Psyllid ID: psy14051

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIANLQSMAQPNPLFNNNGAEDA
ccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccEEccccccccccccEEEEEcccHHHHHHHHHHHHHccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccEEEEEccHHHHHHHHHHHEccccccHEEEEEEEEEcccccccccEEEEcccccEEEHHHHHHHHHHcccccccccccccc
MVDGINLDEIKEFAKAFKLRRLSLgltqtqvgqalsvtegpaysQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQNTMFeklditpksaQKIKPVLERWMKEAEERQVmsnmpgiispplisqnqnmvnaplnlslnsnavsanfhpnvnprtdlknpsagstlpatnmphFILASGQLVqgiqgaqllipttqgittqtiltipvnnvtsnqpvnlalnnGQVISTTIANLqsmaqpnplfnnngaeda
MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQNTMFEklditpksaqkiKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIANLQsmaqpnplfnnngaeda
MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASqqqqqqqqqhqqqqqqqNTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMvnaplnlslnsnavsanFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAqllipttqgittqtiltipVNNVTSNQPVNLALNNGQVISTTIANLQSMAQPNPLFNNNGAEDA
******LDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAA******************************************************************************************************************MPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIAN*******************
*****NLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQ********************NTMFEKLDITPKSAQKIKPVLE**************************************************************************FI****************************LTIPVNNVTSNQPVNLALNNGQVISTTIANLQ*****************
MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAA**********************TMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIANLQSMAQPNPLFNNNGAEDA
***GINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAEER**MSN**GIIS*********MVNAPLNLSLNSNAVSANFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIANLQSMAQP************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAxxxxxxxxxxxxxxxxxxxxxxxTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDLKNPSAGSTLPATNMPHFILASGQLVQGIQGAQLLIPTTQGITTQTILTIPVNNVTSNQPVNLALNNGQVISTTIANLQSMAQPNPLFNNNGAEDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
P78424691 POU domain, class 6, tran yes N/A 0.609 0.225 0.491 8e-32
Q8BJI4691 POU domain, class 6, tran yes N/A 0.609 0.225 0.491 1e-31
P56223301 POU domain, class 6, tran yes N/A 0.296 0.252 0.581 7e-28
Q07916301 POU domain, class 6, tran no N/A 0.296 0.252 0.581 7e-28
Q14863301 POU domain, class 6, tran no N/A 0.296 0.252 0.581 1e-27
P31367610 POU domain, class 6, tran no N/A 0.289 0.121 0.574 3e-27
Q91989426 POU domain, class 5, tran N/A N/A 0.289 0.173 0.333 2e-10
Q9YGL7363 Pituitary-specific positi no N/A 0.320 0.225 0.310 2e-10
B3DM23423 POU domain, class 5, tran no N/A 0.289 0.174 0.333 3e-10
P28069291 Pituitary-specific positi no N/A 0.320 0.281 0.301 9e-10
>sp|P78424|PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens GN=POU6F2 PE=1 SV=3 Back     alignment and function desciption
 Score =  137 bits (345), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 100/169 (59%), Gaps = 13/169 (7%)

Query: 2   VDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQ 61
           VDG+NL+EI+EFAKAFK+RRLSLGLTQTQVGQALS TEGPAYSQSAIC       +  + 
Sbjct: 476 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICR----HTILRSH 531

Query: 62  IASQQQQQQQQQHQQQQQQQN------TMFEKLDITPKSAQKIKPVLERWMKEAEERQV- 114
               Q+ Q+         + N        FEKLDITPKSAQKIKPVLERWM EAE R   
Sbjct: 532 FFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRA 591

Query: 115 -MSNMPGII-SPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDL 161
            M N+   I S P   + +     P  L + +     N HP+    T++
Sbjct: 592 GMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEI 640
Probable transcription factor likely to be involved in early steps in the differentiation of amacrine and ganglion cells. Recognizes and binds to the DNA sequence 5'-ATGCAAAT-3'. Isoform 1 does not bind DNA.
Homo sapiens (taxid: 9606)
>sp|Q8BJI4|PO6F2_MOUSE POU domain, class 6, transcription factor 2 OS=Mus musculus GN=Pou6f2 PE=2 SV=1 Back     alignment and function description
>sp|P56223|PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus GN=Pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|Q07916|PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus GN=Pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|Q14863|PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens GN=POU6F1 PE=1 SV=1 Back     alignment and function description
>sp|P31367|PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio GN=pou6f1 PE=2 SV=1 Back     alignment and function description
>sp|Q91989|P5F13_XENLA POU domain, class 5, transcription factor 1.3 OS=Xenopus laevis GN=pou5f1.3 PE=1 SV=1 Back     alignment and function description
>sp|Q9YGL7|PIT1_CHICK Pituitary-specific positive transcription factor 1 OS=Gallus gallus GN=POU1F1 PE=2 SV=1 Back     alignment and function description
>sp|B3DM23|P5F13_XENTR POU domain, class 5, transcription factor 1.3 OS=Xenopus tropicalis GN=pou5f1.3 PE=2 SV=1 Back     alignment and function description
>sp|P28069|PIT1_HUMAN Pituitary-specific positive transcription factor 1 OS=Homo sapiens GN=POU1F1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
307196835 559 POU domain, class 6, transcription facto 0.378 0.173 0.803 9e-43
322801731 590 hypothetical protein SINV_00668 [Solenop 0.378 0.164 0.803 9e-43
307170609 558 POU domain, class 6, transcription facto 0.378 0.173 0.803 1e-42
332017678 602 POU domain, class 6, transcription facto 0.378 0.161 0.803 1e-42
340723277 673 PREDICTED: hypothetical protein LOC10064 0.382 0.145 0.787 1e-42
380021384 688 PREDICTED: uncharacterized protein LOC10 0.382 0.142 0.787 2e-42
328784098 711 PREDICTED: hypothetical protein LOC40843 0.382 0.137 0.787 2e-42
194863499 1008 GG23353 [Drosophila erecta] gi|190662338 0.371 0.094 0.783 4e-40
195332458 1049 GM21028 [Drosophila sechellia] gi|194124 0.371 0.090 0.783 5e-40
195581519 1046 GD10557 [Drosophila simulans] gi|1941925 0.371 0.090 0.783 5e-40
>gi|307196835|gb|EFN78271.1| POU domain, class 6, transcription factor 2 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 92/112 (82%), Gaps = 15/112 (13%)

Query: 1   MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAA 60
           +VDGINLDEIKEFAK FKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQM  A+
Sbjct: 377 VVDGINLDEIKEFAKVFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMYAAS 436

Query: 61  QIASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAEER 112
           QIASQQQ                 FEKLDITPKSAQKIKPVLERWMKEAEER
Sbjct: 437 QIASQQQ---------------ATFEKLDITPKSAQKIKPVLERWMKEAEER 473

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322801731|gb|EFZ22328.1| hypothetical protein SINV_00668 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307170609|gb|EFN62793.1| POU domain, class 6, transcription factor 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332017678|gb|EGI58364.1| POU domain, class 6, transcription factor 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340723277|ref|XP_003400018.1| PREDICTED: hypothetical protein LOC100643587 [Bombus terrestris] gi|350409277|ref|XP_003488678.1| PREDICTED: hypothetical protein LOC100741939 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380021384|ref|XP_003694547.1| PREDICTED: uncharacterized protein LOC100872418 [Apis florea] Back     alignment and taxonomy information
>gi|328784098|ref|XP_391982.4| PREDICTED: hypothetical protein LOC408435 [Apis mellifera] Back     alignment and taxonomy information
>gi|194863499|ref|XP_001970471.1| GG23353 [Drosophila erecta] gi|190662338|gb|EDV59530.1| GG23353 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195332458|ref|XP_002032914.1| GM21028 [Drosophila sechellia] gi|194124884|gb|EDW46927.1| GM21028 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195581519|ref|XP_002080581.1| GD10557 [Drosophila simulans] gi|194192590|gb|EDX06166.1| GD10557 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
FB|FBgn02615881051 pdm3 "pou domain motif 3" [Dro 0.371 0.090 0.756 7.5e-33
UNIPROTKB|F1NBF5290 POU6F2 "Uncharacterized protei 0.187 0.165 0.895 7.7e-31
UNIPROTKB|F1LZY2280 Pou6f2 "Protein Pou6f2" [Rattu 0.484 0.442 0.581 7.9e-30
UNIPROTKB|H0YK27636 POU6F2 "POU domain, class 6, t 0.484 0.194 0.581 4.5e-29
UNIPROTKB|E1C0A7673 POU6F2 "Uncharacterized protei 0.484 0.184 0.581 5.3e-29
UNIPROTKB|P78424691 POU6F2 "POU domain, class 6, t 0.484 0.179 0.581 5.8e-29
MGI|MGI:2443631691 Pou6f2 "POU domain, class 6, t 0.484 0.179 0.581 5.8e-29
ZFIN|ZDB-GENE-091118-71694 pou6f2 "POU class 6 homeobox 2 0.484 0.178 0.581 5.8e-29
UNIPROTKB|F1P7L3688 POU6F2 "Uncharacterized protei 0.433 0.161 0.619 7.3e-29
UNIPROTKB|Q14863301 POU6F1 "POU domain, class 6, t 0.183 0.156 0.872 1.6e-28
FB|FBgn0261588 pdm3 "pou domain motif 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 370 (135.3 bits), Expect = 7.5e-33, P = 7.5e-33
 Identities = 84/111 (75%), Positives = 89/111 (80%)

Query:     1 MVDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAA 60
             +VDGI+LDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALA QM  AA
Sbjct:   866 VVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALAAQMY-AA 924

Query:    61 QIASXXXXXXXXXXXXXXXXXNTMFEKLDITPKSAQKIKPVLERWMKEAEE 111
             Q+++                   MFEKLDITPKSAQKIKPVLERWMKEAEE
Sbjct:   925 QLSTQQ---------------QNMFEKLDITPKSAQKIKPVLERWMKEAEE 960
GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007608 "sensory perception of smell" evidence=IMP
GO:0007409 "axonogenesis" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007412 "axon target recognition" evidence=IMP
UNIPROTKB|F1NBF5 POU6F2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LZY2 Pou6f2 "Protein Pou6f2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0YK27 POU6F2 "POU domain, class 6, transcription factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0A7 POU6F2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P78424 POU6F2 "POU domain, class 6, transcription factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2443631 Pou6f2 "POU domain, class 6, transcription factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091118-71 pou6f2 "POU class 6 homeobox 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7L3 POU6F2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14863 POU6F1 "POU domain, class 6, transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
pfam0015775 pfam00157, Pou, Pou domain - N-terminal to homeobo 9e-28
smart0035275 smart00352, POU, Found in Pit-Oct-Unc transcriptio 1e-25
>gnl|CDD|189427 pfam00157, Pou, Pou domain - N-terminal to homeobox domain Back     alignment and domain information 
 Score =  101 bits (253), Expect = 9e-28
 Identities = 38/109 (34%), Positives = 53/109 (48%), Gaps = 34/109 (31%)

Query: 2   VDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQ 61
            D  +LDE+++FAK FK RR+ LG TQ  VG AL    GP +SQ+ IC            
Sbjct: 1   DDTTDLDELEQFAKEFKQRRIKLGYTQADVGLALGALYGPVFSQTTICR----------- 49

Query: 62  IASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAE 110
                                  FE L ++ K+  K+KP+LE+W++EAE
Sbjct: 50  -----------------------FEALQLSFKNMCKLKPLLEKWLEEAE 75

Length = 75
>gnl|CDD|197673 smart00352, POU, Found in Pit-Oct-Unc transcription factors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG3802|consensus398 100.0
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 100.0
KOG1168|consensus385 100.0
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 99.96
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 97.29
PF0004657 Homeobox: Homeobox domain not present here.; Inter 97.2
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 97.04
cd0008659 homeodomain Homeodomain; DNA binding domains invol 96.89
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 95.6
KOG0488|consensus309 95.34
KOG2251|consensus228 94.7
COG5576156 Homeodomain-containing transcription factor [Trans 93.72
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 93.42
KOG0842|consensus307 92.69
KOG0843|consensus197 92.39
KOG0850|consensus245 91.92
KOG0485|consensus268 90.55
TIGR00270154 conserved hypothetical protein TIGR00270. 88.81
PHA0197667 helix-turn-helix protein 88.34
KOG2252|consensus558 87.84
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 87.57
PRK06424144 transcription factor; Provisional 87.36
KOG0491|consensus194 86.79
KOG0489|consensus261 85.57
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 84.89
KOG0494|consensus332 84.62
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 81.79
KOG0849|consensus354 80.94
PRK0972688 antitoxin HipB; Provisional 80.34
>KOG3802|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.9e-56  Score=418.33  Aligned_cols=132  Identities=32%  Similarity=0.458  Sum_probs=127.2

Q ss_pred             CCCCChHHHHHHHHHHHhhhhccCcchhHHhhhhhcccCCCCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy14051          2 VDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQ   81 (256)
Q Consensus         2 vd~~~l~el~~FAk~FK~rRl~LGlTQ~~Vg~aL~~~~G~aySQstICR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (256)
                      .|++|+||||+|||.||+|||+|||||+|||+|||++||++||||||||                               
T Consensus       200 ed~~~leELEqFAK~FKqRRIkLGfTQaDVGlALG~lyGn~FSQTTIcR-------------------------------  248 (398)
T KOG3802|consen  200 EDTPDLEELEQFAKTFKQRRIKLGFTQADVGLALGALYGNVFSQTTICR-------------------------------  248 (398)
T ss_pred             ccccCHHHHHHHHHHHHhheeccccchhHHHHHHHhhhCcccchhhhhH-------------------------------
Confidence            5899999999999999999999999999999999999999999999999                               


Q ss_pred             hhchhcccCChhhhhhhhHHHHHHHHHHHHhhhcC--CCCCCCCCcccccCCCcccchhhHhhhHHhhccCCCCCccccc
Q psy14051         82 NTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMS--NMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRT  159 (256)
Q Consensus        82 ~~~FEkLdls~kna~KlkPvLekWL~EAE~~~~~g--n~~~~i~~~~~KRKRRTSIep~vKslLEs~F~knPKPSseEIT  159 (256)
                         ||+|+|||||||||||+|+|||+|||.++..|  +..++|+...|||||||+|++.+|..||+||.+|||||++||+
T Consensus       249 ---FEALqLSFKNMCKLKPLL~KWLeEAes~~~~~~~~~~e~i~a~~RkRKKRTSie~~vr~aLE~~F~~npKPt~qEIt  325 (398)
T KOG3802|consen  249 ---FEALQLSFKNMCKLKPLLEKWLEEAESRESTGSPNSIEKIGAQSRKRKKRTSIEVNVRGALEKHFLKNPKPTSQEIT  325 (398)
T ss_pred             ---hHhhccCHHHHhhhHHHHHHHHHHHhcccccCCCCCHHHhhccccccccccceeHHHHHHHHHHHHhCCCCCHHHHH
Confidence               99999999999999999999999999976655  6788899889999999999999999999999999999999999


Q ss_pred             cCCCCCCC
Q psy14051        160 DLKNPSAG  167 (256)
Q Consensus       160 ~LAe~Lns  167 (256)
                      +||++|+-
T Consensus       326 ~iA~~L~l  333 (398)
T KOG3802|consen  326 HIAESLQL  333 (398)
T ss_pred             HHHHHhcc
Confidence            99999986

>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>TIGR00270 conserved hypothetical protein TIGR00270 Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 3e-24
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 2e-09
1pou_A71 The Solution Structure Of The Oct-1 Pou-Specific Do 4e-08
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 4e-08
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 4e-08
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 5e-08
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 7e-08
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 7e-08
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 7e-08
3l1p_A155 Pou Protein:dna Complex Length = 155 2e-06
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 67/108 (62%), Gaps = 34/108 (31%)
Query: 5   INLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIAS 64
           IN +EI+EFAK FK+RRLSLGLTQTQVGQA + TEGPAYSQSAI                
Sbjct: 1   INXEEIREFAKNFKIRRLSLGLTQTQVGQAXTATEGPAYSQSAI---------------- 44
Query: 65  XXXXXXXXXXXXXXXXXNTMFEKLDITPKSAQKIKPVLERWMKEAEER 112
                             + FEKLDITPKSAQK+KPVLE+W+ EAE R
Sbjct: 45  ------------------SRFEKLDITPKSAQKLKPVLEKWLNEAELR 74
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|1POU|A Chain A, The Solution Structure Of The Oct-1 Pou-Specific Domain Reveals A Striking Similarity To The Bacteriophage Lambda Repressor Dna-Binding Domain Length = 71 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-22
2xsd_C164 POU domain, class 3, transcription factor 1; trans 9e-22
3d1n_I151 POU domain, class 6, transcription factor 1; prote 5e-19
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 7e-17
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
 Score = 89.3 bits (221), Expect = 2e-22
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 34/123 (27%)

Query: 3   DGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQI 62
           +  +L+E+++FAK FK RR+ LG TQ  VG A+    G  +SQ+ I              
Sbjct: 2   EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISR------------ 49

Query: 63  ASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGII 122
                                 FE L+++ K+  K+KP+LE+W+ +AE      +     
Sbjct: 50  ----------------------FEALNLSFKNMSKLKPLLEKWLNDAEANLSSDSSLSSP 87

Query: 123 SPP 125
           S  
Sbjct: 88  SAL 90
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
2xsd_C164 POU domain, class 3, transcription factor 1; trans 100.0
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 100.0
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 100.0
3d1n_I151 POU domain, class 6, transcription factor 1; prote 100.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 100.0
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.2
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.73
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.01
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 97.84
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 97.81
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 97.79
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 97.76
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 97.74
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 97.74
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 97.73
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 97.69
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 97.67
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 97.67
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 97.66
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 97.65
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 97.65
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 97.65
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 97.65
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 97.64
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 97.63
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 97.58
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 97.58
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 97.58
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 97.58
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 97.57
3a01_A93 Homeodomain-containing protein; homeodomain, prote 97.56
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 97.56
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 97.53
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 97.52
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 97.51
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 97.5
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 97.5
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 97.48
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 97.48
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 97.46
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 97.43
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 97.37
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 97.36
1wh5_A80 ZF-HD homeobox family protein; structural genomics 97.34
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 97.34
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 97.3
1lfb_A99 Liver transcription factor (LFB1); transcription r 97.27
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 97.17
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 97.15
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 97.11
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 97.06
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 96.97
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 96.96
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 96.84
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 96.82
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 96.78
1uhs_A72 HOP, homeodomain only protein; structural genomics 96.74
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 96.71
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 96.5
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 96.48
3a02_A60 Homeobox protein aristaless; homeodomain, developm 96.45
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 96.41
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 96.18
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 96.16
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 95.94
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 95.88
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 95.64
4ghj_A101 Probable transcriptional regulator; structural gen 95.38
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 95.29
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 94.94
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 94.94
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 94.78
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 94.76
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 94.65
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 94.51
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 94.29
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 94.18
3s8q_A82 R-M controller protein; protein-DNA complex, helix 93.69
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 93.53
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 93.29
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 93.12
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 93.04
3g5g_A99 Regulatory protein; transcriptional regulator, hel 92.97
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 92.85
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 92.55
1jhg_A101 Trp operon repressor; complex (regulatory protein- 92.37
1x57_A91 Endothelial differentiation-related factor 1; HMBF 92.26
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 91.99
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 91.6
2e19_A64 Transcription factor 8; homeobox domain, structura 91.46
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 91.41
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 91.27
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 91.06
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 91.05
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 90.99
2wus_R112 RODZ, putative uncharacterized protein; structural 90.84
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix 90.73
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 90.5
3ivp_A126 Putative transposon-related DNA-binding protein; A 90.46
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 90.23
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 90.2
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 90.16
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 89.64
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 89.6
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 89.39
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; 88.88
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 88.84
1b0n_A111 Protein (SINR protein); transcription regulator, a 88.64
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 88.41
3cec_A104 Putative antidote protein of plasmid maintenance; 88.06
3u3w_A293 Transcriptional activator PLCR protein; ternary co 87.97
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 86.95
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 86.42
3mlf_A111 Transcriptional regulator; structural genomics, he 86.28
2xi8_A66 Putative transcription regulator; HTH DNA-binding 86.04
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 85.89
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 85.67
3fym_A130 Putative uncharacterized protein; HTH DNA binding, 84.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 84.61
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 84.6
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 84.14
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 82.26
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 82.09
3t76_A88 VANU, transcriptional regulator vanug; structural 82.08
3omt_A73 Uncharacterized protein; structural genomics, PSI- 81.38
2awi_A317 PRGX; repressor, pheromone, DNA binding, regulator 80.63
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 80.17
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=6.5e-40  Score=273.54  Aligned_cols=131  Identities=27%  Similarity=0.402  Sum_probs=104.5

Q ss_pred             CCCCChHHHHHHHHHHHhhhhccCcchhHHhhhhhcccCCCCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy14051          2 VDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQ   81 (256)
Q Consensus         2 vd~~~l~el~~FAk~FK~rRl~LGlTQ~~Vg~aL~~~~G~aySQstICR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (256)
                      .|.+|++||++||+.||.|||+|||||+|||.||+.+||+.||||||||                               
T Consensus         7 ~~~~~~~~l~~fa~~fk~~ri~lg~tQ~~vg~alg~l~g~~~Sqtti~r-------------------------------   55 (164)
T 2xsd_C            7 EDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICR-------------------------------   55 (164)
T ss_dssp             --CCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHH-------------------------------
T ss_pred             ccccchhHHHHHHHHHHHHHhhcCCcccccccccccccCCCcCcchhhh-------------------------------
Confidence            4789999999999999999999999999999999999999999999999                               


Q ss_pred             hhchhcccCChhhhhhhhHHHHHHHHHHHHhhhcCCCCCCCCCcccccCCCcccchhhHhhhHHhhccCCCCCccccccC
Q psy14051         82 NTMFEKLDITPKSAQKIKPVLERWMKEAEERQVMSNMPGIISPPLISQNQNMVNAPLNLSLNSNAVSANFHPNVNPRTDL  161 (256)
Q Consensus        82 ~~~FEkLdls~kna~KlkPvLekWL~EAE~~~~~gn~~~~i~~~~~KRKRRTSIep~vKslLEs~F~knPKPSseEIT~L  161 (256)
                         ||+|++|+||||||||+|++||+|+|.........+.+....++||+||.|+...+..||.+|..+++|+..++..|
T Consensus        56 ---FE~l~ls~kn~~klkPlL~~wl~eae~~~~~~~~~~~~~~~~~~rr~Rt~ft~~Ql~~LE~~F~~~~yp~~~~r~~L  132 (164)
T 2xsd_C           56 ---FEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGL  132 (164)
T ss_dssp             ---HHTTCSBHHHHHHHHHHHHHHHHHHCC-----------------------CCHHHHHHHHHHHHHCSSCCHHHHHHH
T ss_pred             ---hhccCCCHHHHHHcchhHHHHHhhhccccCCCcccccccccccCCCCceeccHHHHHHHHHHHhcCCCCCHHHHHHH
Confidence               99999999999999999999999999764322222223344667999999999999999999999999999999999


Q ss_pred             CCCCC
Q psy14051        162 KNPSA  166 (256)
Q Consensus       162 Ae~Ln  166 (256)
                      |..++
T Consensus       133 A~~l~  137 (164)
T 2xsd_C          133 ADSLQ  137 (164)
T ss_dssp             HHHHT
T ss_pred             HHHHC
Confidence            99988
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d1e3oc275 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [Tax 1e-26
d1au7a272 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [ 2e-26
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 96.4 bits (240), Expect = 1e-26
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 34/108 (31%)

Query: 3   DGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQI 62
           +  +L+E+++FAK FK RR+ LG TQ  VG A+    G  +SQ+ I              
Sbjct: 2   EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTIS------------- 48

Query: 63  ASQQQQQQQQQHQQQQQQQNTMFEKLDITPKSAQKIKPVLERWMKEAE 110
                                 FE L+++ K+  K+KP+LE+W+ +AE
Sbjct: 49  ---------------------RFEALNLSFKNMSKLKPLLEKWLNDAE 75
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 98.03
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 98.0
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 97.99
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 97.91
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 97.89
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 97.88
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 97.87
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 97.84
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 97.82
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 97.79
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 97.78
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 97.7
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 97.68
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 97.65
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 97.65
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 97.65
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 97.62
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 97.56
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 97.52
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 97.51
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 97.28
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 97.22
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 97.1
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 97.01
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 96.65
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 96.6
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 96.48
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 96.38
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 95.77
d1y7ya169 Restriction-modification controller protein C.AhdI 95.4
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 95.09
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 94.66
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 94.37
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 93.05
d1x57a178 Endothelial differentiation-related factor 1, EDF1 90.97
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 90.51
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 90.19
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 89.44
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 88.68
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 87.56
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 85.6
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 85.14
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 84.76
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 82.06
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.1e-39  Score=243.22  Aligned_cols=75  Identities=43%  Similarity=0.768  Sum_probs=73.5

Q ss_pred             CCCCChHHHHHHHHHHHhhhhccCcchhHHhhhhhcccCCCCcchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy14051          2 VDGINLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALATQMLCAAQIASQQQQQQQQQHQQQQQQQ   81 (256)
Q Consensus         2 vd~~~l~el~~FAk~FK~rRl~LGlTQ~~Vg~aL~~~~G~aySQstICR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (256)
                      .|+.|++||++||+.||+|||+|||||+|||.||+++||+.||||||||                               
T Consensus         1 e~~~~l~Ele~Fa~~fk~rRi~LG~TQ~dVG~al~~l~g~~~SQttIcR-------------------------------   49 (75)
T d1e3oc2           1 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISR-------------------------------   49 (75)
T ss_dssp             CCSCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHH-------------------------------
T ss_pred             CCCCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHcCcchhHHHHHH-------------------------------
Confidence            4889999999999999999999999999999999999999999999999                               


Q ss_pred             hhchhcccCChhhhhhhhHHHHHHHHHHH
Q psy14051         82 NTMFEKLDITPKSAQKIKPVLERWMKEAE  110 (256)
Q Consensus        82 ~~~FEkLdls~kna~KlkPvLekWL~EAE  110 (256)
                         ||+|+||+||||||||+|+|||+|||
T Consensus        50 ---FE~l~LS~kn~~kLkP~L~~WL~eaE   75 (75)
T d1e3oc2          50 ---FEALNLSFKNMSKLKPLLEKWLNDAE   75 (75)
T ss_dssp             ---HHHTCSCHHHHHHHHHHHHHHHHHHC
T ss_pred             ---HHHhccCHHHHHHHHHHHHHHHHhcC
Confidence               99999999999999999999999996
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure