Psyllid ID: psy13951


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
FQPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
ccccccccccccccccccccEEEEEEEccccccccccccccHHHHccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEcccHHHHHHHHHHHcccccccccc
ccccEEEEEccccccccccEEEEEEEccccccccccHHHccHHHHHHHccEEEEccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEcHHHHHHHHHHHccHHcccccc
fqpnlpealspdssrtyrRHSVLVIIHgesysfgsgniydgfVLASYANMVVVTFNFRLGilgflrpgvgsstvtnfGIMDQVAALQWIKDniehfggdptsvtlmghgtgaASINFLmlspllspsydi
fqpnlpealspdssrtyRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFlmlspllspsydi
FQPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
*****************RRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSP********
FQPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
**************RTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
FQPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FQPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q69ZK9 836 Neuroligin-2 OS=Mus muscu yes N/A 0.846 0.131 0.482 3e-27
Q62888 836 Neuroligin-2 OS=Rattus no yes N/A 0.846 0.131 0.473 9e-27
Q8NFZ4 835 Neuroligin-2 OS=Homo sapi yes N/A 0.846 0.131 0.473 1e-26
Q8N0W4 816 Neuroligin-4, X-linked OS no N/A 0.784 0.125 0.504 1e-24
Q8NFZ3 816 Neuroligin-4, Y-linked OS no N/A 0.784 0.125 0.504 1e-24
Q62765 843 Neuroligin-1 OS=Rattus no no N/A 0.761 0.117 0.51 1e-24
Q62889 848 Neuroligin-3 OS=Rattus no no N/A 0.761 0.116 0.5 9e-24
B0F2B4 945 Neuroligin 4-like OS=Mus no N/A 0.784 0.107 0.504 1e-23
Q8BYM5 825 Neuroligin-3 OS=Mus muscu no N/A 0.761 0.12 0.5 1e-23
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.761 0.116 0.49 1e-23
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function desciption
 Score =  120 bits (300), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 80/112 (71%), Gaps = 2/112 (1%)

Query: 11  PDSS-RTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGV 69
           PD+  R   +  V++ +HG SY  G+GN++DG VLA+Y N++VVT N+RLG+LGFL  G 
Sbjct: 167 PDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTG- 225

Query: 70  GSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLS 121
             +   N+G++DQ+ AL+W+ +NI HFGGDP  +T+ G G GA+ +N L+LS
Sbjct: 226 DQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILS 277




Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures.
Mus musculus (taxid: 10090)
>sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 Back     alignment and function description
>sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 Back     alignment and function description
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function description
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function description
>sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 Back     alignment and function description
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description
>sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 Back     alignment and function description
>sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
242010064 1372 conserved hypothetical protein [Pediculu 0.815 0.077 0.679 2e-38
350405100 1472 PREDICTED: hypothetical protein LOC10074 0.869 0.076 0.592 2e-37
340718657 1499 PREDICTED: hypothetical protein LOC10064 0.869 0.075 0.592 2e-37
383848940 1503 PREDICTED: uncharacterized protein LOC10 0.869 0.075 0.601 2e-37
328781399 1423 PREDICTED: hypothetical protein LOC72435 0.869 0.079 0.584 3e-36
222354850 809 neuroligin 1 [Apis mellifera] 0.869 0.139 0.575 2e-35
157134466 1252 neuroligin, putative [Aedes aegypti] gi| 0.807 0.083 0.638 5e-35
170041857 1052 neuroligin [Culex quinquefasciatus] gi|1 0.807 0.099 0.638 7e-35
345484731 823 PREDICTED: neuroligin-4, Y-linked [Nason 0.838 0.132 0.616 7e-35
91082045 1208 PREDICTED: similar to neuroligin, putati 0.869 0.093 0.592 1e-34
>gi|242010064|ref|XP_002425796.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509729|gb|EEB13058.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/106 (67%), Positives = 89/106 (83%)

Query: 18  RRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNF 77
           +++ V+V IHGES+ + SGN YDG VL+SY N+VVVT NFRLGILGFL+PG+   TV+NF
Sbjct: 219 KKYPVIVYIHGESFEWNSGNPYDGSVLSSYGNVVVVTINFRLGILGFLKPGLNEHTVSNF 278

Query: 78  GIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPL 123
           G++DQ+A LQWIKDNI  FGGD + VTLMGHGTGAA INFLM+SP+
Sbjct: 279 GLLDQIAGLQWIKDNIGEFGGDSSMVTLMGHGTGAACINFLMVSPV 324




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350405100|ref|XP_003487327.1| PREDICTED: hypothetical protein LOC100740648 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718657|ref|XP_003397780.1| PREDICTED: hypothetical protein LOC100644931 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383848940|ref|XP_003700105.1| PREDICTED: uncharacterized protein LOC100877010 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328781399|ref|XP_001120179.2| PREDICTED: hypothetical protein LOC724358 [Apis mellifera] Back     alignment and taxonomy information
>gi|222354850|gb|ACM48186.1| neuroligin 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|157134466|ref|XP_001656324.1| neuroligin, putative [Aedes aegypti] gi|108881362|gb|EAT45587.1| AAEL003129-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170041857|ref|XP_001848665.1| neuroligin [Culex quinquefasciatus] gi|167865424|gb|EDS28807.1| neuroligin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345484731|ref|XP_003425111.1| PREDICTED: neuroligin-4, Y-linked [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91082045|ref|XP_971146.1| PREDICTED: similar to neuroligin, putative [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0051146 1354 Nlg1 "Neuroligin 1" [Drosophil 0.846 0.081 0.572 1.1e-31
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.884 0.089 0.579 1.7e-29
FB|FBgn0031866 1248 neuroligin "neuroligin" [Droso 0.807 0.084 0.571 1.4e-27
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.792 0.088 0.571 2e-27
ZFIN|ZDB-GENE-090918-2 828 nlgn2a "neuroligin 2a" [Danio 0.815 0.128 0.504 9.2e-26
MGI|MGI:2681835 836 Nlgn2 "neuroligin 2" [Mus musc 0.846 0.131 0.482 9.4e-26
UNIPROTKB|I3LD92 804 NLGN2 "Uncharacterized protein 0.846 0.136 0.473 2.3e-25
UNIPROTKB|E2R9D0 835 NLGN2 "Uncharacterized protein 0.846 0.131 0.473 2.5e-25
RGD|621118 836 Nlgn2 "neuroligin 2" [Rattus n 0.846 0.131 0.473 2.5e-25
ZFIN|ZDB-GENE-090918-3 860 nlgn2b "neuroligin 2b" [Danio 0.815 0.123 0.495 2.7e-25
FB|FBgn0051146 Nlg1 "Neuroligin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 361 (132.1 bits), Expect = 1.1e-31, P = 1.1e-31
 Identities = 63/110 (57%), Positives = 88/110 (80%)

Query:    16 TYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVT 75
             T ++++VLV +HGES+ + SGN YDG VL+SY  ++VVT N+RLG+LGFLRP + +  + 
Sbjct:   273 TPKQYAVLVYLHGESFEWNSGNPYDGSVLSSYGEVIVVTVNYRLGVLGFLRPSIDAHNIA 332

Query:    76 NFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLS 125
             N+ ++DQ+AAL WIK+NIE FGGD + VTLMGH TGAA +N+LM+SP+ S
Sbjct:   333 NYALLDQIAALHWIKENIEAFGGDNSRVTLMGHSTGAACVNYLMVSPVAS 382




GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=IBA;NAS
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0009986 "cell surface" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
GO:0004872 "receptor activity" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031866 neuroligin "neuroligin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090918-2 nlgn2a "neuroligin 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2681835 Nlgn2 "neuroligin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LD92 NLGN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9D0 NLGN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621118 Nlgn2 "neuroligin 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090918-3 nlgn2b "neuroligin 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 2e-45
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 2e-35
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 1e-34
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 2e-09
pfam07859 207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 3e-06
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
 Score =  153 bits (388), Expect = 2e-45
 Identities = 56/116 (48%), Positives = 76/116 (65%), Gaps = 5/116 (4%)

Query: 10  SPDSSRTYRRHSVLVIIHGESYSFGSG--NIYDGFVLASYANMVVVTFNFRLGILGFLRP 67
           +P  +   ++  V+V IHG  +  GS   + YDG  LA+  ++VVVT N+RLG LGFL  
Sbjct: 90  TPKLASESKKLPVMVWIHGGGFQSGSASLDDYDGPDLAASEDVVVVTINYRLGALGFL-- 147

Query: 68  GVGSSTV-TNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSP 122
             G S +  N G++DQV AL+W+KDNI  FGGDP +VTL G   GAAS++ L+LSP
Sbjct: 148 STGDSELPGNAGLLDQVLALRWVKDNIAAFGGDPDNVTLFGESAGAASVSLLLLSP 203


Length = 510

>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.95
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.95
KOG1515|consensus 336 99.94
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.94
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.93
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.91
PRK10162 318 acetyl esterase; Provisional 99.9
KOG1516|consensus 545 99.89
KOG4389|consensus 601 99.87
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.68
KOG4388|consensus 880 99.64
KOG4627|consensus 270 99.63
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 99.62
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.49
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.46
PLN00021 313 chlorophyllase 99.41
PRK10115 686 protease 2; Provisional 99.38
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.34
KOG2100|consensus 755 99.32
PRK10566 249 esterase; Provisional 99.28
PRK13604 307 luxD acyl transferase; Provisional 99.27
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.25
KOG2281|consensus 867 99.24
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.23
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.2
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.16
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 99.13
PLN02298 330 hydrolase, alpha/beta fold family protein 99.11
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.11
PLN02385 349 hydrolase; alpha/beta fold family protein 99.05
PRK10985 324 putative hydrolase; Provisional 99.04
PLN02442 283 S-formylglutathione hydrolase 99.04
COG4099387 Predicted peptidase [General function prediction o 99.04
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.03
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.0
PRK10673 255 acyl-CoA esterase; Provisional 98.96
PLN02652 395 hydrolase; alpha/beta fold family protein 98.95
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.95
PHA02857 276 monoglyceride lipase; Provisional 98.95
PLN02511 388 hydrolase 98.94
KOG1552|consensus258 98.93
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.88
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.87
PRK10749 330 lysophospholipase L2; Provisional 98.87
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 98.86
COG1647 243 Esterase/lipase [General function prediction only] 98.85
PRK05077 414 frsA fermentation/respiration switch protein; Revi 98.84
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.83
PRK00870 302 haloalkane dehalogenase; Provisional 98.81
COG0412236 Dienelactone hydrolase and related enzymes [Second 98.8
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 98.79
PRK11460232 putative hydrolase; Provisional 98.79
PLN02211 273 methyl indole-3-acetate methyltransferase 98.78
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.74
COG2945210 Predicted hydrolase of the alpha/beta superfamily 98.74
KOG3847|consensus 399 98.73
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 98.72
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 98.72
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.71
PLN02965 255 Probable pheophorbidase 98.7
PRK03204 286 haloalkane dehalogenase; Provisional 98.69
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.68
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.67
KOG2564|consensus 343 98.67
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 98.67
COG0400207 Predicted esterase [General function prediction on 98.64
PLN02894 402 hydrolase, alpha/beta fold family protein 98.63
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.63
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.62
PLN02824 294 hydrolase, alpha/beta fold family protein 98.62
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.57
KOG4391|consensus 300 98.56
KOG1455|consensus 313 98.55
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.55
PLN02872 395 triacylglycerol lipase 98.54
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 98.53
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 98.52
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.52
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.5
PRK03592 295 haloalkane dehalogenase; Provisional 98.49
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 98.48
PLN02679 360 hydrolase, alpha/beta fold family protein 98.48
COG4188 365 Predicted dienelactone hydrolase [General function 98.47
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.46
KOG3101|consensus 283 98.44
KOG1838|consensus 409 98.43
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.43
PRK10349 256 carboxylesterase BioH; Provisional 98.43
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.42
PRK05855 582 short chain dehydrogenase; Validated 98.42
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.38
PRK07581 339 hypothetical protein; Validated 98.37
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.36
PLN02578 354 hydrolase 98.33
PRK06489 360 hypothetical protein; Provisional 98.33
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 98.31
KOG4178|consensus 322 98.3
PF00756 251 Esterase: Putative esterase; InterPro: IPR000801 T 98.29
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 98.28
PRK11071190 esterase YqiA; Provisional 98.26
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.24
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 98.23
PF07819 225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.23
KOG4409|consensus 365 98.21
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.2
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 98.19
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.14
KOG1454|consensus 326 98.11
KOG2382|consensus 315 98.1
PF05677 365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.05
PRK08775 343 homoserine O-acetyltransferase; Provisional 98.01
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 98.01
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.0
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.97
PF05990 233 DUF900: Alpha/beta hydrolase of unknown function ( 97.91
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 97.9
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.88
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.8
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 97.79
COG4757 281 Predicted alpha/beta hydrolase [General function p 97.78
COG3150 191 Predicted esterase [General function prediction on 97.76
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 97.76
KOG2237|consensus 712 97.72
PRK07868 994 acyl-CoA synthetase; Validated 97.66
PF05057 217 DUF676: Putative serine esterase (DUF676); InterPr 97.63
COG1770 682 PtrB Protease II [Amino acid transport and metabol 97.63
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.61
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.56
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 97.55
KOG2112|consensus206 97.52
COG2936 563 Predicted acyl esterases [General function predict 97.5
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.49
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 97.47
PF01674 219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.4
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.39
PRK06765 389 homoserine O-acetyltransferase; Provisional 97.33
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 97.31
KOG3975|consensus 301 97.26
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 97.26
COG0627 316 Predicted esterase [General function prediction on 97.24
PF11187 224 DUF2974: Protein of unknown function (DUF2974); In 97.18
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.17
PF03283 361 PAE: Pectinacetylesterase 97.13
PRK04940180 hypothetical protein; Provisional 97.11
KOG4667|consensus 269 97.1
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 97.01
PF08840 213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.99
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 96.93
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 96.92
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 96.84
KOG3724|consensus 973 96.83
KOG4840|consensus 299 96.82
KOG2624|consensus 403 96.76
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 96.74
COG3319 257 Thioesterase domains of type I polyketide synthase 96.69
COG3208 244 GrsT Predicted thioesterase involved in non-riboso 96.68
PF06028 255 DUF915: Alpha/beta hydrolase of unknown function ( 96.65
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 96.64
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 96.64
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.64
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 96.61
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 96.53
KOG3967|consensus297 96.48
PLN02408 365 phospholipase A1 96.37
COG4814 288 Uncharacterized protein with an alpha/beta hydrola 96.27
PLN02454 414 triacylglycerol lipase 96.27
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.17
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 96.04
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.92
PLN02571 413 triacylglycerol lipase 95.87
PLN02324 415 triacylglycerol lipase 95.81
PLN02802 509 triacylglycerol lipase 95.79
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 95.59
PLN02753 531 triacylglycerol lipase 95.56
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 95.49
KOG2183|consensus 492 95.49
PLN02761 527 lipase class 3 family protein 95.42
KOG1553|consensus 517 95.4
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 95.32
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 95.2
PLN02719 518 triacylglycerol lipase 95.1
PLN00413 479 triacylglycerol lipase 95.05
PLN02310 405 triacylglycerol lipase 95.02
TIGR03712 511 acc_sec_asp2 accessory Sec system protein Asp2. Th 94.97
KOG2984|consensus 277 94.97
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 94.75
PLN02209 437 serine carboxypeptidase 94.73
PLN03037 525 lipase class 3 family protein; Provisional 94.68
PLN02934 515 triacylglycerol lipase 94.5
COG1505 648 Serine proteases of the peptidase family S9A [Amin 94.44
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 94.37
PLN02847 633 triacylglycerol lipase 94.14
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 94.03
PLN02162 475 triacylglycerol lipase 93.95
KOG3043|consensus242 93.92
PF039918 Prion_octapep: Copper binding octapeptide repeat; 93.87
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.68
KOG2182|consensus 514 93.04
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 92.99
COG3946 456 VirJ Type IV secretory pathway, VirJ component [In 92.87
KOG4569|consensus 336 92.43
COG3673 423 Uncharacterized conserved protein [Function unknow 92.15
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 92.14
PF08237 225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 91.57
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 91.51
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 91.0
PF09994 277 DUF2235: Uncharacterized alpha/beta hydrolase doma 90.95
KOG1282|consensus 454 90.72
COG5153 425 CVT17 Putative lipase essential for disintegration 88.89
KOG4540|consensus 425 88.89
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 87.27
COG4947227 Uncharacterized protein conserved in bacteria [Fun 87.06
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 86.85
KOG2369|consensus 473 86.72
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 86.12
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 86.1
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 85.9
smart00824 212 PKS_TE Thioesterase. Peptide synthetases are invol 85.68
PF10081 289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 82.02
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 81.99
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
Probab=99.95  E-value=7.9e-29  Score=189.82  Aligned_cols=119  Identities=45%  Similarity=0.813  Sum_probs=96.1

Q ss_pred             CCCCCCCCCceEEEEEeCCCcccCCC--CcchhHHHhhcCCeEEEeeccccccccCCCCCCCCCCCCCccHHHHHHHHHH
Q psy13951         11 PDSSRTYRRHSVLVIIHGESYSFGSG--NIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQW   88 (130)
Q Consensus        11 p~~~~~~~~~Pvvv~iHGGg~~~g~~--~~~~~~~~~~~~g~~vv~~~yrl~~~~~~~~~~~~~~~~~~~~~D~~~a~~~   88 (130)
                      |.......++|||||||||+|..|+.  ..+....++...+++||++||||+++||...........+.++.|++.|++|
T Consensus       116 P~~~~~~~~lPV~v~ihGG~f~~G~~~~~~~~~~~~~~~~~vivVt~nYRlg~~Gfl~~~~~~~~~gN~Gl~Dq~~AL~W  195 (535)
T PF00135_consen  116 PSNASSNSKLPVMVWIHGGGFMFGSGSFPPYDGASLAASKDVIVVTINYRLGAFGFLSLGDLDAPSGNYGLLDQRLALKW  195 (535)
T ss_dssp             ETSSSSTTSEEEEEEE--STTTSSCTTSGGGHTHHHHHHHTSEEEEE----HHHHH-BSSSTTSHBSTHHHHHHHHHHHH
T ss_pred             ccccccccccceEEEeecccccCCCcccccccccccccCCCEEEEEecccccccccccccccccCchhhhhhhhHHHHHH
Confidence            33334444899999999999999998  4555555777789999999999999999987653222489999999999999


Q ss_pred             HHHhhhhhCCCCCCeEEEEcChhHHHHHHHHhCCCCCCCCC
Q psy13951         89 IKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYD  129 (130)
Q Consensus        89 l~~~~~~~~~d~~ri~l~G~SaGg~~a~~~~~~~~~~g~~~  129 (130)
                      +++|+..||+||+||.|+|+||||.++..++++|..+|||.
T Consensus       196 V~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~~LF~  236 (535)
T PF00135_consen  196 VQDNIAAFGGDPDNVTLFGQSAGAASVSLLLLSPSSKGLFH  236 (535)
T ss_dssp             HHHHGGGGTEEEEEEEEEEETHHHHHHHHHHHGGGGTTSBS
T ss_pred             HHhhhhhcccCCcceeeeeecccccccceeeeccccccccc
Confidence            99999999999999999999999999999999999999985



Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....

>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>PF03991 Prion_octapep: Copper binding octapeptide repeat; InterPro: IPR020949 Prion protein (PrP-c) [, , ] is a small glycoprotein found in high quantity in the brain of animals infected with certain degenerative neurological diseases, such as sheep scrapie and bovine spongiform encephalopathy (BSE), and the human dementias Creutzfeldt-Jacob disease (CJD) and Gerstmann-Straussler syndrome (GSS) Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG2182|consensus Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>COG3673 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF09994 DUF2235: Uncharacterized alpha/beta hydrolase domain (DUF2235); InterPro: IPR018712 This domain has no known function Back     alignment and domain information
>KOG1282|consensus Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540|consensus Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>KOG2369|consensus Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 2e-28
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 4e-26
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 2e-25
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 2e-24
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 2e-24
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 1e-23
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 3e-23
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 4e-23
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 4e-23
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 4e-23
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-21
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-21
1qe3_A 489 Pnb Esterase Length = 489 1e-19
1c7j_A 489 Pnb Esterase 56c8 Length = 489 2e-19
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 2e-19
1aql_A 532 Crystal Structure Of Bovine Bile-Salt Activated Lip 3e-19
1jmy_A 522 Truncated Recombinant Human Bile Salt Stimulated Li 4e-19
1f6w_A 533 Structure Of The Catalytic Domain Of Human Bile Sal 4e-19
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 4e-19
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 5e-19
2bce_A 579 Cholesterol Esterase From Bos Taurus Length = 579 6e-19
1akn_A 579 Structure Of Bile-salt Activated Lipase Length = 57 7e-19
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 7e-19
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 7e-19
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 7e-19
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 7e-19
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 8e-19
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 8e-19
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 8e-19
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 8e-19
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 8e-19
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 1e-18
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 1e-18
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 1e-18
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 1e-18
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 2e-18
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 2e-18
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 3e-18
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 3e-18
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 3e-18
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 2e-17
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 2e-17
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 2e-17
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 2e-17
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 2e-17
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 2e-17
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 2e-17
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 2e-17
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 2e-17
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 2e-17
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 2e-17
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 2e-17
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 3e-17
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 3e-17
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 1e-16
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-16
1eea_A 534 Acetylcholinesterase Length = 534 1e-16
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-16
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 1e-16
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 1e-16
2cek_A 535 Conformational Flexibility In The Peripheral Site O 1e-16
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 2e-16
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 2e-16
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 2e-16
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 2e-16
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 7e-16
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 7e-16
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 7e-16
2jgj_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 7e-16
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 8e-16
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 4e-15
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 5e-15
1ukc_A 522 Crystal Structure Of Aspergillus Niger Esta Length 2e-13
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 1e-11
1gz7_A 534 Crystal Structure Of The Closed State Of Lipase 2 F 3e-10
1lpm_A 549 A Structural Basis For The Chiral Preferences Of Li 9e-09
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 9e-09
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 9e-09
1crl_A 534 Insights Into Interfacial Activation From An 'open' 1e-08
2c7b_A 311 The Crystal Structure Of Este1, A New Thermophilic 4e-04
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure

Iteration: 1

Score = 120 bits (301), Expect = 2e-28, Method: Composition-based stats. Identities = 54/112 (48%), Positives = 80/112 (71%), Gaps = 2/112 (1%) Query: 11 PDSS-RTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGV 69 PD+ R + V++ +HG SY G+GN++DG VLA+Y N++VVT N+RLG+LGFL G Sbjct: 128 PDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTG- 186 Query: 70 GSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLS 121 + N+G++DQ+ AL+W+ +NI HFGGDP +T+ G G GA+ +N L+LS Sbjct: 187 DQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILS 238
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1AQL|A Chain A, Crystal Structure Of Bovine Bile-Salt Activated Lipase Complexed With Taurocholate Length = 532 Back     alignment and structure
>pdb|1JMY|A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase Length = 522 Back     alignment and structure
>pdb|1F6W|A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase Length = 533 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2BCE|A Chain A, Cholesterol Esterase From Bos Taurus Length = 579 Back     alignment and structure
>pdb|1AKN|A Chain A, Structure Of Bile-salt Activated Lipase Length = 579 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 4e-49
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 8e-49
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 3e-48
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 1e-47
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 1e-47
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 2e-47
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 1e-45
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 1e-44
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 2e-43
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 5e-41
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 4e-40
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 1e-37
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 2e-36
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 3e-07
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 1e-06
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 4e-06
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 5e-06
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 1e-05
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 2e-05
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 4e-05
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 9e-05
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 2e-04
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 2e-04
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 2e-04
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 4e-04
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 4e-04
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
 Score =  163 bits (415), Expect = 4e-49
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 8/130 (6%)

Query: 2   QPNLPEALSPDSSRTYRRHSVLVIIHGESYSFGSGN--IYDGFVLASYANMVVVTFNFRL 59
                   + +   T     +L+ I+G  +  GS    IY+  ++A+  N++V +F +R+
Sbjct: 123 ADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRV 182

Query: 60  GILGFLRPG-VGSSTVT-----NFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAA 113
           G  GFL       S        N G+ DQ  A++W+KDN   FGG+P  +TL G   G++
Sbjct: 183 GAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSS 242

Query: 114 SINFLMLSPL 123
           S+N  ++SP+
Sbjct: 243 SVNAQLMSPV 252


>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.94
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.93
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.93
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.93
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.93
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.93
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.92
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.92
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.92
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.92
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.91
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.91
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.9
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.87
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.87
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.86
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.86
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.85
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 99.83
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.82
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.82
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.82
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.81
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 99.8
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.8
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.8
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.78
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 99.78
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.76
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 99.75
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 99.75
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 99.73
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 99.7
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.7
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 99.65
3h04_A 275 Uncharacterized protein; protein with unknown func 99.63
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.52
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.51
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.49
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 99.49
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 99.48
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.47
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.46
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.46
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.45
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.44
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.44
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.43
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 99.42
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.41
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.41
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.41
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.41
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.39
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.38
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.38
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.38
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.38
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 99.37
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.36
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.36
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.36
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.35
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.34
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 99.34
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 99.33
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 99.33
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.33
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 99.33
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.32
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 99.32
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.31
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.31
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.31
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.3
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.3
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 99.29
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.29
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.29
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 99.28
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.28
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.26
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.26
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.24
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.24
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 99.22
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.22
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.21
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.21
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 99.21
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.2
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 99.2
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.19
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.18
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.18
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 99.18
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.18
3llc_A 270 Putative hydrolase; structural genomics, joint cen 99.17
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.16
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.15
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.15
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.14
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.13
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.12
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.12
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.09
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.09
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.07
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.07
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.06
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.06
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 99.05
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.03
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.02
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.01
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 99.01
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.01
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.0
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 99.0
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.0
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.0
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.99
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 98.99
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.98
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 98.98
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.98
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.98
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.98
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.98
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.97
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.97
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.97
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 98.97
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.96
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.96
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 98.96
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.96
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.96
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.95
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.95
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.94
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.94
1r3d_A 264 Conserved hypothetical protein VC1974; structural 98.94
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 98.94
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 98.94
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.94
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.94
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.93
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 98.93
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.93
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 98.93
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.93
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 98.93
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.93
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.93
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.92
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.91
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.91
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.91
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.91
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.91
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.91
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 98.91
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.91
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.9
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.9
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 98.9
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 98.89
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.89
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.89
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.88
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.88
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.88
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.88
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 98.88
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 98.87
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.87
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.87
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.85
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.85
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 98.84
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.84
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.84
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.84
1iup_A 282 META-cleavage product hydrolase; aromatic compound 98.84
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.83
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 98.83
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.83
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.83
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 98.81
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.81
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.81
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 98.81
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.8
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 98.8
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.8
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.78
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.78
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.76
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.76
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 98.76
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.75
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.74
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.73
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 98.73
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.71
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.69
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.69
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 98.69
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.68
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.65
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.64
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 98.64
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.63
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 98.62
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 98.62
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.62
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 98.6
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 98.58
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.55
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.55
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.91
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.48
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 98.47
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 98.42
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.42
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 98.42
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.39
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.37
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 98.37
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 98.36
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.35
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.29
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 98.19
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.18
3lp5_A 250 Putative cell surface hydrolase; structural genom 98.1
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 98.0
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 97.97
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 97.87
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 97.84
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 97.76
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 97.68
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.66
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.64
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 97.35
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.26
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.24
1tia_A 279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.19
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 96.94
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 96.76
1tib_A 269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.45
1lgy_A 269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.33
1uwc_A 261 Feruloyl esterase A; hydrolase, serine esterase, x 96.22
4az3_A 300 Lysosomal protective protein 32 kDa chain; hydrola 96.18
3g7n_A 258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 95.9
1tgl_A 269 Triacyl-glycerol acylhydrolase; carboxylic esteras 95.89
3uue_A 279 LIP1, secretory lipase (family 3); LID-domain, hyd 95.86
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 95.81
1gxs_A 270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 95.73
3o0d_A 301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 95.62
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 93.11
2ory_A 346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 93.77
3hc7_A 254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 93.16
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 92.78
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 89.93
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 89.9
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 84.39
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 82.67
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 81.8
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 81.79
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
Probab=99.94  E-value=9.9e-27  Score=178.59  Aligned_cols=113  Identities=45%  Similarity=0.810  Sum_probs=100.3

Q ss_pred             CCCCceEEEEEeCCCcccCCCCcchhHHHhhcCCeEEEeeccccccccCCCCCCCCCCCCCccHHHHHHHHHHHHHhhhh
Q psy13951         16 TYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWIKDNIEH   95 (130)
Q Consensus        16 ~~~~~Pvvv~iHGGg~~~g~~~~~~~~~~~~~~g~~vv~~~yrl~~~~~~~~~~~~~~~~~~~~~D~~~a~~~l~~~~~~   95 (130)
                      ..+++|||||||||||..|+...+....++.+.|++||++|||++++||+.... .....+.++.|+.+|++|+++++..
T Consensus       111 ~~~~~Pv~v~iHGG~~~~g~~~~~~~~~la~~~g~vvv~~nYRlg~~gf~~~~~-~~~~~n~gl~D~~~al~wv~~ni~~  189 (542)
T 2h7c_A          111 KKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGD-EHSRGNWGHLDQVAALRWVQDNIAS  189 (542)
T ss_dssp             SCCCEEEEEEECCSTTTSCCSTTSCCHHHHHHHTCEEEEECCCCHHHHHCCCSS-TTCCCCHHHHHHHHHHHHHHHHGGG
T ss_pred             CCCCCCEEEEECCCcccCCCccccCHHHHHhcCCEEEEecCCCCccccCCCCCc-ccCccchhHHHHHHHHHHHHHHHHH
Confidence            346789999999999999998877666677778999999999999999887654 3556788999999999999999999


Q ss_pred             hCCCCCCeEEEEcChhHHHHHHHHhCCCCCCCCC
Q psy13951         96 FGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYD  129 (130)
Q Consensus        96 ~~~d~~ri~l~G~SaGg~~a~~~~~~~~~~g~~~  129 (130)
                      |++|++||+|+|+|+||++++.+++++..+++|.
T Consensus       190 fggDp~~Vtl~G~SaGg~~~~~~~~~~~~~~lf~  223 (542)
T 2h7c_A          190 FGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFH  223 (542)
T ss_dssp             GTEEEEEEEEEEETHHHHHHHHHHHCGGGTTSCS
T ss_pred             cCCCccceEEEEechHHHHHHHHHhhhhhhHHHH
Confidence            9999999999999999999999999887777764



>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 1e-16
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 2e-15
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 2e-13
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 4e-13
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 1e-12
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 1e-12
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 3e-10
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 4e-10
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 9e-10
d1jjia_ 311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 0.001
d1lzla_ 317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 0.003
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Mammalian carboxylesterase (liver carboxylesterase I)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.4 bits (176), Expect = 1e-16
 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 1/114 (0%)

Query: 10  SPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGV 69
           +P       R  V+V IHG     G+ + YDG  LA++ N+VVVT  +RLGI GF     
Sbjct: 103 TPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFF-STG 161

Query: 70  GSSTVTNFGIMDQVAALQWIKDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPL 123
              +  N+G +DQVAAL+W++DNI  FGG+P SVT+ G   G  S++ L+LSPL
Sbjct: 162 DEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPL 215


>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.96
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.95
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.95
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.95
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.95
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.95
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.94
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.94
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.94
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.94
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.92
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.92
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.89
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 99.89
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.88
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.84
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.75
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.66
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 99.56
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.46
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.39
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.36
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.36
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.34
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.31
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.25
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.2
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.14
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.11
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.11
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 99.1
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.1
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.09
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.09
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.08
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 99.08
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.07
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.07
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 99.05
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.05
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.03
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.03
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.03
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.0
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 99.0
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.0
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.99
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.98
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 98.97
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.96
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.96
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.95
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.94
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.94
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.92
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.9
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.88
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.86
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.85
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.85
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.85
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.84
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.82
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.81
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.8
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.79
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.78
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.74
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.74
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 98.72
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.72
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.71
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 98.71
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.71
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 98.6
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.6
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.6
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.56
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 98.54
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 98.42
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.37
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.36
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.31
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.26
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.17
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.1
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.86
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 97.85
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 97.64
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.46
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.38
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 97.24
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.78
d1lgya_ 265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.14
d1tiba_ 269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.07
d1tiaa_ 271 Triacylglycerol lipase {Penicillium camembertii [T 96.06
d1uwca_ 261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.0
d3tgla_ 265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.88
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 95.82
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 95.57
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 94.75
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 91.6
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 89.31
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 85.81
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 80.88
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Mammalian carboxylesterase (liver carboxylesterase I)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=7.2e-30  Score=192.65  Aligned_cols=119  Identities=44%  Similarity=0.789  Sum_probs=106.6

Q ss_pred             CCCCCCCCCCceEEEEEeCCCcccCCCCcchhHHHhhcCCeEEEeeccccccccCCCCCCCCCCCCCccHHHHHHHHHHH
Q psy13951         10 SPDSSRTYRRHSVLVIIHGESYSFGSGNIYDGFVLASYANMVVVTFNFRLGILGFLRPGVGSSTVTNFGIMDQVAALQWI   89 (130)
Q Consensus        10 ~p~~~~~~~~~Pvvv~iHGGg~~~g~~~~~~~~~~~~~~g~~vv~~~yrl~~~~~~~~~~~~~~~~~~~~~D~~~a~~~l   89 (130)
                      +|......+++|||||||||+|..|+...++...++...+++||++||||+.+||+.... ...+.+.++.|++.||+||
T Consensus       103 ~P~~~~~~~~lPV~v~ihGG~~~~gs~~~~~~~~~~~~~~vIvVt~nYRLg~~GFl~~~~-~~~~gN~Gl~Dq~~AL~WV  181 (532)
T d2h7ca1         103 TPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGD-EHSRGNWGHLDQVAALRWV  181 (532)
T ss_dssp             ECSCTTSCCCEEEEEEECCSTTTSCCSTTSCCHHHHHHHTCEEEEECCCCHHHHHCCCSS-TTCCCCHHHHHHHHHHHHH
T ss_pred             ECCCCCCCCCcEEEEEEeCCcccccccccCCchhhhhcCceEEEEEeeccCCCccccccc-cccccccccHHHHHHHHHH
Confidence            344445667899999999999999999887777777778999999999999999988765 4567899999999999999


Q ss_pred             HHhhhhhCCCCCCeEEEEcChhHHHHHHHHhCCCCCCCCC
Q psy13951         90 KDNIEHFGGDPTSVTLMGHGTGAASINFLMLSPLLSPSYD  129 (130)
Q Consensus        90 ~~~~~~~~~d~~ri~l~G~SaGg~~a~~~~~~~~~~g~~~  129 (130)
                      ++|+..||+||+||.|+|+||||..+..++++|..++||.
T Consensus       182 ~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~~LF~  221 (532)
T d2h7ca1         182 QDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFH  221 (532)
T ss_dssp             HHHGGGGTEEEEEEEEEEETHHHHHHHHHHHCGGGTTSCS
T ss_pred             HHHHHHhcCCcceeeeeccccccchHHHHHhhhhccCcch
Confidence            9999999999999999999999999999999999999985



>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure