Psyllid ID: psy1412

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRDEDL
ccccEEEEEEEEEEccccccEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHcEEEEEEEEcccEEEEEEEcccccccccccccccccccccEEEEEEEEEcccEEEEEcccccccccccEEEHHHHHHHHHHHcccEEEEEEEcccccccccccccEEEEEEHHHccccccEEEEcEEEcccccccEEcccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHcccccEEEEEcccccEEccccccEEEEccccccccEEEEccccccccHHHHHHHHHcccccHHHHHHHHHcccccccccccccc
ccccccEEEEEEEEEccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccEEEEcccccEEEEEEcccccEEEccccccccccccccEEEEEccEcccEEEcccHHHccHHHHEEcHHHHHHHHHHHHHcccEEEEEccccccccEccccccEcHHHHHHHcccccEEccccEccHHHHccEEEccccEEEcEEEEEEccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccEEEEEcccccccHcccHHHHHHHHHHHHccccccEccHHHHHHHHHcccEEEEEEccHHHHcccccccEEEEccccccEEEccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccc
MYDSVHVLAAGLALLdkssviktsnlscdlevpwrdglslynyintaepalmydSVHVLAAGLALLdkssviktsnlscdlevpwrdglslynYINTLDLLKLKREELRkvghwtpaeginitdrsafyetstnNVTLIVMtreekpyvmvkndanltgnaMFEGFCIDLLKSIAAQVGFHFVLRlvpdhtygvydheTKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIgilfkvptsqptrlfsFMNPLAVEIWLYVLAAYLLVSFTLFVMarfspyewsnphpclaespivenqfsvsnSFWFITGTFlrqgsglnpkvlqqgssrtldtALDSKIEIYQKMWRYMESKKCILflggqgdeTFVTIDLSQRADSKIEIYQKMWRYMeskrpsvfvsdYEEGVKRVLEGDYAFLMESTMLDYEVQRNcnltqigglldskgygiatpkgspwrDRISLAILELQEKGTIQMLYDKWWkntgdvcnrdedl
MYDSVHVLAAGLAlldkssviktsnlscdlevpwrDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSViktsnlscdlevpwrdglslYNYINTLDLLKLKREELRKVghwtpaeginitdrsafyetsTNNVTLivmtreekpyVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVlqqgssrtldtaldSKIEIYQKMWRYMESKKCILFLGGQGDETFVtidlsqradsKIEIYQKMWRymeskrpsvfvsdyeEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQigglldskgyGIATPKGSPWRDRISLAILELQEKGTIQMLYdkwwkntgdvcnrdedl
MYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDllklkreelrkVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRDEDL
****VHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVL******TLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVC******
MYDSVHVLAAGLALLDKSSVIKTSNLS**************NYINTAEPALMYDSVHVLAAGLALLD*****************WRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPY******************FSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRP*VFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKN***********
MYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRDEDL
MYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRDEDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query504 2.2.26 [Sep-21-2011]
Q13002908 Glutamate receptor ionotr yes N/A 0.914 0.507 0.438 1e-115
P42260908 Glutamate receptor ionotr yes N/A 0.914 0.507 0.438 1e-115
Q38PU3908 Glutamate receptor ionotr N/A N/A 0.914 0.507 0.440 1e-115
P39087908 Glutamate receptor ionotr yes N/A 0.914 0.507 0.436 1e-115
P42264 919 Glutamate receptor ionotr no N/A 0.912 0.500 0.426 1e-109
Q13003 919 Glutamate receptor ionotr no N/A 0.912 0.500 0.422 1e-108
Q38PU2 919 Glutamate receptor ionotr N/A N/A 0.912 0.500 0.422 1e-108
B1AS29 919 Glutamate receptor ionotr no N/A 0.912 0.500 0.422 1e-108
Q38PU4918 Glutamate receptor ionotr N/A N/A 0.902 0.495 0.424 1e-108
P39086918 Glutamate receptor ionotr no N/A 0.902 0.495 0.424 1e-108
>sp|Q13002|GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens GN=GRIK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  417 bits (1072), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 228/520 (43%), Positives = 309/520 (59%), Gaps = 59/520 (11%)

Query: 30  LEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGL 89
           L+ P +    L +   T + ALMYD+VHV++  +    + +V   S+L C+   PWR G 
Sbjct: 301 LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV---SSLQCNRHKPWRFGT 357

Query: 90  SLYNYINT-----------------------LDLLKLKREELRKVGHWTPAEGINITD-- 124
              + I                         LD++ LK E L K+G W PA G+N+T+  
Sbjct: 358 RFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ 417

Query: 125 --RSAFYETSTNNVTLIVMTREEKPYVMVK-NDANLTGNAMFEGFCIDLLKSIAAQVGFH 181
             + A    S +N +LIV T  E+PYV+ K +D  L GN  FEG+CIDLL+ ++  +GF 
Sbjct: 418 KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFT 477

Query: 182 FVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLG 241
           + +RLV D  YG  D    +WNG+V+EL+D KADLAVA + I Y RE VIDF+KPFM LG
Sbjct: 478 YEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLG 537

Query: 242 IGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLA 301
           I IL++ P      +FSF+NPL+ +IW+Y+L AYL VS  LFV+ARFSPYEW NPHPC  
Sbjct: 538 ISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNP 597

Query: 302 ESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQG--------------SSRTLDTAL 347
           +S +VEN F++ NSFWF  G  ++QGS L PK L                 SS T + A 
Sbjct: 598 DSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAA 657

Query: 348 DSKIEIYQKMWRYMES-----KKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYME 402
              +E   +M   ++S     K+  +  G   D   +T        SKI  Y KMW +M 
Sbjct: 658 FLTVE---RMESPIDSADDLAKQTKIEYGAVEDGATMTF----FKKSKISTYDKMWAFMS 710

Query: 403 SKRPSVFVSDYEEGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPK 462
           S+R SV V   EEG++RVL  DYAFLMEST +++  QRNCNLTQIGGL+DSKGYG+ TP 
Sbjct: 711 SRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPM 770

Query: 463 GSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRDE 502
           GSP+RD+I++AIL+LQE+G + M+ +KWW+  G  C  +E
Sbjct: 771 GSPYRDKITIAILQLQEEGKLHMMKEKWWRGNG--CPEEE 808
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2.
Homo sapiens (taxid: 9606)
>sp|P42260|GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus GN=Grik2 PE=1 SV=2 Back     alignment and function description
>sp|Q38PU3|GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis GN=GRIK2 PE=2 SV=1 Back     alignment and function description
>sp|P39087|GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus GN=Grik2 PE=1 SV=4 Back     alignment and function description
>sp|P42264|GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus GN=Grik3 PE=1 SV=1 Back     alignment and function description
>sp|Q13003|GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens GN=GRIK3 PE=2 SV=3 Back     alignment and function description
>sp|Q38PU2|GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis GN=GRIK3 PE=2 SV=1 Back     alignment and function description
>sp|B1AS29|GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus GN=Grik3 PE=2 SV=1 Back     alignment and function description
>sp|Q38PU4|GRIK1_MACFA Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis GN=GRIK1 PE=2 SV=1 Back     alignment and function description
>sp|P39086|GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens GN=GRIK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
383865939 1008 PREDICTED: glutamate receptor, ionotropi 0.898 0.449 0.684 0.0
332020480 982 Glutamate receptor, ionotropic kainate 2 0.988 0.507 0.638 0.0
328777632 1000 PREDICTED: glutamate receptor, ionotropi 0.898 0.453 0.682 0.0
380015482 987 PREDICTED: glutamate receptor, ionotropi 0.898 0.458 0.682 0.0
242022297 938 glutamate receptor, ionotropic kainate 2 0.982 0.527 0.627 0.0
340713406 998 PREDICTED: glutamate receptor, ionotropi 0.898 0.453 0.674 0.0
345488319 1023 PREDICTED: glutamate receptor, ionotropi 0.982 0.483 0.630 0.0
321465367 866 hypothetical protein DAPPUDRAFT_55388 [D 0.946 0.550 0.629 0.0
263359630 914 hypothetical protein DVIR88_6g0003 [Dros 0.916 0.505 0.641 0.0
62484334 910 CG11155, isoform A [Drosophila melanogas 0.986 0.546 0.602 0.0
>gi|383865939|ref|XP_003708429.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/492 (68%), Positives = 381/492 (77%), Gaps = 39/492 (7%)

Query: 47  AEPALMYDSVHVLAAGLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDLLKL--- 103
           AEPAL+YDSV V A GLA LD+S  ++ +NLSC+ E PW DGLSLYNYIN   L  L   
Sbjct: 295 AEPALVYDSVQVFAHGLAALDRSHDLRLANLSCEKEKPWDDGLSLYNYINAAGLHGLTGH 354

Query: 104 ------KREELRKV------------GHWTPAEGINITDRSAFYETSTNNVTLIVMTREE 145
                 KR   +              G W P  G+N+TD  AFYET+  N+TL+VMTREE
Sbjct: 355 IEFNEGKRNNFKLDLLKLKKEELVKVGEWKPGSGVNVTDVGAFYETTATNITLVVMTREE 414

Query: 146 KPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGI 205
           KPYVMVK D NLTGNA FEGFCIDLLK IA QVGF + +RLVPDH YGVYD ETKEWNGI
Sbjct: 415 KPYVMVKEDKNLTGNARFEGFCIDLLKWIAGQVGFQYAIRLVPDHMYGVYDPETKEWNGI 474

Query: 206 VKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAV 265
           V+ELM+K+ADLAVASMTINYARESVIDFTKPFMNLGIGILFKVP+SQPTRLFSFMNPLAV
Sbjct: 475 VRELMEKRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPSSQPTRLFSFMNPLAV 534

Query: 266 EIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLR 325
           EIWLYVLAAY+LVSFTLFVMARFSPYEW+NPHPCLAES +VENQF+VSNSFWFITGTFLR
Sbjct: 535 EIWLYVLAAYMLVSFTLFVMARFSPYEWNNPHPCLAESDVVENQFNVSNSFWFITGTFLR 594

Query: 326 QGSGLNPKVLQQGSSRTLD-----------TALDSKIEIYQKMWRYMESKKCILFLGGQG 374
           QGSGLNPK     S+R +            ++  + +  +  + R +   +    L  Q 
Sbjct: 595 QGSGLNPKAT---STRIVGGIWWFFTLIIISSYTANLAAFLTVERMITPIENAADLAEQT 651

Query: 375 DETFVTID----LSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGDYAFLME 430
           + ++ T++    ++   DSKI IYQKMWR+MESK PSVFV  YE+GVKRVLEGDYAFLME
Sbjct: 652 EISYGTLEGGSTMTFFRDSKIGIYQKMWRFMESKSPSVFVKSYEDGVKRVLEGDYAFLME 711

Query: 431 STMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKW 490
           STMLDY VQR+CNLTQIGGLLDSKGYGIATPKGSPWRD+ISLAILELQEKG IQ+LYDKW
Sbjct: 712 STMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGVIQILYDKW 771

Query: 491 WKNTGDVCNRDE 502
           WKNTGDVCNRDE
Sbjct: 772 WKNTGDVCNRDE 783

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332020480|gb|EGI60895.1| Glutamate receptor, ionotropic kainate 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328777632|ref|XP_003249376.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380015482|ref|XP_003691730.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis florea] Back     alignment and taxonomy information
>gi|242022297|ref|XP_002431577.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] gi|212516880|gb|EEB18839.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340713406|ref|XP_003395234.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345488319|ref|XP_001605775.2| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321465367|gb|EFX76369.1| hypothetical protein DAPPUDRAFT_55388 [Daphnia pulex] Back     alignment and taxonomy information
>gi|263359630|gb|ACY70466.1| hypothetical protein DVIR88_6g0003 [Drosophila virilis] Back     alignment and taxonomy information
>gi|62484334|ref|NP_651941.2| CG11155, isoform A [Drosophila melanogaster] gi|442614563|ref|NP_726649.3| CG11155, isoform D [Drosophila melanogaster] gi|61699735|gb|AAF59382.3| CG11155, isoform A [Drosophila melanogaster] gi|206597314|gb|ACI15751.1| FI01405p [Drosophila melanogaster] gi|440218178|gb|AAN06582.3| CG11155, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
FB|FBgn0039927 910 CG11155 [Drosophila melanogast 0.966 0.535 0.596 9.8e-151
FB|FBgn0039916 899 CG9935 [Drosophila melanogaste 0.861 0.482 0.512 2.3e-129
UNIPROTKB|F1M7M9 951 Grik1 "Glutamate receptor iono 0.753 0.399 0.482 3.6e-101
UNIPROTKB|F1M5R4 912 Grik1 "Glutamate receptor iono 0.753 0.416 0.482 3.6e-101
UNIPROTKB|F1LTY2834 Grik1 "Glutamate receptor iono 0.753 0.455 0.482 3.6e-101
UNIPROTKB|F1M4T4883 Grik1 "Glutamate receptor iono 0.753 0.430 0.482 3.6e-101
UNIPROTKB|F1P9T1879 GRIK1 "Uncharacterized protein 0.753 0.432 0.482 3.6e-101
UNIPROTKB|J9NV46849 GRIK1 "Uncharacterized protein 0.753 0.447 0.482 3.6e-101
UNIPROTKB|F1M526832 Grik1 "Glutamate receptor iono 0.753 0.456 0.482 3.6e-101
UNIPROTKB|E7ENK3 949 GRIK1 "Glutamate receptor iono 0.765 0.406 0.471 7.5e-101
FB|FBgn0039927 CG11155 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1471 (522.9 bits), Expect = 9.8e-151, P = 9.8e-151
 Identities = 303/508 (59%), Positives = 370/508 (72%)

Query:    11 GLALLDKSSVIKT-SNLSCDLEVPWRDGL---SLYNYINTAEPALMYDSVHVLAAGLALL 66
             GL  ++ S  I+T S L  D    + +GL   +L N+ N     L   S      G++L 
Sbjct:   301 GLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTWNDGISLY 360

Query:    67 DKSSVIKTSNLSCDLEVPWRDGLSLYNYINTLDXXXXXXXXXXXVGHWTPAEGINITDRS 126
             ++ +   T  L+  ++  + +G    N I  LD           VG+W P +G+NI+D +
Sbjct:   361 NQINAAITDGLTGTVQ--FVEGRR--N-IFKLDILKLKQEKIQKVGYWHPDDGVNISDPT 415

Query:   127 AFYETSTNNVTLIVMTREEKPYVMVKNDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRL 186
             AFY+++  N+TL+VMTREE+PYVMVK D NLTGN  FEGFCIDLLK+IA QVGF + + L
Sbjct:   416 AFYDSNIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIEL 475

Query:   187 VPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILF 246
             VPD+ YGVY  ET  WNGIV+ELM+++ADLAVASMTINYARESVIDFTKPFMNLGIGILF
Sbjct:   476 VPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILF 535

Query:   247 KVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIV 306
             KVPTSQPTRLFSFMNPLA+EIWLYVLAAY+LVSF LFVMARFSPYEW NPHPC  E+ IV
Sbjct:   536 KVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIV 595

Query:   307 ENQFSVSNSFWFITGTFLRQGSGLNPKVLQQ---GSS-----RTLDTALDSKIEIYQKMW 358
             ENQFS+SNSFWFITGTFLRQGSGLNPK       G         + ++  + +  +  + 
Sbjct:   596 ENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVE 655

Query:   359 RYMESKKCILFLGGQGDETFVTID----LSQRADSKIEIYQKMWRYMESKRPSVFVSDYE 414
             R +   +    L  Q + ++ T++    ++   DSKI IYQKMWRYME+++ +VFV  YE
Sbjct:   656 RMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYE 715

Query:   415 EGVKRVLEGDYAFLMESTMLDYEVQRNCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAI 474
             +G+KRV+EG YAFLMESTMLDY VQR+CNLTQIGGLLDSKGYGIATPKGSPWRD+ISLAI
Sbjct:   716 DGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAI 775

Query:   475 LELQEKGTIQMLYDKWWKNTGDVCNRDE 502
             LELQEKG IQ+LYDKWWKNTGDVCNRD+
Sbjct:   776 LELQEKGIIQILYDKWWKNTGDVCNRDD 803
GO:0015277 "kainate selective glutamate receptor activity" evidence=ISS
GO:0006811 "ion transport" evidence=IEA
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IEA
GO:0060025 "regulation of synaptic activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0048812 "neuron projection morphogenesis" evidence=IMP
FB|FBgn0039916 CG9935 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7M9 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5R4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTY2 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4T4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9T1 GRIK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV46 GRIK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M526 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E7ENK3 GRIK1 "Glutamate receptor ionotropic, kainate 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 5e-58
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 1e-46
pfam1061365 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L- 4e-22
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 2e-18
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-12
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 2e-09
cd06393384 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal le 2e-08
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 3e-08
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 3e-08
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 3e-08
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 5e-06
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 7e-06
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 9e-05
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 2e-04
cd06382327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 6e-04
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b 0.002
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information 
 Score =  192 bits (491), Expect = 5e-58
 Identities = 104/258 (40%), Positives = 136/258 (52%), Gaps = 41/258 (15%)

Query: 266 EIWLYVLAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLR 325
           E+WL +LAAYLLV   LF++ RFSPYEW  P       P   NQF++SNS WF  G  ++
Sbjct: 1   EVWLCILAAYLLVGVVLFLLERFSPYEWRGP-------PEEPNQFTLSNSLWFSFGALVQ 53

Query: 326 QGSGLNPKVLQQGSSRTLD--------------TA-LDS--KIEIYQKMWRYMESKKCIL 368
           QG    P+ L   S R L               TA L +   +E  Q   + +E      
Sbjct: 54  QGHRELPRSL---SGRILVGVWWFFALILLSSYTANLAAFLTVERMQSPIQSLED----- 105

Query: 369 FLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESK----RPSVFVSDYEEGVKRVLEG- 423
            L  Q    + T+      +   E     +R M       +  V V  YEEGV+RV +G 
Sbjct: 106 -LAKQNKIGYGTLRGGSTFEFFKESKNPTYRRMWEYMISFKGEVNVESYEEGVQRVRKGN 164

Query: 424 -DYAFLMESTMLDYEVQRN-CNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKG 481
             YAFLMES  L+YEV R+ C LT +G +  +KGYGIA PKGSP RD++S AILEL+E G
Sbjct: 165 GLYAFLMESAYLEYEVARDPCKLTTVGEVFGTKGYGIAFPKGSPLRDKLSRAILELRESG 224

Query: 482 TIQMLYDKWWKNTGDVCN 499
            +Q L +KWWK  G+ C+
Sbjct: 225 ELQKLENKWWKKKGE-CS 241

This family includes the four transmembrane regions of the ionotropic glutamate receptors and NMDA receptors. Length = 268
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|204533 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107388 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>gnl|CDD|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 504
KOG1054|consensus897 100.0
KOG4440|consensus 993 100.0
KOG1053|consensus 1258 100.0
KOG1052|consensus656 100.0
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.86
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.86
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.84
PRK11260266 cystine transporter subunit; Provisional 99.81
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.8
PRK15007243 putative ABC transporter arginine-biding protein; 99.8
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.8
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.78
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 99.78
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.77
PRK15437259 histidine ABC transporter substrate-binding protei 99.74
TIGR02285268 conserved hypothetical protein. Members of this fa 99.69
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.69
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.66
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.65
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.6
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.59
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.59
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.58
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.57
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.57
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 99.51
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 99.42
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 99.4
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 99.32
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 99.29
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 99.25
COG4623 473 Predicted soluble lytic transglycosylase fused to 99.22
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 99.19
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 98.92
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 98.75
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.66
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 98.6
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 98.47
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 98.47
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 98.21
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 98.11
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 98.01
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 97.8
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 97.75
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.66
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 97.64
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 97.63
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 97.43
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 96.03
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 95.99
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 95.86
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 95.7
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 95.66
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 95.47
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 95.39
PF01094348 ANF_receptor: Receptor family ligand binding regio 95.11
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 94.99
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 94.03
PF03466209 LysR_substrate: LysR substrate binding domain; Int 93.98
cd05466197 PBP2_LTTR_substrate The substrate binding domain o 93.88
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 93.74
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 93.52
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 93.22
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 92.89
cd08459201 PBP2_DntR_NahR_LinR_like The C-terminal substrate 92.53
cd08418201 PBP2_TdcA The C-terminal substrate binding domain 92.44
cd08468202 PBP2_Pa0477 The C-terminal substrate biniding doma 92.05
PRK11151305 DNA-binding transcriptional regulator OxyR; Provis 91.92
cd08417200 PBP2_Nitroaromatics_like The C-terminal substrate 91.69
cd08421198 PBP2_LTTR_like_1 The C-terminal substrate binding 91.68
CHL00180305 rbcR LysR transcriptional regulator; Provisional 91.39
cd08426199 PBP2_LTTR_like_5 The C-terminal substrate binding 91.3
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 91.14
cd08415196 PBP2_LysR_opines_like The C-terminal substrate-dom 90.57
KOG1056|consensus878 90.48
PRK10341312 DNA-binding transcriptional activator TdcA; Provis 90.44
cd08438197 PBP2_CidR The C-terminal substrate binding domain 90.43
PRK11553314 alkanesulfonate transporter substrate-binding subu 90.41
cd08433198 PBP2_Nac The C-teminal substrate binding domain of 90.09
cd08466200 PBP2_LeuO The C-terminal substrate binding domain 89.63
cd08460200 PBP2_DntR_like_1 The C-terminal substrate binding 89.54
cd08461198 PBP2_DntR_like_3 The C-terminal substrate binding 89.51
cd08412198 PBP2_PAO1_like The C-terminal substrate-binding do 89.44
cd08440197 PBP2_LTTR_like_4 TThe C-terminal substrate binding 89.35
cd08462200 PBP2_NodD The C-terminal substsrate binding domain 89.32
cd08463203 PBP2_DntR_like_4 The C-terminal substrate binding 89.13
cd08420201 PBP2_CysL_like C-terminal substrate binding domain 88.72
cd08467200 PBP2_SyrM The C-terminal substrate binding of LysR 88.62
cd08434195 PBP2_GltC_like The substrate binding domain of Lys 88.55
cd08411200 PBP2_OxyR The C-terminal substrate-binding domain 88.47
PRK12684313 transcriptional regulator CysB-like protein; Revie 88.4
cd08419197 PBP2_CbbR_RubisCO_like The C-terminal substrate bi 87.98
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 87.81
cd08441198 PBP2_MetR The C-terminal substrate binding domain 87.69
cd08435201 PBP2_GbpR The C-terminal substrate binding domain 87.62
cd08414197 PBP2_LTTR_aromatics_like The C-terminal substrate 87.47
cd08413198 PBP2_CysB_like The C-terminal substrate domain of 86.56
PRK11242296 DNA-binding transcriptional regulator CynR; Provis 86.43
cd08429204 PBP2_NhaR The C-terminal substrate binding domain 86.35
cd08423200 PBP2_LTTR_like_6 The C-terminal substrate binding 86.24
cd08469221 PBP2_PnbR The C-terminal substrate binding domain 85.88
PRK12683309 transcriptional regulator CysB-like protein; Revie 85.72
PRK12682309 transcriptional regulator CysB-like protein; Revie 85.51
cd08456196 PBP2_LysR The C-terminal substrate binding domain 85.44
cd08425197 PBP2_CynR The C-terminal substrate-binding domain 85.31
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 85.12
cd08442193 PBP2_YofA_SoxR_like The C-terminal substrate bindi 84.77
cd08427195 PBP2_LTTR_like_2 The C-terminal substrate binding 84.57
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 84.48
cd08451199 PBP2_BudR The C-terminal substrate binding domain 84.47
cd08464200 PBP2_DntR_like_2 The C-terminal substrate binding 84.12
PRK12681324 cysB transcriptional regulator CysB; Reviewed 83.66
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 83.0
PRK11233305 nitrogen assimilation transcriptional regulator; P 82.93
PRK09791302 putative DNA-binding transcriptional regulator; Pr 82.46
cd08416199 PBP2_MdcR The C-terminal substrate-binding domian 82.44
cd08443198 PBP2_CysB The C-terminal substrate domain of LysR- 82.01
TIGR02424300 TF_pcaQ pca operon transcription factor PcaQ. Memb 81.82
cd08448197 PBP2_LTTR_aromatics_like_2 The C-terminal substrat 81.7
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 81.15
cd08453200 PBP2_IlvR The C-terminal substrate binding domain 80.31
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 80.12
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 80.1
cd08437198 PBP2_MleR The substrate binding domain of LysR-typ 80.09
>KOG1054|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.5e-99  Score=743.80  Aligned_cols=477  Identities=40%  Similarity=0.716  Sum_probs=435.4

Q ss_pred             eeeEEEEeeecCCCccccchhhhhhhccccc-------CCCccccccccccchhhhHHHHHHHHHHHhhhcCCccc----
Q psy1412           6 HVLAAGLALLDKSSVIKTSNLSCDLEVPWRD-------GLSLYNYINTAEPALMYDSVHVLAAGLALLDKSSVIKT----   74 (504)
Q Consensus         6 ~~~~tg~r~~d~~~~~~~~~~~~~~~~~W~~-------g~~~~~~i~~~~~~~~yDav~~~a~a~~~~~~~~~~~~----   74 (504)
                      .+++||||++|.+.++     ++++.++|..       |.+ ...++. .+|++||||.+.++|++.+.+.+ +..    
T Consensus       257 ~aNitgFqivn~~~~~-----~~k~~~~~~~l~~~~~~g~~-~~~~k~-tsAlthDailV~~eaf~~~~~q~-~~~~rRG  328 (897)
T KOG1054|consen  257 GANITGFQIVNKNNPM-----VKKFIQRWKELDEREYPGAS-NDPIKY-TSALTHDAILVMAEAFRSLRRQR-IDISRRG  328 (897)
T ss_pred             CcceeEEEEecCCChH-----HHHHHHHHhhhcccccCCCC-CCCcch-hhhhhhhHHHHHHHHHHHHHHhh-hchhccC
Confidence            4577999999999999     9999999954       322 247888 99999999999999999986422 222    


Q ss_pred             ccCCC--CCCCcccCchhHHHHhhh----------------------ceEEEeeccceeeeeEecCCCCceeecC---CC
Q psy1412          75 SNLSC--DLEVPWRDGLSLYNYINT----------------------LDLLKLKREELRKVGHWTPAEGINITDR---SA  127 (504)
Q Consensus        75 ~~~~c--~~~~~~~~G~~l~~~l~~----------------------~~i~~~~~~~~~~vg~W~~~~gl~~~~~---~~  127 (504)
                      ..-+|  ++..+|.+|..+-+++++                      .+|++++.++.+++|+|+...|+.....   ..
T Consensus       329 ~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~~G~R~Nyt~~i~elk~~~~rk~~~W~e~~~fv~~~t~a~~~  408 (897)
T KOG1054|consen  329 NAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDKYGRRTNYTIDIVELKSNGSRKVGYWNEGEGFVPGSTVAQSR  408 (897)
T ss_pred             CCccccCCCCCchhcchhHHHHHHheeecccccceeecccCccccceEEEEEeccCCcceeeeecccCceeecccccccc
Confidence            12378  568899999999999998                      7899999999999999999999886543   23


Q ss_pred             ccccccCCeEEEEEeecccCeEEEecC-CCCCCCccceehhHHHHHHHHHHcCceEEEEEcCCCCCccccCCCCcchhhH
Q psy1412         128 FYETSTNNVTLIVMTREEKPYVMVKND-ANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIV  206 (504)
Q Consensus       128 ~~~~~~~~~~l~V~~~~~~P~~~~~~~-~~~~~~~~~~G~~idll~~la~~l~f~~~~~~~~~~~~G~~~~~~g~w~gli  206 (504)
                      +.....++++..|.++.+.||++.+.+ ..+.||++|+||||||+.+||+..+++|++..++|++||++++.+.-|+||+
T Consensus       409 ~d~~~~~n~tvvvttiL~spyvm~kkn~~~~egn~ryEGyCvdLa~~iAkhi~~~Y~l~iv~dgkyGardaD~k~WnGMv  488 (897)
T KOG1054|consen  409 NDQASKENRTVVVTTILESPYVMLKKNHEQLEGNERYEGYCVDLAAEIAKHIGIKYKLFIVGDGKYGARDADTKIWNGMV  488 (897)
T ss_pred             ccccccccceEEEEEecCCchhHHHhhHHHhcCCcccceeHHHHHHHHHHhcCceEEEEEecCCcccccCCCcccccchh
Confidence            444556888999999999999999887 6678999999999999999999999999999999999999999444599999


Q ss_pred             HHHhhccccceecceeeecccceeeeeccceeeccEEEEEEccCCCCCCcccccccCchhHHHHHHHHHHHHHHHHHHHH
Q psy1412         207 KELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMA  286 (504)
Q Consensus       207 ~~l~~g~~D~av~~~tit~~R~~~vdFs~p~~~~g~~ilv~~~~~~~~~~~~fl~Pf~~~vWl~i~~~~~~v~~~~~~i~  286 (504)
                      |+|..|+||+|++++|||.+|+++||||.|||.+|++|++++|.++.++.|+||.|+..++|+|++.+|+.|++++|+++
T Consensus       489 GeLv~grAdiavApLTIt~~REeviDFSKPfMslGISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVS  568 (897)
T KOG1054|consen  489 GELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVS  568 (897)
T ss_pred             HHHhcCccceEEeeeeeehhhhhhhccccchhhcCeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCCCCccCCCCCCCC---CCcccCcccchhHHHHHHHHhhccCCCCCCcccccccceehcc--------------ch--
Q psy1412         287 RFSPYEWSNPHPCLAE---SPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDT--------------AL--  347 (504)
Q Consensus       287 r~~p~~~~~~~~~~~~---~~~~~~~~~l~~~~w~~~~~l~~qg~~~~p~~~~~~s~R~v~~--------------An--  347 (504)
                      ||||||||-.... ++   +....|.|++.|++||+++++||||+++.||++   |+||+.+              ||  
T Consensus       569 rFSPYEwh~Ee~~-rg~~t~~~~~NeFgifNsLWFsLgAFMQQG~DI~PRsl---SGRIvggvWWFFTlIIiSSYTANLA  644 (897)
T KOG1054|consen  569 RFSPYEWHTEEFE-RGRFTPSDPPNEFGIFNSLWFSLGAFMQQGCDISPRSL---SGRIVGGVWWFFTLIIISSYTANLA  644 (897)
T ss_pred             ccCchheeccccc-cCCCCCCCCCccchhhHHHHHHHHHHHhcCCCCCcccc---ccceeccchhhhhhhhhhhhhhHHH
Confidence            9999999976542 22   234779999999999999999999999999999   9999988              66  


Q ss_pred             -hhhhhhhhhhhhhcccchhhhhccCCCCceeeee----ecchhccchhHHHHHHHHHHHhcCCCcccCChHHHHHhhh-
Q psy1412         348 -DSKIEIYQKMWRYMESKKCILFLGGQGDETFVTI----DLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVL-  421 (504)
Q Consensus       348 -~Ltv~~~~~~~~~~~~i~s~~dL~~~~~i~~g~~----~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~egi~~v~-  421 (504)
                       |||++      ||.+||+|+|||++|++|.||+.    +.+||++|+++.|++||.||++..|++|+.+++||++||+ 
T Consensus       645 AFLTvE------rMvsPIESaEDLAkQteIaYGt~~~GSTkeFFr~Skiavy~kMW~yM~SaepsVFv~t~aeGv~rVRk  718 (897)
T KOG1054|consen  645 AFLTVE------RMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMKSAEPSVFVRTTAEGVARVRK  718 (897)
T ss_pred             HHHhHH------hhcCcchhHHHHhhcceeeeeecCCCchHHHHhhhhHHHHHHHHHHHhcCCcceeeehhhhHHHHHHh
Confidence             99999      99999999999999999999998    8899999999999999999999999999999999999996 


Q ss_pred             -cCCeEEEeecchhhhhhhcC-CccEEcCCccCCcceEEEecCCCCCchHHHHHHHhhhccChhHHHHHhhccCCCCCCC
Q psy1412         422 -EGDYAFLMESTMLDYEVQRN-CNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCN  499 (504)
Q Consensus       422 -~g~~A~i~e~~~~~y~~~~~-c~l~~vg~~~~~~~~g~a~~k~Spl~~~in~ail~l~e~G~l~~l~~kw~~~~~~~C~  499 (504)
                       +|+|||+.|+++.+|..++. |+.+.||..+++.|||+|.||||.|+..+|.|+|+|.|.|++++|++|||.|+ ++|.
T Consensus       719 sKGkyAfLLEsTmNey~eqRkPCDTMKVGgNLds~GYGiATp~Gsslr~~vNLAvLkL~E~G~LdKLkNKWWYDk-GeC~  797 (897)
T KOG1054|consen  719 SKGKYAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDK-GECG  797 (897)
T ss_pred             cCCceEeehHhhhhhhhhccCCccceecccccCCcceeecCCCCcccccchhhhhhhhcccchHHHhhhhhcccc-cccC
Confidence             67799999999999998876 99999999999999999999999999999999999999999999999999997 9997


Q ss_pred             CC
Q psy1412         500 RD  501 (504)
Q Consensus       500 ~~  501 (504)
                      +.
T Consensus       798 sg  799 (897)
T KOG1054|consen  798 SG  799 (897)
T ss_pred             CC
Confidence            64

>KOG4440|consensus Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins [] Back     alignment and domain information
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08469 PBP2_PnbR The C-terminal substrate binding domain of LysR-type transcriptional regulator PnbR, which is involved in regulating the pnb genes encoding enzymes for 4-nitrobenzoate catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd08416 PBP2_MdcR The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08443 PBP2_CysB The C-terminal substrate domain of LysR-type transcriptional regulator CysB contains type 2 periplasmic binding fold Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ Back     alignment and domain information
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
3kg2_A823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 4e-80
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 4e-38
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 9e-38
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-37
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-37
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-37
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-37
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-37
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 2e-37
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 2e-37
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-37
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 2e-37
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 7e-37
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 1e-36
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 1e-35
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 1e-35
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 1e-35
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 1e-35
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 3e-35
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 2e-34
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 2e-34
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 3e-28
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 6e-26
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 3e-28
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 6e-26
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 3e-28
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 6e-26
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 7e-28
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 5e-26
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 2e-27
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 4e-26
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-27
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 5e-26
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 2e-27
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 7e-26
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 2e-27
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 5e-26
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 2e-27
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 5e-26
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 3e-27
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 6e-26
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 3e-27
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 6e-26
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 3e-27
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-25
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 3e-27
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 6e-26
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 3e-27
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-25
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 3e-27
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 6e-26
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 3e-27
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 6e-26
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 3e-27
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 1e-26
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 3e-27
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 7e-26
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 3e-27
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 6e-26
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 3e-27
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 6e-26
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 3e-27
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 6e-26
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 3e-27
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 1e-26
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 3e-27
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 2e-26
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 3e-27
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 6e-26
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 3e-27
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 8e-27
2i3v_A259 Measurement Of Conformational Changes Accompanying 3e-27
2i3v_A259 Measurement Of Conformational Changes Accompanying 6e-25
2i3w_A259 Measurement Of Conformational Changes Accompanying 3e-27
2i3w_A259 Measurement Of Conformational Changes Accompanying 2e-25
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 7e-27
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 7e-26
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 7e-27
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 8e-27
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 7e-26
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 9e-27
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 9e-27
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 7e-26
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 9e-27
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 7e-26
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-26
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 6e-26
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 2e-26
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 3e-26
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 2e-25
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 8e-26
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 1e-25
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 9e-26
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 3e-25
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 9e-26
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 1e-25
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 9e-26
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 9e-26
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 2e-18
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 1e-13
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 3e-17
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 1e-12
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 1e-13
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 2e-08
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-13
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 9e-09
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-13
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 9e-09
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 2e-13
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 9e-05
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 2e-13
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 3e-08
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 8e-12
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 1e-06
2pyy_A228 Crystal Structure Of The Glur0 Ligand-Binding Core 9e-07
3h6g_A395 Crystal Structure Of The Glur6 Amino Terminal Domai 1e-04
3qlt_A395 Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge H 1e-04
1ggg_A226 Glutamine Binding Protein Open Ligand-Free Structur 2e-04
4io2_A248 Crystal Structure Of The Avglur1 Ligand Binding Dom 5e-04
3om0_A393 Crystal Structure Of The Gluk5 (Ka2) Atd Crystallog 5e-04
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure 
Iteration: 1

 Score =  295 bits (755), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 179/501 (35%), Positives = 264/501 (52%), Gaps = 55/501 (10%)
Query: 50  ALMYDSVHVLAAGLALLDKSSV-IKTSNLSCDL----EVPWRDGLSLYNYIN-------- 96
           AL YD+V V+      L K  + I     + D      VPW  G+ +   +         
Sbjct: 274 ALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLS 333
Query: 97  --------------TLDXXXXXXXXXXXVGHWTPAEGINITDRSAFYETSTNNVTLIVMT 142
                         T++           +G+W+  + + +T+      +     T++V T
Sbjct: 334 GNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTEDDT---SGLEQKTVVVTT 390
Query: 143 REEKPYVMVK-NDANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKE 201
             E PYVM+K N A L GN  +EG+C+DL   IA   GF + L +V D  YG  D +TK 
Sbjct: 391 ILESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI 450
Query: 202 WNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMN 261
           WNG+V EL+  KAD+A+A +TI   RE VIDF+KPFM+LGI I+ K P      +FSF++
Sbjct: 451 WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD 510
Query: 262 PLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWSNPH---PCLAESPIVENQFSVSNSFWF 318
           PLA EIW+ ++ AY+ VS  LF+++RFSPYEW           +S    N+F + NS WF
Sbjct: 511 PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF 570
Query: 319 ITGTFLRQGSGLNPKVLQQGSSRTLD-----------TALDSKIEIYQKMWRYMESKKCI 367
             G F++QG+ ++P+ L   S R +            ++  + +  +  + R +   +  
Sbjct: 571 SLGAFMQQGADISPRSL---SGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESA 627
Query: 368 LFLGGQGDETFVTIDLSQRAD----SKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVL-- 421
             L  Q +  + T+D     +    SKI ++ KMW YM S  PSVFV    EGV RV   
Sbjct: 628 EDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKS 687
Query: 422 EGDYAFLMESTMLDYEVQRN-CNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEK 480
           +G YA+L+ESTM +Y  QR  C+  ++GG LDSKGYGIATPKGS     ++LA+L+L E+
Sbjct: 688 KGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQ 747
Query: 481 GTIQMLYDKWWKNTGDVCNRD 501
           G +  L +KWW + G+   +D
Sbjct: 748 GLLDKLKNKWWYDKGECGAKD 768
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2PYY|A Chain A, Crystal Structure Of The Glur0 Ligand-Binding Core From Nostoc Punctiforme In Complex With (L)-Glutamate Length = 228 Back     alignment and structure
>pdb|3H6G|A Chain A, Crystal Structure Of The Glur6 Amino Terminal Domain Dimer Assembly Length = 395 Back     alignment and structure
>pdb|3QLT|A Chain A, Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge Homodimer Assembly Length = 395 Back     alignment and structure
>pdb|1GGG|A Chain A, Glutamine Binding Protein Open Ligand-Free Structure Length = 226 Back     alignment and structure
>pdb|4IO2|A Chain A, Crystal Structure Of The Avglur1 Ligand Binding Domain Complex With Glutamate At 1.37 Angstrom Resolution Length = 248 Back     alignment and structure
>pdb|3OM0|A Chain A, Crystal Structure Of The Gluk5 (Ka2) Atd Crystallographic Dimer At 1.4 Angstrom Resolution Length = 393 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 1e-124
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 6e-88
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 4e-47
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-41
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 1e-40
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 3e-35
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-38
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-36
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 1e-26
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 5e-22
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-23
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 3e-14
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 5e-21
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-13
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 3e-12
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 2e-11
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 3e-11
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 5e-11
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 2e-06
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 2e-10
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 6e-06
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 2e-10
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 3e-10
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 2e-04
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 4e-10
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 1e-04
2q88_A257 EHUB, putative ABC transporter amino acid-binding 4e-10
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 6e-10
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 5e-06
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 1e-09
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 2e-04
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 2e-09
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 2e-09
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 7e-04
3hv1_A268 Polar amino acid ABC uptake transporter substrate 2e-09
3hv1_A268 Polar amino acid ABC uptake transporter substrate 9e-05
3k4u_A245 Binding component of ABC transporter; structural g 2e-09
3k4u_A245 Binding component of ABC transporter; structural g 3e-05
3kzg_A237 Arginine 3RD transport system periplasmic binding 2e-09
3kzg_A237 Arginine 3RD transport system periplasmic binding 8e-04
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 3e-09
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 8e-07
3del_B242 Arginine binding protein; alpha and beta protein ( 5e-09
3del_B242 Arginine binding protein; alpha and beta protein ( 8e-05
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 5e-09
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 3e-06
3tql_A227 Arginine-binding protein; transport and binding pr 5e-09
3tql_A227 Arginine-binding protein; transport and binding pr 4e-04
1xt8_A292 Putative amino-acid transporter periplasmic solut 7e-09
1xt8_A292 Putative amino-acid transporter periplasmic solut 2e-04
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 8e-09
3qax_A268 Probable ABC transporter arginine-binding protein; 8e-09
3qax_A268 Probable ABC transporter arginine-binding protein; 5e-05
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 1e-08
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 4e-05
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 3e-08
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 6e-08
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 1e-04
2vha_A287 Periplasmic binding transport protein; periplasmic 1e-07
2vha_A287 Periplasmic binding transport protein; periplasmic 2e-05
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 4e-07
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 8e-04
4eq9_A246 ABC transporter substrate-binding protein-amino A 8e-07
2yln_A283 Putative ABC transporter, periplasmic binding Pro 9e-07
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 2e-06
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 7e-04
2o1m_A258 Probable amino-acid ABC transporter extracellular- 3e-06
2o1m_A258 Probable amino-acid ABC transporter extracellular- 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  382 bits (981), Expect = e-124
 Identities = 185/545 (33%), Positives = 277/545 (50%), Gaps = 61/545 (11%)

Query: 11  GLALLDKSSVIKTSNLSCDLEVPWRDGLSLYNYINTAEPALMYDSVHVLAAGLALL---- 66
           G  ++D    + +  +     +  ++    +        AL YD+V V+      L    
Sbjct: 235 GFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQR 294

Query: 67  -DKSSVIKTSNLSCDLEVPWRDGLSLYNYIN----------------------TLDLLKL 103
            + S      +   +  VPW  G+ +   +                       T+++++L
Sbjct: 295 IEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMEL 354

Query: 104 KREELRKVGHWTPAEGINITDRSAFYETSTNNVTLIVMTREEKPYVMVK-NDANLTGNAM 162
           K    RK+G+W+  + + +T+            T++V T  E PYVM+K N A L GN  
Sbjct: 355 KTNGPRKIGYWSEVDKMVLTEDDTSG---LEQKTVVVTTILESPYVMMKANHAALAGNER 411

Query: 163 FEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKADLAVASMT 222
           +EG+C+DL   IA   GF + L +V D  YG  D +TK WNG+V EL+  KAD+A+A +T
Sbjct: 412 YEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLT 471

Query: 223 INYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTL 282
           I   RE VIDF+KPFM+LGI I+ K P      +FSF++PLA EIW+ ++ AY+ VS  L
Sbjct: 472 ITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVL 531

Query: 283 FVMARFSPYEWSNPH---PCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGS 339
           F+++RFSPYEW           +S    N+F + NS WF  G F++QG+       +  S
Sbjct: 532 FLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGA---DISPRSLS 588

Query: 340 SRTLD--------------TALDSKIEIYQKMWRYMESKKCILFLGGQGDETFVTIDLSQ 385
            R +               TA  +     ++M   +ES +    L  Q +  + T+D   
Sbjct: 589 GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED---LSKQTEIAYGTLDSGS 645

Query: 386 RAD----SKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVL--EGDYAFLMESTMLDYEVQ 439
             +    SKI ++ KMW YM S  PSVFV    EGV RV   +G YA+L+ESTM +Y  Q
Sbjct: 646 TKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQ 705

Query: 440 R-NCNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVC 498
           R  C+  ++GG LDSKGYGIATPKGS     ++LA+L+L E+G +  L +KWW + G+  
Sbjct: 706 RKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDKGECG 765

Query: 499 NRDED 503
            +D  
Sbjct: 766 AKDSG 770
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 100.0
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 100.0
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 100.0
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 100.0
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.98
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.97
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.97
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.96
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.9
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.9
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.89
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.88
3k4u_A245 Binding component of ABC transporter; structural g 99.88
3del_B242 Arginine binding protein; alpha and beta protein ( 99.87
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.86
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.86
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.86
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.85
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.85
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.84
3tql_A227 Arginine-binding protein; transport and binding pr 99.84
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.83
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.83
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.82
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.82
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.82
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.82
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.81
3qax_A268 Probable ABC transporter arginine-binding protein; 99.8
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.8
2vha_A287 Periplasmic binding transport protein; periplasmic 99.8
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.78
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.77
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.77
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.76
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.76
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.68
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 98.97
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 98.78
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 98.77
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 98.76
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.63
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.6
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 98.56
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 98.52
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 98.45
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.44
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 97.95
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 96.62
2f5x_A312 BUGD; periplasmic binding protein, transport prote 96.61
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 96.61
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 96.19
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 96.17
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 96.16
4ab5_A222 Transcriptional regulator, LYSR family; transcript 95.69
3qsl_A346 Putative exported protein; unknown, structural gen 95.66
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 95.19
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 95.17
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 95.11
3oxn_A241 Putative transcriptional regulator, LYSR family; s 94.34
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 94.33
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 93.64
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 93.03
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 92.99
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; 92.8
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 92.79
3i45_A387 Twin-arginine translocation pathway signal protei; 92.05
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 91.87
3fzv_A306 Probable transcriptional regulator; LYSR, structur 91.39
3hhf_B213 Transcriptional regulator, LYSR family; transcript 90.45
2esn_A310 Probable transcriptional regulator; PA0477, APC582 89.81
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R fami 89.41
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 89.18
3td9_A366 Branched chain amino acid ABC transporter, peripl 88.98
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 88.8
2y7p_A218 LYSR-type regulatory protein; transcription regula 88.1
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional re 88.08
2nr1_A27 NR1 M2, M2; receptor, signal, postsynaptic membran 87.96
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 87.55
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR tran 87.3
2ql3_A209 Probable transcriptional regulator, LYSR family P; 86.85
2a9h_A155 Voltage-gated potassium channel; potassium channel 85.12
3r26_A237 Molybdate-binding periplasmic protein; protein bin 84.41
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 83.52
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 83.3
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR f 83.25
4evq_A375 Putative ABC transporter subunit, substrate-bindi 81.41
1uth_A315 LYSR-type regulatory protein; transcription regula 81.17
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 80.61
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, tra 80.31
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=3.1e-66  Score=580.43  Aligned_cols=474  Identities=39%  Similarity=0.702  Sum_probs=396.1

Q ss_pred             EEEEeeecCCCccccchhhhhhhcccccCCCc-----cc-cccccccchhhhHHHHHHHHHHHhhhcC-Cc--ccccCCC
Q psy1412           9 AAGLALLDKSSVIKTSNLSCDLEVPWRDGLSL-----YN-YINTAEPALMYDSVHVLAAGLALLDKSS-VI--KTSNLSC   79 (504)
Q Consensus         9 ~tg~r~~d~~~~~~~~~~~~~~~~~W~~g~~~-----~~-~i~~~~~~~~yDav~~~a~a~~~~~~~~-~~--~~~~~~c   79 (504)
                      +++++..+++.+.     .+++.++|......     .. .+.. +++++||||+++|+|++++...+ .+  ...+.+|
T Consensus       233 ~~~~~~~~~~~~~-----~~~f~~~~~~~~~~~~~~~~~~~~~~-~a~~~YDAv~~la~Al~~~~~~~~~~~~~~~~~~c  306 (823)
T 3kg2_A          233 VSGFQIVDYDDSL-----VSKFIERWSTLEEKEYPGAHTATIKY-TSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDC  306 (823)
T ss_dssp             EEEEESSCTTSHH-----HHHHHHHHTTSCTTTSTTCCSSCCCH-HHHHHHHHHHHHHHHHHHHHTTTCCCCCSSCCCCT
T ss_pred             ceEeeeecCCchH-----HHHHHHHHHhhcccccCCCCccccch-hhHHHHHHHHHHHHHHHHHHhhccccccCCCCCCc
Confidence            5788887776655     78888888652111     00 2333 68999999999999999986422 11  2345688


Q ss_pred             CCC--CcccCchhHHHHhhh----------------------ceEEEeeccceeeeeEecCCCCceeecCCCccccccCC
Q psy1412          80 DLE--VPWRDGLSLYNYINT----------------------LDLLKLKREELRKVGHWTPAEGINITDRSAFYETSTNN  135 (504)
Q Consensus        80 ~~~--~~~~~G~~l~~~l~~----------------------~~i~~~~~~~~~~vg~W~~~~gl~~~~~~~~~~~~~~~  135 (504)
                      ...  .+|.+|..+.++|++                      |+|+|+.++++++||.|++..|+....   +...++++
T Consensus       307 ~~~~~~~~~~g~~l~~~l~~~~f~G~tG~i~fd~~G~~~~~~~~I~~~~~~g~~~vg~w~~~~g~~~~~---~~~~~~~~  383 (823)
T 3kg2_A          307 LANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVLTE---DDTSGLEQ  383 (823)
T ss_dssp             TCSSCCCCTHHHHHHHHHTTCCCEETTEECCBCSSSCBCSCEEEEEEECSSCEEEEEEEETTTEEEECC---CCCSSCCC
T ss_pred             cCCCCCcccchHHHHHHHHhcccCCcccCeEECCCCcccccEEEEEEEcCCCCeeEEEEcCCCCceecc---CcccccCC
Confidence            654  679999999999997                      899999999999999999998888554   34557789


Q ss_pred             eEEEEEeecccCeEEEecC-CCCCCCccceehhHHHHHHHHHHcCceEEEEEcCCCCCccccCCCCcchhhHHHHhhccc
Q psy1412         136 VTLIVMTREEKPYVMVKND-ANLTGNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHTYGVYDHETKEWNGIVKELMDKKA  214 (504)
Q Consensus       136 ~~l~V~~~~~~P~~~~~~~-~~~~~~~~~~G~~idll~~la~~l~f~~~~~~~~~~~~G~~~~~~g~w~gli~~l~~g~~  214 (504)
                      ++|+|++...+||++.+++ +...++++++|||+||++++++++||+++++.+++++||..++.+|+|+|++++|.+|++
T Consensus       384 ~~l~v~~~~~~P~~~~~~~~~~~~~~~~~~G~~~dl~~~~a~~l~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~l~~~~~  463 (823)
T 3kg2_A          384 KTVVVTTILESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKA  463 (823)
T ss_dssp             CCEEEEECCCTTTSEECTTGGGCCGGGGEESHHHHHHHHHHHHHTCCEEEEECSSCCCCCBCTTTCCBCHHHHHHHTTSC
T ss_pred             CEEEEEEecCCCcEEEecCccccCCCCceEEEHHHHHHHHHHHcCCcEEEEEccCCcccccCCCCCchhhHHHhhccccC
Confidence            9999999999999998654 334567899999999999999999999999999999999998889999999999999999


Q ss_pred             cceecceeeecccceeeeeccceeeccEEEEEEccCCCCCCcccccccCchhHHHHHHHHHHHHHHHHHHHHhhCCCCcc
Q psy1412         215 DLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYVLAAYLLVSFTLFVMARFSPYEWS  294 (504)
Q Consensus       215 D~av~~~tit~~R~~~vdFs~p~~~~g~~ilv~~~~~~~~~~~~fl~Pf~~~vWl~i~~~~~~v~~~~~~i~r~~p~~~~  294 (504)
                      |++++++++|++|.+.+|||.||+..+++++++++.+...+++.|++||++.+|++++++++++++++|+++|++|++|+
T Consensus       464 D~~~~~~~~t~~R~~~~dfs~py~~~~~~~~v~~~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~w~  543 (823)
T 3kg2_A          464 DIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH  543 (823)
T ss_dssp             SEECSCCBCCHHHHTTEEECSCSEEECEEEEEECCCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC--------
T ss_pred             cEEecceecchhheeeEEeccchhhCCEEEEEECCCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhhcc
Confidence            99999999999999999999999999999999999877788999999999999999999999999999999999999999


Q ss_pred             CCCCCCCC---CCcccCcccchhHHHHHHHHhhccCCCCCCcccccccceehcc--------------ch---hhhhhhh
Q psy1412         295 NPHPCLAE---SPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDT--------------AL---DSKIEIY  354 (504)
Q Consensus       295 ~~~~~~~~---~~~~~~~~~l~~~~w~~~~~l~~qg~~~~p~~~~~~s~R~v~~--------------An---~Ltv~~~  354 (504)
                      +++.|...   .....+++++.+++|++++++++||.+..|++.   ++|++++              ||   +||++  
T Consensus       544 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~p~~~---~~R~~~~~w~~~~lil~~~Yta~L~s~Lt~~--  618 (823)
T 3kg2_A          544 TEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGADISPRSL---SGRIVGGVWWFFTLIIISSYTANLAAFLTVE--  618 (823)
T ss_dssp             ---------------CHHHHHHHHHHHTTTTSCC------CCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
T ss_pred             CcccccccccccccccccccHHHHHHHHHHHHHhcCCCcCCcch---hhhhHHHHHHHHHHHHHHHHHHHHHHHhccc--
Confidence            88765532   223456788999999999999999999999999   9999987              33   89999  


Q ss_pred             hhhhhhcccchhhhhccCCCCceeeee----ecchhccchhHHHHHHHHHHHhcCCCcccCChHHHHHhhh--cCCeEEE
Q psy1412         355 QKMWRYMESKKCILFLGGQGDETFVTI----DLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVL--EGDYAFL  428 (504)
Q Consensus       355 ~~~~~~~~~i~s~~dL~~~~~i~~g~~----~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~egi~~v~--~g~~A~i  428 (504)
                          ++.++|++++||.+++.+.+|++    ...+|++++...|++|+++|+..++.+++.+.+|++++++  +|.|||+
T Consensus       619 ----~~~~~I~s~~dL~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~  694 (823)
T 3kg2_A          619 ----RMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYL  694 (823)
T ss_dssp             ----HHCCCCCSSHHHHHCCSSEEECBSSSHHHHHHHHCCCHHHHHHHHHHHHCSSCCCBSSHHHHHHHHHTTTTSEEEE
T ss_pred             ----ccCCCCCCHHHHhhCCCeeEEEEeCCcHHHHHHhccchHHHHHHHHHHhcCCccccCCHHHHHHHHhccCCceEEE
Confidence                99999999999999888899876    5678899999999999999999888889999999999995  5669999


Q ss_pred             eecchhhhhhhcC-CccEEcCCccCCcceEEEecCCCCCchHHHHHHHhhhccChhHHHHHhhccCCCCCCCCC
Q psy1412         429 MESTMLDYEVQRN-CNLTQIGGLLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCNRD  501 (504)
Q Consensus       429 ~e~~~~~y~~~~~-c~l~~vg~~~~~~~~g~a~~k~Spl~~~in~ail~l~e~G~l~~l~~kw~~~~~~~C~~~  501 (504)
                      .|.+.++|+.+++ |+++.+++.+...+|||++||||||++.||++|++|+|+|++++|+++||.++ ++|...
T Consensus       695 ~~~~~~~y~~~~~~c~l~~v~~~~~~~~~~~~~~k~spl~~~~~~~il~l~e~G~~~~~~~~w~~~~-~~c~~~  767 (823)
T 3kg2_A          695 LESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGLLDKLKNKWWYDK-GECGAK  767 (823)
T ss_dssp             EEHHHHHHHHTSTTCCEEEESCCSSCEEECCEEETTCSSHHHHHHHHHHHHHTTHHHHHHHHHHTTS-CSCSST
T ss_pred             echHHHHHHHhcCCCceEEccccccccceeEeecCCChHHHHHHHHHHHHHhCCcHHHHHHhhCcCC-CCCCCC
Confidence            9999999998877 99999999999999999999999999999999999999999999999999875 889764
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure
>3hhf_B Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 2.30A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding DO cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2y7p_A LYSR-type regulatory protein; transcription regulator, DNA-binding, transcription, transcr factor, transcription regulation; HET: SAL PEU; 1.85A {Burkholderia SP} PDB: 2y7k_A* 2y84_A 2y7w_A 2y7r_A Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Back     alignment and structure
>2nr1_A NR1 M2, M2; receptor, signal, postsynaptic membrane; NMR {Homo sapiens} SCOP: j.35.1.1 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR struc genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli} PDB: 3hfu_A Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family P; APC7314, rhodococcus RHA1, structural genomics, PSI-2; HET: MSE; 2.05A {Rhodococcus SP} Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcripti regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 504
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 5e-25
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 4e-24
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 4e-22
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 8e-19
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 2e-18
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 4e-15
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 3e-17
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 6e-15
d1xt8a1248 c.94.1.1 (A:10-257) Putative amino-acid transporte 1e-07
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-06
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 3e-06
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 2e-04
d1lsta_238 c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding 5e-04
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Glutamate receptor ligand binding core
species: Rat (Rattus norvegicus), GluR2 [TaxId: 10116]

 Score =  102 bits (253), Expect = 5e-25
 Identities = 58/145 (40%), Positives = 79/145 (54%), Gaps = 3/145 (2%)

Query: 354 YQKMWRYMESKKCILFLGGQGDETFVTIDLSQRADSKIEIYQKMWRYMESKRPSVFVSDY 413
            +K      ++                        SKI ++ KMW YM S  PSVFV   
Sbjct: 113 IKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTT 172

Query: 414 EEGVKRVLEG--DYAFLMESTMLDYEVQRN-CNLTQIGGLLDSKGYGIATPKGSPWRDRI 470
            EGV RV +    YA+L+ESTM +Y  QR  C+  ++GG LDSKGYGIATPKGS   + +
Sbjct: 173 AEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAV 232

Query: 471 SLAILELQEKGTIQMLYDKWWKNTG 495
           +LA+L+L E+G +  L +KWW + G
Sbjct: 233 NLAVLKLNEQGLLDKLKNKWWYDKG 257
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Length = 248 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Length = 238 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 100.0
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 100.0
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.97
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.96
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.91
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.88
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.83
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.81
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 97.24
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.59
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli 95.36
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 94.86
d1al3a_237 Cofactor-binding fragment of LysR-type protein Cys 94.19
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 93.84
d1i6aa_212 Hydrogen peroxide-inducible genes LysR-type activa 92.18
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 92.05
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 84.87
d1ixca2205 LysR-type regulatory protein CbnR {Ralstonia eutro 81.16
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

Probab=100.00  E-value=1.2e-36  Score=294.64  Aligned_cols=242  Identities=32%  Similarity=0.606  Sum_probs=193.1

Q ss_pred             EEEEEeecccCeEEEecCCCCC-------------------------CCccceehhHHHHHHHHHHcCceEEEEEcCCCC
Q psy1412         137 TLIVMTREEKPYVMVKNDANLT-------------------------GNAMFEGFCIDLLKSIAAQVGFHFVLRLVPDHT  191 (504)
Q Consensus       137 ~l~V~~~~~~P~~~~~~~~~~~-------------------------~~~~~~G~~idll~~la~~l~f~~~~~~~~~~~  191 (504)
                      ||+|+|.+++||+++.+.++.+                         +..+++||||||+++|+++|||+|+++.+++++
T Consensus         2 hl~v~t~~~~Pfv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~iDl~~~ia~~lg~~~e~~~v~~~~   81 (277)
T d2a5sa1           2 HLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGK   81 (277)
T ss_dssp             CEEEEECCBTTTBEEEECCCC-CCCCTTCEEEEEEEESSSSSSCEEEEEEEEESHHHHHHHHHHHHHTCCEEEEECCSSS
T ss_pred             ceEEEEEecCCeEEEeccCcccCcccCCCcccceecccccCCCCCcccccceeeeHHHHHHHHHHHhCCCEEEEEccCCC
Confidence            7999999999999876532211                         124578999999999999999999999999999


Q ss_pred             CccccCCCCcchhhHHHHhhccccceecceeeecccceeeeeccceeeccEEEEEEccCCCCCCcccccccCchhHHHHH
Q psy1412         192 YGVYDHETKEWNGIVKELMDKKADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAVEIWLYV  271 (504)
Q Consensus       192 ~G~~~~~~g~w~gli~~l~~g~~D~av~~~tit~~R~~~vdFs~p~~~~g~~ilv~~~~~~~~~~~~fl~Pf~~~vWl~i  271 (504)
                      ||...  +++|++++++|.+|++|++++++++|++|++.++||.||+..+.+++++++... .+.+.|++|+..      
T Consensus        82 ~g~~~--~~~w~~~l~~l~~g~~Di~i~~~tit~eR~~~v~Fs~Py~~~~~~ilv~k~~~~-~~~~~~~~~~~~------  152 (277)
T d2a5sa1          82 HGKKV--NNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRQVTG-LSDKKFQRPHDY------  152 (277)
T ss_dssp             SCCEE--TTEECHHHHHHHTTSCSEECSSCBCCHHHHTTEEECCCCEEECEEEEEETCCCS-TTSHHHHSGGGS------
T ss_pred             cCccC--CCCHHHHHhhhhcccEEEEEEccEeehhhhhhhcccCCceecceEEEEecCccc-CChhHhcCcccc------
Confidence            99875  789999999999999999999999999999999999999999999999976432 222333332211      


Q ss_pred             HHHHHHHHHHHHHHHhhCCCCccCCCCCCCCCCcccCcccchhHHHHHHHHhhccCCCCCCcccccccceehccchhhhh
Q psy1412         272 LAAYLLVSFTLFVMARFSPYEWSNPHPCLAESPIVENQFSVSNSFWFITGTFLRQGSGLNPKVLQQGSSRTLDTALDSKI  351 (504)
Q Consensus       272 ~~~~~~v~~~~~~i~r~~p~~~~~~~~~~~~~~~~~~~~~l~~~~w~~~~~l~~qg~~~~p~~~~~~s~R~v~~An~Ltv  351 (504)
                                                                                                      
T Consensus       153 --------------------------------------------------------------------------------  152 (277)
T d2a5sa1         153 --------------------------------------------------------------------------------  152 (277)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhhhhhhcccchhhhhccCCCCceeeee----ecchhccchhHHHHHHHHHHHhcCCCcccCChHHHHHhhhcCC-eE
Q psy1412         352 EIYQKMWRYMESKKCILFLGGQGDETFVTI----DLSQRADSKIEIYQKMWRYMESKRPSVFVSDYEEGVKRVLEGD-YA  426 (504)
Q Consensus       352 ~~~~~~~~~~~~i~s~~dL~~~~~i~~g~~----~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~egi~~v~~g~-~A  426 (504)
                                           +..+++|++    ...++++.    +..++..+..    ..+.+.++++++|.+|+ +|
T Consensus       153 ---------------------~~~~~~g~v~~~~~~~~~~~~----~~~~~~~~~~----~~~~~~~~~~~~l~~G~~Da  203 (277)
T d2a5sa1         153 ---------------------SPPFRFGTVPNGSTERNIRNN----YPYMHQYMTR----FNQRGVEDALVSLKTGKLDA  203 (277)
T ss_dssp             ---------------------SSCCCEECCTTSHHHHHHHTT----CHHHHHHHGG----GCCSSHHHHHHHHHTTSCSE
T ss_pred             ---------------------chheeeeccchhhHHHHHHHh----hhhhcceEEE----ecCCCHHHHHHHHHcCCcce
Confidence                                 112233333    22333332    3334444433    33678999999999999 89


Q ss_pred             EEeecchhhhhhhcC--CccEEcCC--ccCCcceEEEecCCCCCchHHHHHHHhhhccChhHHHHHhhccCCCCCCC
Q psy1412         427 FLMESTMLDYEVQRN--CNLTQIGG--LLDSKGYGIATPKGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVCN  499 (504)
Q Consensus       427 ~i~e~~~~~y~~~~~--c~l~~vg~--~~~~~~~g~a~~k~Spl~~~in~ail~l~e~G~l~~l~~kw~~~~~~~C~  499 (504)
                      ++.+.+.+.|+++++  |++..++.  .+...+||||+||||||++.||++|++|+++|.+++|.+|||+   +.|.
T Consensus       204 ~i~d~~~~~y~~~~~~~~~l~~~~~~~~~~~~~ygia~~k~s~l~~~in~al~~l~~~G~~~~L~~KW~~---g~~~  277 (277)
T d2a5sa1         204 FIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLT---GICH  277 (277)
T ss_dssp             EEEEHHHHHHHHHTCTTSCEEEEECCCGGGCEEECCEEETTCTTHHHHHHHHHHHHHHTHHHHHHHHHTC---CCCC
T ss_pred             ecccHHHHHHHHhhCCCCcEEEecCCCCcCcceEEEEEeCChHHHHHHHHHHHHHHHCCHHHHHHhhhcC---CCCC
Confidence            999999999988775  88888754  5788899999999999999999999999999999999999996   7784
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure