Psyllid ID: psy14049

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MSTVCFRYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGSL
ccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHEEccHHHHHHHHHccccccccc
ccHHHHHHHcccccHHHHccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHEEEHHHHHHHHHHHccccccccccc
mstvcfryksgqnhltefigmepskkrkrrtsfTPQALELLNAHfernthpsgteiTTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGSL
mstvcfryksgqnhltefigmepskkrkrRTSFTPQALELLNAhfernthpsgtEITTLAHQLGYEREVIRIWFCNKRQALkntvrmmskgsl
MSTVCFRYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGSL
****CFRY*******************************LLNAHF*******GTEITTLAHQLGYEREVIRIWFCNKRQAL************
*******************************SFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCN*****************
MSTVCFRYKSGQNHLTEFIGME*********SFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGSL
*******************************SFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKN**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVCFRYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
P78424691 POU domain, class 6, tran no N/A 0.903 0.121 0.702 4e-32
Q8BJI4691 POU domain, class 6, tran yes N/A 0.903 0.121 0.702 5e-32
P31367610 POU domain, class 6, tran no N/A 0.849 0.129 0.632 2e-27
P56223301 POU domain, class 6, tran yes N/A 0.881 0.272 0.634 6e-27
Q07916301 POU domain, class 6, tran no N/A 0.881 0.272 0.634 1e-26
Q14863301 POU domain, class 6, tran no N/A 0.881 0.272 0.634 1e-26
Q17237351 Silk gland factor 3 OS=Bo N/A N/A 0.623 0.165 0.482 1e-09
B3DM23423 POU domain, class 5, tran no N/A 0.709 0.156 0.424 1e-09
P31360445 POU domain, class 3, tran no N/A 0.688 0.143 0.462 1e-09
P20265443 POU domain, class 3, tran no N/A 0.688 0.144 0.462 1e-09
>sp|P78424|PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens GN=POU6F2 PE=1 SV=3 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 75/84 (89%)

Query: 7   RYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYE 66
           R+++G  +LTEFIG EPSKKRKRRTSFTPQALE+LNAHFE+NTHPSG E+T +A +L Y+
Sbjct: 588 RHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYD 647

Query: 67  REVIRIWFCNKRQALKNTVRMMSK 90
           REV+R+WFCNKRQALKNT++ + +
Sbjct: 648 REVVRVWFCNKRQALKNTIKRLKQ 671
Probable transcription factor likely to be involved in early steps in the differentiation of amacrine and ganglion cells. Recognizes and binds to the DNA sequence 5'-ATGCAAAT-3'. Isoform 1 does not bind DNA.
Homo sapiens (taxid: 9606)
>sp|Q8BJI4|PO6F2_MOUSE POU domain, class 6, transcription factor 2 OS=Mus musculus GN=Pou6f2 PE=2 SV=1 Back     alignment and function description
>sp|P31367|PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio GN=pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|P56223|PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus GN=Pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|Q07916|PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus GN=Pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|Q14863|PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens GN=POU6F1 PE=1 SV=1 Back     alignment and function description
>sp|Q17237|SGF3_BOMMO Silk gland factor 3 OS=Bombyx mori GN=SGF3 PE=2 SV=1 Back     alignment and function description
>sp|B3DM23|P5F13_XENTR POU domain, class 5, transcription factor 1.3 OS=Xenopus tropicalis GN=pou5f1.3 PE=2 SV=1 Back     alignment and function description
>sp|P31360|PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus GN=Pou3f2 PE=2 SV=1 Back     alignment and function description
>sp|P20265|PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens GN=POU3F2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
357615452 604 hypothetical protein KGM_18821 [Danaus p 0.913 0.140 0.964 4e-44
194753093 1013 GF12353 [Drosophila ananassae] gi|190620 0.913 0.083 0.952 7e-44
320543660 1291 pou domain motif 3, isoform C [Drosophil 0.913 0.065 0.952 8e-44
194863499 1008 GG23353 [Drosophila erecta] gi|190662338 0.913 0.084 0.952 9e-44
195474695 1002 GE19193 [Drosophila yakuba] gi|194175726 0.913 0.084 0.952 9e-44
195332458 1049 GM21028 [Drosophila sechellia] gi|194124 0.913 0.081 0.952 9e-44
195123414 1167 GI18690 [Drosophila mojavensis] gi|19391 0.913 0.072 0.952 9e-44
24586577 994 pou domain motif 3, isoform A [Drosophil 0.913 0.085 0.952 1e-43
195581519 1046 GD10557 [Drosophila simulans] gi|1941925 0.913 0.081 0.952 1e-43
195381827 1080 GJ21706 [Drosophila virilis] gi|19414444 0.913 0.078 0.952 1e-43
>gi|357615452|gb|EHJ69664.1| hypothetical protein KGM_18821 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  181 bits (459), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 83/85 (97%)

Query: 7   RYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYE 66
           RY SGQNHLT+FIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEIT LAHQLGYE
Sbjct: 518 RYASGQNHLTDFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYE 577

Query: 67  REVIRIWFCNKRQALKNTVRMMSKG 91
           REVIRIWFCNKRQALKNTVRMMSKG
Sbjct: 578 REVIRIWFCNKRQALKNTVRMMSKG 602

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194753093|ref|XP_001958853.1| GF12353 [Drosophila ananassae] gi|190620151|gb|EDV35675.1| GF12353 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|320543660|ref|NP_001137617.2| pou domain motif 3, isoform C [Drosophila melanogaster] gi|318068543|gb|ACL83071.2| pou domain motif 3, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194863499|ref|XP_001970471.1| GG23353 [Drosophila erecta] gi|190662338|gb|EDV59530.1| GG23353 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195474695|ref|XP_002089625.1| GE19193 [Drosophila yakuba] gi|194175726|gb|EDW89337.1| GE19193 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195332458|ref|XP_002032914.1| GM21028 [Drosophila sechellia] gi|194124884|gb|EDW46927.1| GM21028 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195123414|ref|XP_002006202.1| GI18690 [Drosophila mojavensis] gi|193911270|gb|EDW10137.1| GI18690 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|24586577|ref|NP_610377.1| pou domain motif 3, isoform A [Drosophila melanogaster] gi|21483222|gb|AAM52586.1| AT16994p [Drosophila melanogaster] gi|23240375|gb|AAF59100.3| pou domain motif 3, isoform A [Drosophila melanogaster] gi|220942388|gb|ACL83737.1| pdm3-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195581519|ref|XP_002080581.1| GD10557 [Drosophila simulans] gi|194192590|gb|EDX06166.1| GD10557 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195381827|ref|XP_002049645.1| GJ21706 [Drosophila virilis] gi|194144442|gb|EDW60838.1| GJ21706 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
FB|FBgn02615881051 pdm3 "pou domain motif 3" [Dro 0.913 0.080 0.952 1.7e-39
UNIPROTKB|F1NBF5290 POU6F2 "Uncharacterized protei 0.903 0.289 0.702 4.2e-31
UNIPROTKB|F1LZY2280 Pou6f2 "Protein Pou6f2" [Rattu 0.903 0.3 0.702 4.2e-31
UNIPROTKB|H0YK27636 POU6F2 "POU domain, class 6, t 0.903 0.132 0.702 2.2e-30
UNIPROTKB|E1C0A7673 POU6F2 "Uncharacterized protei 0.903 0.124 0.702 2.7e-30
UNIPROTKB|P78424691 POU6F2 "POU domain, class 6, t 0.903 0.121 0.702 2.9e-30
MGI|MGI:2443631691 Pou6f2 "POU domain, class 6, t 0.903 0.121 0.702 2.9e-30
ZFIN|ZDB-GENE-091118-71694 pou6f2 "POU class 6 homeobox 2 0.903 0.121 0.702 2.9e-30
UNIPROTKB|F1P7L3688 POU6F2 "Uncharacterized protei 0.903 0.122 0.702 4.7e-30
UNIPROTKB|Q14863301 POU6F1 "POU domain, class 6, t 0.870 0.269 0.641 8.4e-26
FB|FBgn0261588 pdm3 "pou domain motif 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 432 (157.1 bits), Expect = 1.7e-39, P = 1.7e-39
 Identities = 81/85 (95%), Positives = 84/85 (98%)

Query:     7 RYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYE 66
             RYKSGQNHLT++IG+EPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEIT LAHQLGYE
Sbjct:   965 RYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYE 1024

Query:    67 REVIRIWFCNKRQALKNTVRMMSKG 91
             REVIRIWFCNKRQALKNTVRMMSKG
Sbjct:  1025 REVIRIWFCNKRQALKNTVRMMSKG 1049
GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007608 "sensory perception of smell" evidence=IMP
GO:0007409 "axonogenesis" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007412 "axon target recognition" evidence=IMP
UNIPROTKB|F1NBF5 POU6F2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LZY2 Pou6f2 "Protein Pou6f2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0YK27 POU6F2 "POU domain, class 6, transcription factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0A7 POU6F2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P78424 POU6F2 "POU domain, class 6, transcription factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2443631 Pou6f2 "POU domain, class 6, transcription factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091118-71 pou6f2 "POU class 6 homeobox 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7L3 POU6F2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14863 POU6F1 "POU domain, class 6, transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P56223PO6F1_RATNo assigned EC number0.63410.88170.2724yesN/A
Q8BJI4PO6F2_MOUSENo assigned EC number0.70230.90320.1215yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-17
smart0038957 smart00389, HOX, Homeodomain 2e-15
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 67.9 bits (167), Expect = 5e-17
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 27 RKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKN 83
          R++RT+FTP+ LE L   FE+N +PS  E   LA +LG     +++WF N+R   K 
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0488|consensus309 99.84
KOG0850|consensus245 99.83
KOG0489|consensus261 99.83
KOG0484|consensus125 99.82
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.81
KOG0842|consensus307 99.8
KOG0843|consensus197 99.79
KOG2251|consensus 228 99.79
KOG0493|consensus342 99.78
KOG0485|consensus268 99.76
KOG0494|consensus 332 99.76
KOG0487|consensus308 99.76
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.72
KOG0492|consensus246 99.72
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.72
KOG0848|consensus317 99.7
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.69
COG5576156 Homeodomain-containing transcription factor [Trans 99.65
KOG0491|consensus194 99.64
KOG0483|consensus198 99.64
KOG0844|consensus 408 99.63
KOG3802|consensus398 99.62
KOG0486|consensus 351 99.59
KOG4577|consensus 383 99.56
KOG0847|consensus288 99.5
KOG0490|consensus 235 99.36
KOG0849|consensus 354 99.33
KOG0775|consensus304 99.29
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.13
KOG1168|consensus385 99.06
KOG0774|consensus334 99.01
KOG2252|consensus558 98.98
KOG0490|consensus235 98.44
KOG1146|consensus 1406 98.14
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.89
KOG0773|consensus342 97.72
KOG3623|consensus 1007 97.04
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 96.13
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 92.34
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 89.28
KOG1146|consensus 1406 88.91
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 88.1
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 88.02
PF1066860 Phage_terminase: Phage terminase small subunit; In 87.71
PRK03975141 tfx putative transcriptional regulator; Provisiona 86.24
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 85.15
PRK11924179 RNA polymerase sigma factor; Provisional 84.52
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 84.19
PF1351852 HTH_28: Helix-turn-helix domain 82.7
PRK09639166 RNA polymerase sigma factor SigX; Provisional 82.3
PRK06759154 RNA polymerase factor sigma-70; Validated 81.37
PRK05602186 RNA polymerase sigma factor; Reviewed 80.56
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 80.14
>KOG0488|consensus Back     alignment and domain information 
Probab=99.84  E-value=5.8e-21  Score=130.92  Aligned_cols=67  Identities=31%  Similarity=0.486  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHHHHHHHHhhHhhhc
Q psy14049         21 MEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRM   87 (93)
Q Consensus        21 ~~~~k~rr~r~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WFqnrR~k~kr~~~~   87 (93)
                      ..++|.|+.||.||..|+..||..|+...|++..+|..||..|||+..||++||||||+|||++...
T Consensus       167 ~~pkK~RksRTaFT~~Ql~~LEkrF~~QKYLS~~DR~~LA~~LgLTdaQVKtWfQNRRtKWKrq~a~  233 (309)
T KOG0488|consen  167 STPKKRRKSRTAFSDHQLFELEKRFEKQKYLSVADRIELAASLGLTDAQVKTWFQNRRTKWKRQTAE  233 (309)
T ss_pred             CCCcccccchhhhhHHHHHHHHHHHHHhhcccHHHHHHHHHHcCCchhhHHHHHhhhhHHHHHHHHh
Confidence            3457888999999999999999999999999999999999999999999999999999999998765

>KOG0850|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 4e-27
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 9e-11
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 5e-10
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 5e-10
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 6e-10
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 8e-10
1pog_A67 Solution Structure Of The Oct-1 Pou-Homeo Domain De 1e-09
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 6e-09
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 1e-08
1hdp_A63 Solution Structure Of A Pou-Specific Homeodomain: 3 4e-08
1ocp_A67 Solution Structure Of Oct3 Pou-Homeodomain Length = 2e-07
3l1p_A155 Pou Protein:dna Complex Length = 155 7e-07
2da3_A80 Solution Structure Of The Third Homeobox Domain Of 1e-06
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 2e-05
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 5e-04
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 6e-04
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 6e-04
3nar_A96 Crystal Structure Of Zhx1 Hd4 (Zinc-Fingers And Hom 8e-04
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 9e-04
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure 
Iteration: 1

 Score =  116 bits (290), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 65/84 (77%)
Query: 1   MSTVCFRYKSGQNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLA 60
           ++    R + GQ +L EF+G EPSKKRKRRTSFTPQA+E LNA+FE+N  P+G EIT  A
Sbjct: 68  LNEAELRNQEGQQNLXEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEXA 127
Query: 61  HQLGYEREVIRIWFCNKRQALKNT 84
            +L Y+REV+R+WF N+RQ LKNT
Sbjct: 128 KELNYDREVVRVWFSNRRQTLKNT 151
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure
>pdb|1POG|A Chain A, Solution Structure Of The Oct-1 Pou-Homeo Domain Determined By Nmr And Restrained Molecular Dynamics Length = 67 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|1HDP|A Chain A, Solution Structure Of A Pou-Specific Homeodomain: 3d-Nmr Studies Of Human B-Cell Transcription Factor Oct-2 Length = 63 Back     alignment and structure
>pdb|1OCP|A Chain A, Solution Structure Of Oct3 Pou-Homeodomain Length = 67 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure
>pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|3NAR|A Chain A, Crystal Structure Of Zhx1 Hd4 (Zinc-Fingers And Homeoboxes Protein 1, Homeodomain 4) Length = 96 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-23
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-21
1e3o_C160 Octamer-binding transcription factor 1; transcript 9e-21
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-20
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-19
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-16
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-13
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-10
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-10
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-10
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 4e-10
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-09
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-08
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-08
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 7e-08
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 8e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-07
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-07
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-07
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 4e-07
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-07
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 7e-07
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 1e-06
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-06
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-06
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 6e-06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 6e-06
3a01_A93 Homeodomain-containing protein; homeodomain, prote 6e-06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 9e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-05
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-05
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-05
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 6e-05
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 6e-05
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-04
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 3e-04
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 4e-04
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 7e-04
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 7e-04
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
 Score = 87.0 bits (215), Expect = 1e-23
 Identities = 49/73 (67%), Positives = 61/73 (83%)

Query: 12  QNHLTEFIGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIR 71
           Q +L EF+G EPSKKRKRRTSFTPQA+E LNA+FE+N  P+G EIT +A +L Y+REV+R
Sbjct: 79  QQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEMAKELNYDREVVR 138

Query: 72  IWFCNKRQALKNT 84
           +WF N+RQ LKNT
Sbjct: 139 VWFSNRRQTLKNT 151
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.9
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.9
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.89
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.89
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.89
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.89
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.89
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.89
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.89
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.89
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.89
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.89
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.89
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.89
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.89
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.88
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.88
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.88
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.88
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.88
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.88
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.88
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.88
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.88
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.88
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.87
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.87
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.87
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.87
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.87
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.87
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.87
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.87
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.87
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.87
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.87
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.86
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.86
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.86
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.86
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.86
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.86
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.86
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.86
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.86
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.86
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.86
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.86
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.86
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.85
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.84
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.84
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.84
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.83
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.83
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.83
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.83
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.83
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.82
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.82
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.82
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.82
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.82
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.82
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.81
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.81
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.8
2e19_A64 Transcription factor 8; homeobox domain, structura 99.79
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.79
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.78
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.78
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.78
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.69
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.66
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.64
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.64
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.52
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.87
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 97.12
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 92.6
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 91.36
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 88.19
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 87.61
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 84.26
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 82.18
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 80.66
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=2.4e-23  Score=117.18  Aligned_cols=68  Identities=29%  Similarity=0.434  Sum_probs=62.2

Q ss_pred             cCCCCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHHHHHHHHhhHhhh
Q psy14049         19 IGMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVR   86 (93)
Q Consensus        19 ~~~~~~k~rr~r~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WFqnrR~k~kr~~~   86 (93)
                      .+...++.++.|+.|+..|+..|+..|..++||+..++..||..+||++.+|++||||||+++|+...
T Consensus        10 ~~~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~~   77 (80)
T 2dmt_A           10 PGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGP   77 (80)
T ss_dssp             SCCCCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCCS
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcccC
Confidence            34445677888999999999999999999999999999999999999999999999999999998654
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-14
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-13
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 5e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 6e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-11
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-11
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 5e-11
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 7e-11
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-10
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-10
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-10
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-10
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 8e-10
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 8e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-09
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-09
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 4e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 7e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-05
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 58.7 bits (142), Expect = 7e-14
 Identities = 16/71 (22%), Positives = 28/71 (39%)

Query: 20 GMEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQ 79
           +     RK+R  +T      L   F  N + +      +A  L      ++IWF N+R 
Sbjct: 7  WLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRM 66

Query: 80 ALKNTVRMMSK 90
           +K   +  +K
Sbjct: 67 KMKKINKDRAK 77
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.92
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.91
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.91
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.91
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.91
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.91
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.91
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.9
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.9
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.9
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.9
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.9
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.89
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.89
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.88
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.88
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.87
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.87
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.87
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.87
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.86
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.85
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.84
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.83
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.82
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.81
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.79
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.79
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.77
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.76
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.76
d1hlva166 DNA-binding domain of centromere binding protein B 94.77
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 90.98
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 86.73
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 85.52
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 81.14
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 81.0
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 80.64
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeotic bicoid protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.92  E-value=1e-24  Score=117.68  Aligned_cols=65  Identities=25%  Similarity=0.446  Sum_probs=59.9

Q ss_pred             CCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHHHHHHHHhhHhhhcccC
Q psy14049         26 KRKRRTSFTPQALELLNAHFERNTHPSGTEITTLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK   90 (93)
Q Consensus        26 ~rr~r~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WFqnrR~k~kr~~~~~~~   90 (93)
                      +++.|+.||.+|+..|+..|..++||+..++..||..+||++.+|++||||+|+++|+.......
T Consensus         1 Prr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~~V~iWFqNrR~k~kk~~~~~~~   65 (67)
T d1zq3p1           1 PRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKD   65 (67)
T ss_dssp             CSCCSCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             CCCCCCcCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCCccceeeccccHHHhHhhhhhhccc
Confidence            35678999999999999999999999999999999999999999999999999999997765543
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure