Psyllid ID: psy1413


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
ccEEEEEccccccccccccccccccccccccccccEEEEEEccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEcccccEEEEEccccccccccEEEEEEEccHHHHHHHcccccEEEEEcccccccccHHHHHHccccEEEEEEcccccHHHHHHHHHcccccccccEEccEEcccccccEEEEEEcccccccccccccEEEEcccccccccHHHHcccccccccccEEEEccccccccccEEEccccEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccccEEEEccccHHHHHHHcc
EEEEEEcHHHHHHHHHcEccccEccccEEcccEEEEEEEEEcccccccccccEEEEcccccccccHHHHccccccEEEEEcccccccccEEEEEEEEEEEcHHHHHHHHHcEccccEccccEEcccEEEEEEEEEccccccHHHcccccEEEEcccccccccccHHHHHccccEEEEcccccccHHHHHHHHHccccccHHHEEEEEEHHHHHHHHHHHHHcccccccccccccEEEEccEEcccccHHHHcccHHHccccEEccEccEccccEcEEEEEHHHEEEccccccHHHHHcHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEccccccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHc
mhcvgicgsdvhylthgqigdfrlsdpmivgheASGIVSKVGAKvkhlkvdnqtrfvpefrnvclspilrrrfslrfreqkpiedpddheVLLEMHCVgicgsdvhylthgqigdfrlsdpmivgheaSGIVSKVGAKvkhlkatrpggclvivgagsqdvkiplvltmtkeidirgvfryanDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCdrvaiepgvpcrtctyckegrynLCRQIffcatppdhgnlsryyRHAAdfchklpdhvsleegalleplsvgvHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELlqgeqpdktidcsgiestiklgml
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLkvdnqtrfvpefrnvclspilrrrfslrfreqkpiedpddhEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGclvivgagsqdvkiPLVLTmtkeidirgVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIEllqgeqpdktidcsgiestiklgml
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
**CVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQK*I***DDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQG*********************
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFVPEFRNVCLSPILRRRFSLRFREQKPIEDPDDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
Q58D31356 Sorbitol dehydrogenase OS yes N/A 0.446 0.511 0.581 4e-57
P07846354 Sorbitol dehydrogenase OS N/A N/A 0.446 0.514 0.581 4e-57
Q64442357 Sorbitol dehydrogenase OS yes N/A 0.453 0.518 0.556 7e-56
Q4R639357 Sorbitol dehydrogenase OS N/A N/A 0.446 0.509 0.565 3e-54
Q00796357 Sorbitol dehydrogenase OS yes N/A 0.446 0.509 0.565 3e-54
P27867357 Sorbitol dehydrogenase OS yes N/A 0.453 0.518 0.545 6e-54
Q5R5F3357 Sorbitol dehydrogenase OS yes N/A 0.446 0.509 0.559 3e-53
Q02912348 Sorbitol dehydrogenase OS N/A N/A 0.455 0.534 0.471 8e-50
Q1PSI9366 L-idonate 5-dehydrogenase no N/A 0.446 0.497 0.456 3e-43
Q0CWQ2353 Probable D-xylulose reduc N/A N/A 0.446 0.515 0.449 2e-41
>sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 Back     alignment and function desciption
 Score =  222 bits (565), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 144/184 (78%), Gaps = 2/184 (1%)

Query: 224 GNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADF 283
           G+ ++ +   DRVAIEPG P  T  +CK GRYNL   IFFCATPPD GNL R+Y+H A+F
Sbjct: 79  GSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANF 138

Query: 284 CHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASR 343
           C+KLPD+V+ EEGAL+EPLSVG+HACRRAGVTLG+KVL+ GAGPIGLV+LL A+A+GA++
Sbjct: 139 CYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVSLLAAKAMGAAQ 198

Query: 344 VVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTI 403
           VV+TD+   +L  AKE+GAD  + I  N S +EI+   +E L G +P+ TI+C+G+E++I
Sbjct: 199 VVVTDLSASRLSKAKEVGADFILQIS-NESPQEIAKK-VEGLLGSKPEVTIECTGVETSI 256

Query: 404 KLGM 407
           + G+
Sbjct: 257 QAGI 260




Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 4
>sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 Back     alignment and function description
>sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 Back     alignment and function description
>sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 Back     alignment and function description
>sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 Back     alignment and function description
>sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 Back     alignment and function description
>sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 Back     alignment and function description
>sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 Back     alignment and function description
>sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 Back     alignment and function description
>sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
383855848362 PREDICTED: sorbitol dehydrogenase-like i 0.421 0.475 0.627 3e-64
383855846350 PREDICTED: sorbitol dehydrogenase-like i 0.450 0.525 0.627 3e-64
332021414350 Sorbitol dehydrogenase [Acromyrmex echin 0.426 0.497 0.657 3e-63
307204829350 Sorbitol dehydrogenase [Harpegnathos sal 0.458 0.534 0.632 5e-63
380016980349 PREDICTED: sorbitol dehydrogenase-like i 0.450 0.527 0.627 6e-63
194902172360 GG17814 [Drosophila erecta] gi|190652326 0.426 0.483 0.662 6e-63
17737897360 sorbitol dehydrogenase-2 [Drosophila mel 0.426 0.483 0.662 6e-63
195499907360 GE26061 [Drosophila yakuba] gi|194183248 0.426 0.483 0.662 7e-63
48096138349 PREDICTED: sorbitol dehydrogenase-like i 0.450 0.527 0.627 7e-63
328791633364 PREDICTED: sorbitol dehydrogenase-like i 0.450 0.505 0.627 8e-63
>gi|383855848|ref|XP_003703422.1| PREDICTED: sorbitol dehydrogenase-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  252 bits (643), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/185 (62%), Positives = 147/185 (79%)

Query: 224 GNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADF 283
           G  +K +   DRVAIEPGV CRTC +CK GRYNLC+++ FCATPP HGNL R+Y+HAADF
Sbjct: 76  GKNVKNLKLGDRVAIEPGVSCRTCAFCKTGRYNLCKEMVFCATPPVHGNLRRFYKHAADF 135

Query: 284 CHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASR 343
           C KLP+HVSL EGA+LEPLSVGVHAC+RA + + SKVLI GAGPIGLVT+L A+A+GA++
Sbjct: 136 CFKLPEHVSLAEGAMLEPLSVGVHACKRADIGISSKVLILGAGPIGLVTMLAAKAMGANK 195

Query: 344 VVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTI 403
           +VITD+ + KL  AK++GADAT+L+  N +  E+   I EL  GE+PDKTID  G +STI
Sbjct: 196 IVITDLTQSKLDVAKKLGADATLLVKNNMTETELVKKIHELFDGEEPDKTIDACGAQSTI 255

Query: 404 KLGML 408
           +L +L
Sbjct: 256 RLAIL 260




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383855846|ref|XP_003703421.1| PREDICTED: sorbitol dehydrogenase-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332021414|gb|EGI61782.1| Sorbitol dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307204829|gb|EFN83387.1| Sorbitol dehydrogenase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380016980|ref|XP_003692445.1| PREDICTED: sorbitol dehydrogenase-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|194902172|ref|XP_001980623.1| GG17814 [Drosophila erecta] gi|190652326|gb|EDV49581.1| GG17814 [Drosophila erecta] Back     alignment and taxonomy information
>gi|17737897|ref|NP_524311.1| sorbitol dehydrogenase-2 [Drosophila melanogaster] gi|4100630|gb|AAD00903.1| sorbitol dehydrogenase [Drosophila melanogaster] gi|7299382|gb|AAF54573.1| sorbitol dehydrogenase-2 [Drosophila melanogaster] gi|16198265|gb|AAL13960.1| LD47736p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195499907|ref|XP_002097147.1| GE26061 [Drosophila yakuba] gi|194183248|gb|EDW96859.1| GE26061 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|48096138|ref|XP_392401.1| PREDICTED: sorbitol dehydrogenase-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|328791633|ref|XP_003251602.1| PREDICTED: sorbitol dehydrogenase-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
FB|FBgn0022359 360 Sodh-2 "Sorbitol dehydrogenase 0.424 0.480 0.666 1.9e-83
FB|FBgn0024289 360 Sodh-1 "Sorbitol dehydrogenase 0.424 0.480 0.643 9.4e-82
UNIPROTKB|F1P183372 SORD "Uncharacterized protein" 0.443 0.486 0.551 1.4e-76
UNIPROTKB|Q58D31356 SORD "Sorbitol dehydrogenase" 0.446 0.511 0.581 4.6e-76
UNIPROTKB|F1PXG0356 SORD "Uncharacterized protein" 0.446 0.511 0.559 5.2e-75
UNIPROTKB|P07846354 SORD "Sorbitol dehydrogenase" 0.446 0.514 0.581 2.3e-74
MGI|MGI:98266357 Sord "sorbitol dehydrogenase" 0.453 0.518 0.556 3.7e-74
UNIPROTKB|Q00796357 SORD "Sorbitol dehydrogenase" 0.446 0.509 0.565 1.2e-73
UNIPROTKB|F1SN27356 SORD "Sorbitol dehydrogenase" 0.421 0.483 0.586 1.6e-73
UNIPROTKB|H0YLA4336 SORD "Sorbitol dehydrogenase" 0.446 0.541 0.565 2e-73
FB|FBgn0022359 Sodh-2 "Sorbitol dehydrogenase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 1.9e-83, Sum P(2) = 1.9e-83
 Identities = 116/174 (66%), Positives = 141/174 (81%)

Query:   234 DRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSL 293
             DRVAIEPGVPCR C +CK+GRYNLC  + FCATPP  GNL+RYY+HAADFC KLPDHVS+
Sbjct:    86 DRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKHAADFCFKLPDHVSM 145

Query:   294 EEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHK 353
             EEGALLEPLSVGVHACRRAGV LGSKVLI GAGPIGLVTLL A+A+GAS ++ITD+++ +
Sbjct:   146 EEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQR 205

Query:   354 LKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGM 407
             L  AKE+GA  T+L+ R+ S EE +  ++     E PDK+IDC G ES+ +L +
Sbjct:   206 LDVAKELGATHTLLLQRDQSAEE-TVKVVHQTMSEVPDKSIDCCGAESSARLAI 258


GO:0003939 "L-iditol 2-dehydrogenase activity" evidence=ISS;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
FB|FBgn0024289 Sodh-1 "Sorbitol dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P183 SORD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D31 SORD "Sorbitol dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXG0 SORD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P07846 SORD "Sorbitol dehydrogenase" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
MGI|MGI:98266 Sord "sorbitol dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q00796 SORD "Sorbitol dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN27 SORD "Sorbitol dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLA4 SORD "Sorbitol dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q64442DHSO_MOUSE1, ., 1, ., 1, ., 1, 40.55610.45340.5182yesN/A
P27867DHSO_RAT1, ., 1, ., 1, ., 1, 40.54540.45340.5182yesN/A
Q58D31DHSO_BOVIN1, ., 1, ., 1, ., 1, 40.58150.44600.5112yesN/A
Q00796DHSO_HUMAN1, ., 1, ., 1, ., 1, 40.56520.44600.5098yesN/A
Q5R5F3DHSO_PONAB1, ., 1, ., 1, ., 1, 40.55970.44600.5098yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 6e-98
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 6e-69
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 3e-46
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 1e-43
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 1e-43
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 3e-43
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 5e-38
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 6e-37
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 2e-36
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 3e-36
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 1e-33
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 1e-29
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 1e-27
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 6e-26
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 9e-26
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 1e-25
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 1e-25
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 3e-25
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 2e-24
cd05281341 cd05281, TDH, Threonine dehydrogenase 5e-24
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 2e-23
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 2e-22
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 7e-22
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 9e-22
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 9e-22
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 8e-21
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 2e-20
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 2e-20
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 4e-19
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 6e-19
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 7e-19
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 2e-18
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 3e-18
cd08283 386 cd08283, FDH_like_1, Glutathione-dependent formald 3e-18
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 3e-17
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 3e-17
cd08282 375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 5e-17
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 1e-16
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 2e-16
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 4e-16
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 5e-16
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 6e-16
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 1e-15
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 4e-15
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 4e-15
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 8e-15
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 8e-15
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 1e-14
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 6e-14
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 7e-14
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 7e-14
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 2e-13
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 2e-13
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 1e-12
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 3e-12
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 4e-12
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 5e-12
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 6e-12
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 6e-12
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 7e-12
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 8e-12
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 8e-12
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 8e-12
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 9e-12
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 1e-11
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 1e-11
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-11
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 2e-11
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-11
TIGR02819 393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 2e-11
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 2e-11
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 2e-11
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 3e-11
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 4e-11
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 6e-11
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 7e-11
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 1e-10
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 2e-10
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 2e-10
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 2e-10
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 3e-10
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 8e-10
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 9e-10
cd08287345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 9e-10
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-09
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-09
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-09
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 3e-09
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 4e-09
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 5e-09
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 6e-09
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 7e-09
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 7e-09
cd05281341 cd05281, TDH, Threonine dehydrogenase 1e-08
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 1e-08
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 2e-08
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 2e-08
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-08
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 2e-08
cd08300368 cd08300, alcohol_DH_class_III, class III alcohol d 2e-08
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 3e-08
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 3e-08
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 3e-08
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 4e-08
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 5e-08
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 6e-08
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 8e-08
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 1e-07
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 1e-07
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 1e-07
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 1e-07
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 2e-07
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 2e-07
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 2e-07
TIGR03366280 TIGR03366, HpnZ_proposed, putative phosphonate cat 2e-07
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 3e-07
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 3e-07
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 3e-07
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 4e-07
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 4e-07
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 4e-07
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 5e-07
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 6e-07
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 6e-07
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 6e-07
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 6e-07
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 7e-07
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 8e-07
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 1e-06
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 1e-06
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 1e-06
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 1e-06
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 1e-06
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 1e-06
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 2e-06
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 2e-06
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 2e-06
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 2e-06
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 2e-06
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 3e-06
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 3e-06
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 3e-06
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 3e-06
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 3e-06
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 4e-06
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 4e-06
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 5e-06
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 5e-06
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 5e-06
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 6e-06
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 7e-06
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 7e-06
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 8e-06
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 1e-05
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 1e-05
cd05281341 cd05281, TDH, Threonine dehydrogenase 2e-05
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 2e-05
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 2e-05
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 2e-05
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 2e-05
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 2e-05
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 2e-05
PLN02740381 PLN02740, PLN02740, Alcohol dehydrogenase-like 2e-05
TIGR02822329 TIGR02822, adh_fam_2, zinc-binding alcohol dehydro 3e-05
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 4e-05
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 7e-05
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 7e-05
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 8e-05
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 9e-05
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 9e-05
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 1e-04
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 1e-04
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 1e-04
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 1e-04
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 1e-04
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 1e-04
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 2e-04
cd05281341 cd05281, TDH, Threonine dehydrogenase 2e-04
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 2e-04
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 2e-04
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 2e-04
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-04
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 2e-04
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 2e-04
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 2e-04
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 3e-04
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 3e-04
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 3e-04
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 3e-04
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 3e-04
cd08246 393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 3e-04
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 4e-04
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 4e-04
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 4e-04
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 4e-04
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 5e-04
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 5e-04
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 5e-04
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 5e-04
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 6e-04
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 6e-04
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 7e-04
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 8e-04
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 0.001
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 0.001
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 0.001
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 0.001
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 0.001
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 0.002
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 0.002
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 0.002
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 0.002
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 0.002
cd08238410 cd08238, sorbose_phosphate_red, L-sorbose-1-phosph 0.002
TIGR01751 398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 0.002
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 0.003
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 0.003
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 0.003
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 0.003
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 0.004
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 0.004
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
 Score =  295 bits (758), Expect = 6e-98
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 1/173 (0%)

Query: 234 DRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSL 293
           DRVAIEPGVPCRTC +CK GRYNLC  + F ATPP  G L RY  H ADFCHKLPD+VSL
Sbjct: 80  DRVAIEPGVPCRTCEFCKSGRYNLCPDMRFAATPPVDGTLCRYVNHPADFCHKLPDNVSL 139

Query: 294 EEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHK 353
           EEGAL+EPLSVGVHACRRAGV  G  VL+ GAGPIGL+T   A+A GA++VV+TDI   +
Sbjct: 140 EEGALVEPLSVGVHACRRAGVRPGDTVLVFGAGPIGLLTAAVAKAFGATKVVVTDIDPSR 199

Query: 354 LKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLG 406
           L+ AKE+GA  TV +       E +  I ELL G+ PD  I+C+G ES I+  
Sbjct: 200 LEFAKELGATHTVNVRTE-DTPESAEKIAELLGGKGPDVVIECTGAESCIQTA 251


Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 343

>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
KOG0024|consensus354 100.0
KOG0024|consensus354 100.0
KOG0023|consensus360 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.97
KOG0022|consensus375 99.97
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.96
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.96
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.95
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.95
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.95
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.95
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.94
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.94
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.94
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.94
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.94
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.94
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.94
PLN02178375 cinnamyl-alcohol dehydrogenase 99.94
PLN02740381 Alcohol dehydrogenase-like 99.93
PLN02740381 Alcohol dehydrogenase-like 99.93
PLN02827378 Alcohol dehydrogenase-like 99.93
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.93
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.93
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.93
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.93
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.93
KOG1202|consensus 2376 99.93
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.93
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.93
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.92
PLN02827378 Alcohol dehydrogenase-like 99.92
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.92
PLN02514357 cinnamyl-alcohol dehydrogenase 99.92
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.92
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.92
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.92
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.92
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.92
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.92
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.92
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.91
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.91
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.91
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.91
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.91
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.9
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.9
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.9
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.89
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.89
KOG1197|consensus336 99.89
PLN02178 375 cinnamyl-alcohol dehydrogenase 99.89
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.89
PRK10083339 putative oxidoreductase; Provisional 99.89
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.88
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.88
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.88
PRK10083339 putative oxidoreductase; Provisional 99.88
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.88
PLN02702364 L-idonate 5-dehydrogenase 99.88
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.88
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.87
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.87
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.86
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.86
KOG1197|consensus 336 99.86
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.86
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.86
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.85
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.85
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.85
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.85
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.85
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.85
PLN02702364 L-idonate 5-dehydrogenase 99.85
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.84
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.84
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.84
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.84
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.84
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.84
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.84
PLN02514357 cinnamyl-alcohol dehydrogenase 99.84
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.84
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.84
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.84
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.84
KOG0025|consensus354 99.84
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.84
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.84
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.83
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.83
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.83
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.83
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.83
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.83
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.83
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.83
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.83
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.82
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.82
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.82
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.82
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.82
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.82
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.82
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.81
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.81
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.81
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.81
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.81
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.81
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.81
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.81
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.81
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.81
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.81
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.8
cd08290 341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.8
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.8
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.8
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.8
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.8
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.8
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.8
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.8
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.79
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.79
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.79
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.79
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.79
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.79
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.78
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.78
KOG1198|consensus 347 99.78
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.78
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.77
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.77
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.77
PRK13771334 putative alcohol dehydrogenase; Provisional 99.77
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.77
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.77
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.77
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.77
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.77
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.77
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.76
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.76
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.76
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.76
PTZ00354 334 alcohol dehydrogenase; Provisional 99.75
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.75
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 99.75
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.75
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.75
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.75
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.75
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.75
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.75
PRK13771334 putative alcohol dehydrogenase; Provisional 99.75
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.75
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.74
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.74
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.74
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.74
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.74
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.74
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.74
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.74
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.73
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.73
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.72
cd08247 352 AST1_like AST1 is a cytoplasmic protein associated 99.72
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.72
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.72
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.72
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.71
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.71
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.7
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.7
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.7
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.7
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.7
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.7
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.7
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.69
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.69
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.69
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.69
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.69
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.68
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.66
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.66
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.65
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.65
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 99.64
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.64
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.64
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.64
KOG0025|consensus 354 99.64
COG2130 340 Putative NADP-dependent oxidoreductases [General f 99.61
cd08275 337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.58
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.56
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.56
KOG1198|consensus347 99.54
KOG0023|consensus360 99.54
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.52
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.52
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.5
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.48
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.46
cd08273 331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.39
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.36
KOG0022|consensus375 99.32
KOG1202|consensus 2376 99.21
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.2
KOG1196|consensus 343 99.14
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.03
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.93
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 98.87
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 98.81
KOG1196|consensus343 98.75
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 98.65
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 98.64
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 98.55
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 98.55
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 98.49
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.48
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 98.48
PTZ00354334 alcohol dehydrogenase; Provisional 98.47
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 98.46
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 98.4
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 98.39
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 98.38
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 98.36
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 98.34
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 98.31
cd08252336 AL_MDR Arginate lyase and other MDR family members 98.26
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 98.25
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 98.2
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.2
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 98.18
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.17
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 98.13
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 98.11
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.07
COG0300 265 DltE Short-chain dehydrogenases of various substra 98.06
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 98.02
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 97.98
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.97
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 97.97
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.96
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.96
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 97.95
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 97.95
PRK06139 330 short chain dehydrogenase; Provisional 97.93
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 97.92
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.88
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 97.84
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.82
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 97.82
PRK08339 263 short chain dehydrogenase; Provisional 97.81
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 97.79
PRK05872 296 short chain dehydrogenase; Provisional 97.77
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 97.77
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 97.75
cd08251303 polyketide_synthase polyketide synthase. Polyketid 97.75
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 97.7
PRK05993 277 short chain dehydrogenase; Provisional 97.69
PRK07814 263 short chain dehydrogenase; Provisional 97.68
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 97.68
PRK06500 249 short chain dehydrogenase; Provisional 97.68
PRK09072 263 short chain dehydrogenase; Provisional 97.68
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.67
PRK07478 254 short chain dehydrogenase; Provisional 97.67
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.67
PRK08324 681 short chain dehydrogenase; Validated 97.66
PRK08265 261 short chain dehydrogenase; Provisional 97.64
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.64
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.64
PRK06198 260 short chain dehydrogenase; Provisional 97.62
PRK08267 260 short chain dehydrogenase; Provisional 97.61
PRK07904 253 short chain dehydrogenase; Provisional 97.6
PRK07831 262 short chain dehydrogenase; Provisional 97.57
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 97.57
PRK07825 273 short chain dehydrogenase; Provisional 97.56
PRK07890 258 short chain dehydrogenase; Provisional 97.56
PRK07062 265 short chain dehydrogenase; Provisional 97.55
PRK05866 293 short chain dehydrogenase; Provisional 97.54
PRK05693 274 short chain dehydrogenase; Provisional 97.54
PRK08213 259 gluconate 5-dehydrogenase; Provisional 97.54
PRK07677 252 short chain dehydrogenase; Provisional 97.53
PRK05867 253 short chain dehydrogenase; Provisional 97.53
PRK08628 258 short chain dehydrogenase; Provisional 97.53
PRK07109 334 short chain dehydrogenase; Provisional 97.53
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.52
PRK07576 264 short chain dehydrogenase; Provisional 97.52
PRK06194 287 hypothetical protein; Provisional 97.52
PRK05876 275 short chain dehydrogenase; Provisional 97.52
PRK08177 225 short chain dehydrogenase; Provisional 97.51
PRK08862 227 short chain dehydrogenase; Provisional 97.5
PRK12939 250 short chain dehydrogenase; Provisional 97.5
PRK07063 260 short chain dehydrogenase; Provisional 97.5
PRK06182 273 short chain dehydrogenase; Validated 97.49
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.49
PRK12829 264 short chain dehydrogenase; Provisional 97.49
PRK06172 253 short chain dehydrogenase; Provisional 97.49
PRK05854 313 short chain dehydrogenase; Provisional 97.48
PRK06138 252 short chain dehydrogenase; Provisional 97.48
PRK06180 277 short chain dehydrogenase; Provisional 97.47
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 97.47
PRK06114 254 short chain dehydrogenase; Provisional 97.47
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.46
PRK08251 248 short chain dehydrogenase; Provisional 97.46
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.46
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.46
PRK06720169 hypothetical protein; Provisional 97.46
PRK06841 255 short chain dehydrogenase; Provisional 97.45
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 97.45
PRK05717 255 oxidoreductase; Validated 97.45
PRK06949 258 short chain dehydrogenase; Provisional 97.45
PRK09242 257 tropinone reductase; Provisional 97.44
PRK08264 238 short chain dehydrogenase; Validated 97.43
PRK07523 255 gluconate 5-dehydrogenase; Provisional 97.43
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.43
PRK07791 286 short chain dehydrogenase; Provisional 97.43
PRK06101 240 short chain dehydrogenase; Provisional 97.43
PRK12938 246 acetyacetyl-CoA reductase; Provisional 97.43
PRK08643 256 acetoin reductase; Validated 97.43
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.42
PRK07035 252 short chain dehydrogenase; Provisional 97.41
PRK08226 263 short chain dehydrogenase; Provisional 97.41
PRK06181 263 short chain dehydrogenase; Provisional 97.41
PRK07774 250 short chain dehydrogenase; Provisional 97.41
PRK06125 259 short chain dehydrogenase; Provisional 97.4
PRK06196 315 oxidoreductase; Provisional 97.4
PRK10538 248 malonic semialdehyde reductase; Provisional 97.4
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.4
PRK07024 257 short chain dehydrogenase; Provisional 97.39
PRK08589 272 short chain dehydrogenase; Validated 97.38
PRK06057 255 short chain dehydrogenase; Provisional 97.38
PRK07453 322 protochlorophyllide oxidoreductase; Validated 97.37
PRK07067 257 sorbitol dehydrogenase; Provisional 97.37
PRK08277 278 D-mannonate oxidoreductase; Provisional 97.37
PRK06940 275 short chain dehydrogenase; Provisional 97.37
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 97.37
PRK06484 520 short chain dehydrogenase; Validated 97.36
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.36
PRK06124 256 gluconate 5-dehydrogenase; Provisional 97.35
PRK08085 254 gluconate 5-dehydrogenase; Provisional 97.35
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.34
KOG1205|consensus 282 97.33
PRK06482 276 short chain dehydrogenase; Provisional 97.33
PRK07097 265 gluconate 5-dehydrogenase; Provisional 97.32
PRK07832 272 short chain dehydrogenase; Provisional 97.32
PLN02780 320 ketoreductase/ oxidoreductase 97.32
PRK07454 241 short chain dehydrogenase; Provisional 97.32
PRK08303 305 short chain dehydrogenase; Provisional 97.32
PRK05875 276 short chain dehydrogenase; Provisional 97.31
PRK06197 306 short chain dehydrogenase; Provisional 97.31
PRK08017 256 oxidoreductase; Provisional 97.31
PRK12743 256 oxidoreductase; Provisional 97.31
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 97.3
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 97.29
PRK06484 520 short chain dehydrogenase; Validated 97.29
PRK09186 256 flagellin modification protein A; Provisional 97.29
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 97.29
PRK08278 273 short chain dehydrogenase; Provisional 97.28
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 97.28
PRK06953 222 short chain dehydrogenase; Provisional 97.27
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.27
PRK07856 252 short chain dehydrogenase; Provisional 97.27
PLN02253 280 xanthoxin dehydrogenase 97.27
PRK07806 248 short chain dehydrogenase; Provisional 97.26
PRK12828 239 short chain dehydrogenase; Provisional 97.26
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.26
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.25
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 97.25
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.24
PRK08263 275 short chain dehydrogenase; Provisional 97.24
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 97.24
TIGR02415 254 23BDH acetoin reductases. One member of this famil 97.24
PRK12746 254 short chain dehydrogenase; Provisional 97.23
KOG1199|consensus 260 97.23
PRK07326 237 short chain dehydrogenase; Provisional 97.22
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.22
PRK06914 280 short chain dehydrogenase; Provisional 97.21
PRK08340 259 glucose-1-dehydrogenase; Provisional 97.21
PRK07074 257 short chain dehydrogenase; Provisional 97.19
PRK07060 245 short chain dehydrogenase; Provisional 97.19
PRK05650 270 short chain dehydrogenase; Provisional 97.19
PRK06128 300 oxidoreductase; Provisional 97.19
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.18
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.18
PRK05855 582 short chain dehydrogenase; Validated 97.17
PRK12937 245 short chain dehydrogenase; Provisional 97.16
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.16
PRK07775 274 short chain dehydrogenase; Provisional 97.14
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.14
PRK06701 290 short chain dehydrogenase; Provisional 97.13
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.13
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.12
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 97.11
PRK09134 258 short chain dehydrogenase; Provisional 97.1
PRK12935 247 acetoacetyl-CoA reductase; Provisional 97.1
KOG1209|consensus 289 97.1
PRK07102 243 short chain dehydrogenase; Provisional 97.09
PRK06398 258 aldose dehydrogenase; Validated 97.09
PLN03209 576 translocon at the inner envelope of chloroplast su 97.08
PRK09291 257 short chain dehydrogenase; Provisional 97.08
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.08
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 97.07
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 97.07
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 97.07
PRK06947 248 glucose-1-dehydrogenase; Provisional 97.06
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 97.06
PRK12742 237 oxidoreductase; Provisional 97.05
PRK06483 236 dihydromonapterin reductase; Provisional 97.04
PRK08703 239 short chain dehydrogenase; Provisional 97.04
PRK06523 260 short chain dehydrogenase; Provisional 97.03
KOG1201|consensus 300 97.03
PRK07577 234 short chain dehydrogenase; Provisional 97.02
PRK13940 414 glutamyl-tRNA reductase; Provisional 97.01
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 97.0
PRK07985 294 oxidoreductase; Provisional 96.99
KOG0725|consensus 270 96.98
PRK06179 270 short chain dehydrogenase; Provisional 96.98
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 96.97
PRK05884 223 short chain dehydrogenase; Provisional 96.97
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.97
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.96
KOG1014|consensus 312 96.96
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.95
PRK08936 261 glucose-1-dehydrogenase; Provisional 96.93
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 96.92
PRK05599 246 hypothetical protein; Provisional 96.91
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 96.91
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 96.9
PRK07023 243 short chain dehydrogenase; Provisional 96.9
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 96.89
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.89
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 96.89
PRK06123 248 short chain dehydrogenase; Provisional 96.89
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 96.89
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 96.89
PRK12827 249 short chain dehydrogenase; Provisional 96.88
KOG2017|consensus 427 96.88
PRK08219 227 short chain dehydrogenase; Provisional 96.88
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 96.87
PRK09135 249 pteridine reductase; Provisional 96.87
PRK12747 252 short chain dehydrogenase; Provisional 96.84
smart00822180 PKS_KR This enzymatic domain is part of bacterial 96.82
PRK12744 257 short chain dehydrogenase; Provisional 96.81
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.8
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 96.79
PRK07201 657 short chain dehydrogenase; Provisional 96.78
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 96.78
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.77
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.75
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.74
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 96.7
PRK07041 230 short chain dehydrogenase; Provisional 96.66
PLN02494 477 adenosylhomocysteinase 96.65
PRK12367 245 short chain dehydrogenase; Provisional 96.64
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.6
KOG1200|consensus 256 96.59
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 96.57
PRK12824 245 acetoacetyl-CoA reductase; Provisional 96.56
KOG1207|consensus 245 96.55
PRK07069 251 short chain dehydrogenase; Validated 96.55
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 96.53
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.49
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.48
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 96.47
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.44
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 96.43
PRK04148134 hypothetical protein; Provisional 96.41
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.38
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 96.34
PLN00015 308 protochlorophyllide reductase 96.31
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 96.3
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.3
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.29
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.29
PRK08223 287 hypothetical protein; Validated 96.25
PRK06924 251 short chain dehydrogenase; Provisional 96.22
KOG1208|consensus 314 96.21
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 96.21
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.18
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.18
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.16
CHL00194 317 ycf39 Ycf39; Provisional 96.15
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.13
KOG1611|consensus 249 96.12
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.1
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.1
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 96.09
>KOG0024|consensus Back     alignment and domain information
Probab=100.00  E-value=2.7e-38  Score=281.89  Aligned_cols=255  Identities=59%  Similarity=1.018  Sum_probs=238.8

Q ss_pred             cCCcceeccceeeecccccCCCC-CCcceEEEEeeeeecCCeEEEEccCccccccccccccccCcceeEEEccCchHHHH
Q psy1413          64 CLSPILRRRFSLRFREQKPIEDP-DDHEVLLEMHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHL  142 (408)
Q Consensus        64 ~~~~~~~~p~~~~~~~~~~lp~~-~~~~~~~~~~~~~~~g~~vlv~g~G~vG~~~i~~a~~~G~~~~~vv~~~g~~~~~~  142 (408)
                      ....++.++.++.+ +..+.|.. .+.++++....++++|+++..+-.|.+|...+..+..+|+|..|++..+|..++.+
T Consensus         5 ~~A~vl~g~~di~i-~~~p~p~i~~p~eVlv~i~a~GICGSDvHy~~~G~ig~~v~k~PmvlGHEssGiV~evG~~Vk~L   83 (354)
T KOG0024|consen    5 NLALVLRGKGDIRI-EQRPIPTITDPDEVLVAIKAVGICGSDVHYYTHGRIGDFVVKKPMVLGHESSGIVEEVGDEVKHL   83 (354)
T ss_pred             cceeEEEccCceeE-eeCCCCCCCCCCEEEEEeeeEEecCccchhhccCCcCccccccccccccccccchhhhccccccc
Confidence            45678899999999 58888776 78889999999999999999999999999999999999999999999999877766


Q ss_pred             hhccCCcEEEEEccCCCCcccCHHHHHhcCcEEEEeecCCCcHHHHHHHHHcCCCCCCCceeeeeccchHHHHHHHHHcC
Q psy1413         143 KATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRYANDYPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTG  222 (408)
Q Consensus       143 ~~l~~gG~iv~~G~~~~~~~~~~~~~~~~~~~l~g~~~~~~~~~~~~~l~~~g~~~~~~~i~~~~~l~~~~~a~~~~~~~  222 (408)
                      +.                                                                              
T Consensus        84 kV------------------------------------------------------------------------------   85 (354)
T KOG0024|consen   84 KV------------------------------------------------------------------------------   85 (354)
T ss_pred             cc------------------------------------------------------------------------------
Confidence            66                                                                              


Q ss_pred             CCCceEEEEEcCceeecCCCcccccccccCCccccccceeecccCCCCccceeEEeeccceeeeCCCCCCcccccccchh
Q psy1413         223 AGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPL  302 (408)
Q Consensus       223 ~~~~~kvvi~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~aa~~~~~  302 (408)
                                +|||+++|.-+|+.|..|++|++|.|+...+.++++.+|++++|++++++.++++|+++|++++|+++++
T Consensus        86 ----------GDrVaiEpg~~c~~cd~CK~GrYNlCp~m~f~atpp~~G~la~y~~~~~dfc~KLPd~vs~eeGAl~ePL  155 (354)
T KOG0024|consen   86 ----------GDRVAIEPGLPCRDCDFCKEGRYNLCPHMVFCATPPVDGTLAEYYVHPADFCYKLPDNVSFEEGALIEPL  155 (354)
T ss_pred             ----------CCeEEecCCCccccchhhhCcccccCCccccccCCCcCCceEEEEEechHheeeCCCCCchhhcccccch
Confidence                      9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhccCcCCCCEEEEEecchhHHHHHHHHHHhCCCeEEEEecChhhHHHHHHcCCCeEEecCCCCChHHHHHHHH
Q psy1413         303 SVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHII  382 (408)
Q Consensus       303 ~~~~~~~~~~~~~~~~~~lv~G~G~~G~~~~~~~~~~Ga~~vv~~~~~~~~~~~~~~~ga~~~i~~~~~~~~~~~~~~~~  382 (408)
                      ++++|+.++..+++++++||+|+|++|+....+|+++||..|++++-.+.|++.++++|++.+++.....+.+++.+.++
T Consensus       156 sV~~HAcr~~~vk~Gs~vLV~GAGPIGl~t~l~Aka~GA~~VVi~d~~~~Rle~Ak~~Ga~~~~~~~~~~~~~~~~~~v~  235 (354)
T KOG0024|consen  156 SVGVHACRRAGVKKGSKVLVLGAGPIGLLTGLVAKAMGASDVVITDLVANRLELAKKFGATVTDPSSHKSSPQELAELVE  235 (354)
T ss_pred             hhhhhhhhhcCcccCCeEEEECCcHHHHHHHHHHHHcCCCcEEEeecCHHHHHHHHHhCCeEEeeccccccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999988777556788888998


Q ss_pred             HHhcCCCCceEEEcccchhhhhhcC
Q psy1413         383 ELLQGEQPDKTIDCSGIESTIKLGM  407 (408)
Q Consensus       383 ~~~~~~~~d~i~d~~g~~~~~~~~~  407 (408)
                      .+.+.+.+|+.|||+|...+++.|+
T Consensus       236 ~~~g~~~~d~~~dCsG~~~~~~aai  260 (354)
T KOG0024|consen  236 KALGKKQPDVTFDCSGAEVTIRAAI  260 (354)
T ss_pred             hhccccCCCeEEEccCchHHHHHHH
Confidence            8887678999999999999988775



>KOG0024|consensus Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1e3j_A352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 4e-58
3qe3_A355 Sheep Liver Sorbitol Dehydrogenase Length = 355 4e-58
1pl7_A356 Human Sorbitol Dehydrogenase (Apo) Length = 356 2e-55
1pl6_A356 Human SdhNADHINHIBITOR COMPLEX Length = 356 1e-54
3m6i_A363 L-Arabinitol 4-Dehydrogenase Length = 363 3e-38
4ej6_A370 Crystal Structure Of A Putative Zinc-Binding Dehydr 6e-17
4a2c_A346 Crystal Structure Of Galactitol-1-Phosphate Dehydro 1e-16
2dq4_A343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 5e-15
2dfv_A347 Hyperthermophilic Threonine Dehydrogenase From Pyro 1e-14
2d8a_A348 Crystal Structure Of Ph0655 From Pyrococcus Horikos 1e-14
3gfb_A350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 4e-14
4ilk_A359 Crystal Structure Of Short Chain Alcohol Dehydrogen 3e-13
1rjw_A339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 4e-12
3pii_A339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 6e-12
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 3e-10
3ip1_A404 Structure Of Putative Alcohol Dehydrogenase (Tm_042 2e-09
1h2b_A359 Crystal Structure Of The Alcohol Dehydrogenase From 2e-09
4eez_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 3e-09
4eex_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 2e-08
3cos_A381 Crystal Structure Of Human Class Ii Alcohol Dehydro 2e-08
1vj0_A380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 3e-08
2xaa_A345 Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube 3e-08
2eer_A347 Structural Study Of Project Id St2577 From Sulfolob 2e-07
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 2e-07
1hso_A374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 7e-07
1hso_A374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 2e-04
3fpc_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 2e-06
1hdz_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-06
1hdz_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-04
1ht0_A374 Human Gamma-2 Alcohol Dehydrogense Length = 374 3e-06
1ht0_A374 Human Gamma-2 Alcohol Dehydrogense Length = 374 6e-05
3uko_A378 Crystal Structure Of S-Nitrosoglutathione Reductase 4e-06
4dl9_A396 Crystal Structure Of S-nitrosoglutathione Reductase 7e-06
2nvb_A352 Contribution Of Pro275 To The Thermostability Of Th 1e-05
1ykf_A352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 1e-05
3s1l_A340 Crystal Structure Of Apo-Form Furx Length = 340 1e-05
1y9a_A 360 Alcohol Dehydrogenase From Entamoeba Histolotica In 2e-05
2oui_A 360 D275p Mutant Of Alcohol Dehydrogenase From Protozoa 2e-05
3fpl_A351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 2e-05
1axe_A374 Crystal Structure Of The Active-Site Mutant Phe93-> 3e-05
1axe_A374 Crystal Structure Of The Active-Site Mutant Phe93-> 4e-04
1mgo_A374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 3e-05
1mgo_A374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 4e-04
1qlh_A374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 3e-05
1qlh_A374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 4e-04
1axg_A374 Crystal Structure Of The Val203->ala Mutant Of Live 3e-05
1n8k_A374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 3e-05
1n8k_A374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 4e-04
6adh_A374 Structure Of Triclinic Ternary Complex Of Horse Liv 3e-05
6adh_A374 Structure Of Triclinic Ternary Complex Of Horse Liv 4e-04
1a71_A374 Ternary Complex Of An Active Site Double Mutant Of 3e-05
1ju9_A374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 3e-05
1ju9_A374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 4e-04
3oq6_A374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 3e-05
3oq6_A374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 3e-04
3meq_A365 Crystal Structure Of Alcohol Dehydrogenase From Bru 3e-05
1hdx_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-05
1hdx_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-04
1htb_A374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 3e-05
1htb_A374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 3e-04
2dph_A 398 Crystal Structure Of Formaldehyde Dismutase Length 3e-05
1hdy_A374 Three-Dimensional Structures Of Three Human Alcohol 4e-05
1hdy_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-04
1e3e_A376 Mouse Class Ii Alcohol Dehydrogenase Complex With N 5e-05
1ee2_B373 The Structure Of Steroid-Active Alcohol Dehydrogena 5e-05
1ee2_B373 The Structure Of Steroid-Active Alcohol Dehydrogena 1e-04
1ee2_A373 The Structure Of Steroid-Active Alcohol Dehydrogena 5e-05
1ee2_A373 The Structure Of Steroid-Active Alcohol Dehydrogena 9e-05
1e3l_A376 P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase 5e-05
1llu_A342 The Ternary Complex Of Pseudomonas Aeruginosa Alcoh 1e-04
1agn_A373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 1e-04
1agn_A373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 8e-04
1d1t_A373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 1e-04
1d1t_A373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 9e-04
3fsr_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 1e-04
1qv6_A374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 1e-04
1qv6_A374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 7e-04
3ftn_A352 Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO 2e-04
1jqb_A351 Alcohol Dehydrogenase From Clostridium Beijerinckii 2e-04
2b83_A351 A Single Amino Acid Substitution In The Clostridium 2e-04
1ped_A351 Bacterial Secondary Alcohol Dehydrogenase (Apo-Form 2e-04
1kol_A 398 Crystal Structure Of Formaldehyde Dehydrogenase Len 5e-04
1p0c_A373 Crystal Structure Of The Nadp(H)-Dependent Vertebra 5e-04
1teh_A373 Structure Of Human Liver Chichi Alcohol Dehydrogena 5e-04
1ps0_A360 Crystal Structure Of The Nadp(H)-Dependent Cinnamyl 5e-04
1mc5_A374 Ternary Complex Of Human Glutathione-Dependent Form 5e-04
3qj5_A374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 6e-04
2fzw_A373 Structure Of The Binary Complex Of The E67l Mutant 6e-04
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure

Iteration: 1

Score = 222 bits (565), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 115/208 (55%), Positives = 147/208 (70%), Gaps = 10/208 (4%) Query: 206 NYLLEDTL---HAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIF 262 +++++D + H G +K + DRVA+EPGVPCR C +CKEG+YNLC + Sbjct: 55 DFIVKDPMVIGHEASGTVVKVGKNVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLT 114 Query: 263 FCATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLI 322 FCATPPD GNL+RYY HAADFCHKLPD+VSLEEGALLEPLSVGVHACRRAGV LG+ VL+ Sbjct: 115 FCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQLGTTVLV 174 Query: 323 TGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLIDRNHSLEEISTHII 382 GAGPIGLV++L A+A GA VV T +L+ AK GAD T+++D +E + II Sbjct: 175 IGAGPIGLVSVLAAKAYGAF-VVCTARSPRRLEVAKNCGADVTLVVD---PAKEEESSII 230 Query: 383 ELLQ---GEQPDKTIDCSGIESTIKLGM 407 E ++ G+ P+ TIDCSG E I +G+ Sbjct: 231 ERIRSAIGDLPNVTIDCSGNEKCITIGI 258
>pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 Back     alignment and structure
>pdb|1PL7|A Chain A, Human Sorbitol Dehydrogenase (Apo) Length = 356 Back     alignment and structure
>pdb|1PL6|A Chain A, Human SdhNADHINHIBITOR COMPLEX Length = 356 Back     alignment and structure
>pdb|3M6I|A Chain A, L-Arabinitol 4-Dehydrogenase Length = 363 Back     alignment and structure
>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 Back     alignment and structure
>pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 Back     alignment and structure
>pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure
>pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|3IP1|A Chain A, Structure Of Putative Alcohol Dehydrogenase (Tm_042) From Thermotoga Maritima Length = 404 Back     alignment and structure
>pdb|1H2B|A Chain A, Crystal Structure Of The Alcohol Dehydrogenase From The Hyperthermophilic Archaeon Aeropyrum Pernix At 1.65a Resolution Length = 359 Back     alignment and structure
>pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 Back     alignment and structure
>pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 Back     alignment and structure
>pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|3FPC|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-294 Of T. Brockii Adh By E. Histolytica Adh Length = 352 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 Back     alignment and structure
>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 Back     alignment and structure
>pdb|1Y9A|A Chain A, Alcohol Dehydrogenase From Entamoeba Histolotica In Complex With Cacodylate Length = 360 Back     alignment and structure
>pdb|2OUI|A Chain A, D275p Mutant Of Alcohol Dehydrogenase From Protozoa Entamoeba Histolytica Length = 360 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|2DPH|A Chain A, Crystal Structure Of Formaldehyde Dismutase Length = 398 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 Back     alignment and structure
>pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 Back     alignment and structure
>pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 Back     alignment and structure
>pdb|1KOL|A Chain A, Crystal Structure Of Formaldehyde Dehydrogenase Length = 398 Back     alignment and structure
>pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|1PS0|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Cinnamyl Alcohol Dehydrogenase From Saccharomyces Cerevisiae Length = 360 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 1e-84
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-34
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 6e-27
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-21
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-84
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 3e-34
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-26
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 8e-22
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-81
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 6e-36
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-26
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 5e-21
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 2e-76
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 6e-22
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 5e-21
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 2e-16
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 2e-75
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 6e-27
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 7e-25
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 7e-20
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 3e-72
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 3e-25
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 2e-19
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 1e-14
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 1e-70
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 9e-23
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 9e-23
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 4e-18
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 1e-61
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 3e-23
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 4e-18
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 9e-18
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 4e-61
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 6e-18
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-15
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-11
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 2e-50
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 4e-17
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 1e-14
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 9e-11
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 8e-37
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 3e-12
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 8e-12
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 3e-07
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 2e-31
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 4e-09
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 5e-08
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 6e-08
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 4e-28
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 2e-10
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 8e-09
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 1e-06
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 7e-26
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 8e-10
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 6e-07
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 2e-06
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 1e-24
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 4e-12
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 2e-08
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 2e-07
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 2e-22
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 4e-07
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 3e-06
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 8e-06
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 3e-22
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 6e-08
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 3e-06
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 3e-06
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 4e-20
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 1e-09
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 4e-07
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 6e-06
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 3e-17
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 4e-04
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 4e-17
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 1e-12
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 9e-09
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 1e-04
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 5e-17
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 4e-12
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 3e-08
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 2e-16
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 3e-11
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 8e-08
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 6e-04
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 3e-16
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 3e-11
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-07
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 1e-15
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 7e-12
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 1e-07
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 2e-15
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 1e-04
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 9e-15
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 6e-05
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 1e-14
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 2e-10
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 2e-06
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 1e-14
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 2e-10
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 2e-06
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 2e-14
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 6e-12
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 4e-08
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 2e-14
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 6e-13
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 6e-10
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 3e-06
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 1e-11
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 6e-10
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 4e-08
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 3e-11
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 2e-09
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 2e-07
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 4e-11
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 2e-09
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 6e-09
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-10
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 3e-10
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 4e-09
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 2e-07
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 2e-09
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 2e-09
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 1e-07
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 2e-09
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 3e-09
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 6e-09
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 4e-04
4eye_A342 Probable oxidoreductase; structural genomics, niai 2e-08
4eye_A342 Probable oxidoreductase; structural genomics, niai 2e-04
3gms_A 340 Putative NADPH:quinone reductase; structural genom 5e-08
3gms_A340 Putative NADPH:quinone reductase; structural genom 2e-04
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 6e-08
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 1e-05
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 5e-05
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 7e-07
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 2e-06
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 7e-05
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 1e-04
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 3e-06
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 1e-04
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 3e-06
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 5e-06
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 6e-06
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 1e-04
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 2e-05
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 2e-05
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 1e-04
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 3e-05
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 2e-04
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 3e-05
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 3e-05
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 1e-04
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 3e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 4e-05
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 4e-05
2rir_A300 Dipicolinate synthase, A chain; structural genomic 6e-05
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 2e-04
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 5e-04
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 3e-04
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 5e-04
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 7e-04
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
 Score =  261 bits (669), Expect = 1e-84
 Identities = 102/174 (58%), Positives = 132/174 (75%), Gaps = 2/174 (1%)

Query: 234 DRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAADFCHKLPDHVSL 293
           DRVAIEPG P     +CK GRYNL   IFFCATPPD GNL R+Y+H A FC+KLPD+V+ 
Sbjct: 89  DRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTF 148

Query: 294 EEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHK 353
           EEGAL+EPLSVG+HACRR GVTLG KVL+ GAGPIG+VTLL A+A+GA++VV+TD+   +
Sbjct: 149 EEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATR 208

Query: 354 LKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGM 407
           L  AKE+GAD  + I    S +EI+  +   L G +P+ TI+C+G E++I+ G+
Sbjct: 209 LSKAKEIGADLVLQI-SKESPQEIARKVEGQL-GCKPEVTIECTGAEASIQAGI 260


>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.97
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.97
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.97
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.97
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.97
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.97
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.97
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.97
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.97
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.97
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.97
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.97
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.97
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.96
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.96
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.96
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.96
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.96
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.96
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.96
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.96
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.96
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.96
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.96
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.96
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.96
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.96
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.96
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.96
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.96
3gms_A 340 Putative NADPH:quinone reductase; structural genom 99.96
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.96
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.96
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.96
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.96
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 99.96
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.96
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.96
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.96
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.96
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.96
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.96
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.96
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.96
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.95
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.95
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.95
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.95
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 99.95
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.95
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.95
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.95
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 99.95
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 99.95
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 99.95
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.95
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.95
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.95
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.95
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.95
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.95
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.95
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.95
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 99.95
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.95
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.95
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.95
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.95
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.95
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 99.95
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.95
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.95
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.95
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.95
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.95
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.95
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.95
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.94
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.94
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.94
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.94
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.94
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.94
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.94
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.94
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 99.94
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.94
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 99.93
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.93
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.93
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.93
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.93
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.93
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.93
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.93
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.92
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.92
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.92
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.92
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.92
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 99.91
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.91
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.88
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.87
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.85
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.85
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.85
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.84
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.83
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.82
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 99.74
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.74
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.73
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.62
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.55
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.52
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.49
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.48
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.45
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.45
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.44
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.4
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.4
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.4
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.4
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.38
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.38
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.37
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.37
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.36
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.36
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.33
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.31
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.31
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.29
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.26
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.26
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.22
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.21
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 98.93
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.41
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.35
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.14
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.1
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 98.09
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.04
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 98.03
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 97.99
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 97.99
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.98
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.97
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.96
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.95
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.94
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.94
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 97.94
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.93
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.93
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.93
4dqx_A 277 Probable oxidoreductase protein; structural genomi 97.92
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.91
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 97.91
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.9
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 97.89
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.88
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.88
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.88
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.87
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.87
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 97.87
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.86
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.86
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 97.86
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.86
3imf_A 257 Short chain dehydrogenase; structural genomics, in 97.86
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.86
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 97.86
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 97.86
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.84
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 97.84
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.84
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.84
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.83
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 97.83
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.83
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.83
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.83
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.82
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.81
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.81
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.81
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.81
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.81
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 97.81
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 97.81
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.81
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.8
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.8
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.8
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 97.8
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.8
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 97.8
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 97.8
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.79
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.79
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 97.79
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 97.78
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 97.78
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 97.77
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.77
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.76
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.76
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 97.76
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.75
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.75
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.74
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.74
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 97.73
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 97.73
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.73
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.73
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.73
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.73
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 97.72
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.72
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 97.72
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 97.72
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.72
3cxt_A 291 Dehydrogenase with different specificities; rossma 97.72
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.71
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.71
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.71
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.71
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.71
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.71
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.71
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 97.71
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.7
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.7
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.7
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 97.7
1xq1_A 266 Putative tropinone reducatse; structural genomics, 97.7
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 97.69
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.69
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 97.69
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.69
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.68
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 97.68
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.68
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 97.68
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 97.67
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.67
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 97.67
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.66
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.66
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.66
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.66
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 97.66
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 97.66
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.65
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 97.65
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.65
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.64
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 97.64
1xkq_A 280 Short-chain reductase family member (5D234); parra 97.64
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.64
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.64
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.63
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.63
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.63
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.63
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.62
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.62
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 97.62
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.61
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.61
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 97.61
3rih_A 293 Short chain dehydrogenase or reductase; structural 97.61
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 97.61
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 97.61
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.6
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.6
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.6
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.59
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.59
1xhl_A 297 Short-chain dehydrogenase/reductase family member 97.59
1spx_A 278 Short-chain reductase family member (5L265); paral 97.59
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 97.58
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 97.58
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.58
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 97.57
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 97.57
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 97.55
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 97.55
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.55
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 97.55
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.54
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.54
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 97.54
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.54
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.54
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.54
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.54
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.53
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 97.53
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.53
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.53
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 97.52
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.52
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 97.52
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 97.51
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 97.51
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 97.5
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.5
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 97.49
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.48
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 97.48
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.48
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.47
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.46
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.45
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 97.44
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.44
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.43
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.42
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.41
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.4
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 97.4
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.39
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.38
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.38
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.37
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.33
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.32
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.31
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.3
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 97.3
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 97.3
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.29
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 97.28
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.28
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.27
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.24
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.23
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.23
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 97.21
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.2
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 97.2
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.2
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.2
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 97.17
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.15
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.14
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.13
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.13
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 97.12
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.12
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.06
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.06
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 97.05
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.04
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.03
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 97.01
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.0
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 96.99
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.98
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 96.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.97
1xq6_A 253 Unknown protein; structural genomics, protein stru 96.96
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.94
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.93
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.92
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 96.92
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.92
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.9
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.9
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.9
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.89
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.89
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 96.86
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.86
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.84
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 96.82
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.82
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.81
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 96.77
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.77
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.76
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.75
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 96.72
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.7
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 96.68
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.66
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 96.65
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.64
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.63
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.6
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.58
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.57
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.57
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 96.56
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 96.54
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.54
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.54
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.53
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.52
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 96.51
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.5
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.49
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 96.49
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.47
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 96.46
4e4y_A 244 Short chain dehydrogenase family protein; structur 96.45
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 96.45
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.45
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.43
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.39
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 96.39
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.39
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.34
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.33
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.32
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.3
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.3
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.29
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.29
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.28
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.23
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.22
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.19
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.16
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.14
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.12
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.12
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 96.09
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 96.09
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 96.08
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.06
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.06
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.04
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.03
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.02
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.99
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.96
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.94
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 95.93
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 95.93
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.93
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 95.91
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.9
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.87
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.86
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.85
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.8
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 95.78
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 95.77
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.76
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.76
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 95.73
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 95.73
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 95.71
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 95.7
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 95.66
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.64
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.62
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.59
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.58
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 95.57
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.57
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.56
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 95.55
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 95.55
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.47
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 95.45
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 95.3
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 95.29
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 95.24
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 95.2
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 95.2
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 95.19
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.16
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 95.14
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.07
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.04
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 94.94
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.94
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 94.89
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 94.88
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.88
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 94.82
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.77
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 94.77
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 94.74
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 94.72
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 94.72
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 94.71
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 94.69
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 94.68
4f6c_A 427 AUSA reductase domain protein; thioester reductase 94.65
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
Probab=100.00  E-value=2.5e-34  Score=300.30  Aligned_cols=313  Identities=12%  Similarity=0.147  Sum_probs=243.7

Q ss_pred             CCeeeecccchhhhhcCCCCCCCCCCCccccCCccEEEEEeCCCCCCCCCCCEEEEc-----cCcccccCCcceecccee
Q psy1413           1 MHCVGICGSDVHYLTHGQIGDFRLSDPMIVGHEASGIVSKVGAKVKHLKVDNQTRFV-----PEFRNVCLSPILRRRFSL   75 (408)
Q Consensus         1 V~a~gic~sDl~~~~~g~~~~~~~~~P~i~GhE~~G~Vv~vG~~v~~~~vGdrV~~~-----~~~~~~~~~~~~~~p~~~   75 (408)
                      |+++|||++|++++. |.   +  +.|.++|||++|+|+++|++|++|++||||+..     .++...+...++..|+++
T Consensus       245 V~a~gin~~D~~~~~-G~---~--~~~~~lG~E~aG~V~~vG~~V~~~~vGDrV~~~~~G~~ae~~~v~~~~~~~iP~~l  318 (795)
T 3slk_A          245 MRAAGVNFRDALIAL-GM---Y--PGVASLGSEGAGVVVETGPGVTGLAPGDRVMGMIPKAFGPLAVADHRMVTRIPAGW  318 (795)
T ss_dssp             EEEEEECHHHHHHTT-TC---C--SSCCCSCCCEEEEEEEECSSCCSSCTTCEEEECCSSCSSSEEEEETTSEEECCTTC
T ss_pred             EEEEccCHHHHHHHc-CC---C--CCCccccceeEEEEEEeCCCCCcCCCCCEEEEEecCCCcCEEEeehHHEEECCCCC
Confidence            579999999999884 32   2  346679999999999999999999999999854     355677788899999999


Q ss_pred             eecccccCCCCCCcceEEEEeeeee-cCCeEEEEc-cCccccccccccccccCc--------------------------
Q psy1413          76 RFREQKPIEDPDDHEVLLEMHCVGI-CGSDVHYLT-HGQIGDFRLSDPMIVGHE--------------------------  127 (408)
Q Consensus        76 ~~~~~~~lp~~~~~~~~~~~~~~~~-~g~~vlv~g-~G~vG~~~i~~a~~~G~~--------------------------  127 (408)
                      ++++.+.+|..+.+++.+......+ .|++|+|+| +|++|++++|+++.+|++                          
T Consensus       319 s~~~AA~l~~~~~Ta~~al~~~a~l~~G~~VLI~gaaGgvG~~aiqlAk~~Ga~V~~t~~~~k~~~l~lga~~v~~~~~~  398 (795)
T 3slk_A          319 SFARAASVPIVFLTAYYALVDLAGLRPGESLLVHSAAGGVGMAAIQLARHLGAEVYATASEDKWQAVELSREHLASSRTC  398 (795)
T ss_dssp             CHHHHHHHHHHHHHHHCCCCCCTCCCTTCCEEEESTTBHHHHHHHHHHHHTTCCEEEECCGGGGGGSCSCGGGEECSSSS
T ss_pred             CHHHHHhhhHHHHHHHHHHHHHhCCCCCCEEEEecCCCHHHHHHHHHHHHcCCEEEEEeChHHhhhhhcChhheeecCCh
Confidence            9988888887777777554444444 589999999 599999999999988763                          


Q ss_pred             --------------ceeEEEccCchH--HHHhhccCCcEEEEEccCCCCcccCHHHHHhcCcEEEEeecC-------CCc
Q psy1413         128 --------------ASGIVSKVGAKV--KHLKATRPGGCLVIVGAGSQDVKIPLVLTMTKEIDIRGVFRY-------AND  184 (408)
Q Consensus       128 --------------~~~vv~~~g~~~--~~~~~l~~gG~iv~~G~~~~~~~~~~~~~~~~~~~l~g~~~~-------~~~  184 (408)
                                    ++.+++++|...  +++++++++|+++.+|.........+. ...+++++.+....       .+.
T Consensus       399 ~~~~~i~~~t~g~GvDvVld~~gg~~~~~~l~~l~~~Gr~v~iG~~~~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~  477 (795)
T 3slk_A          399 DFEQQFLGATGGRGVDVVLNSLAGEFADASLRMLPRGGRFLELGKTDVRDPVEVA-DAHPGVSYQAFDTVEAGPQRIGEM  477 (795)
T ss_dssp             THHHHHHHHSCSSCCSEEEECCCTTTTHHHHTSCTTCEEEEECCSTTCCCHHHHH-HHSSSEEEEECCGGGGHHHHHHHH
T ss_pred             hHHHHHHHHcCCCCeEEEEECCCcHHHHHHHHHhcCCCEEEEeccccccCccccc-ccCCCCEEEEeeccccCHHHHHHH
Confidence                          445566655432  689999999999999976654333322 23477777765421       145


Q ss_pred             HHHHHHHHHcCCCCCCCceeeeeccchHHHHHHHHHcCCCCceEEEEEcCceeecCCCcccccccccCCccccccceeec
Q psy1413         185 YPIALAMVASGKVDVKKLITHNYLLEDTLHAFETAKTGAGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFC  264 (408)
Q Consensus       185 ~~~~~~l~~~g~~~~~~~i~~~~~l~~~~~a~~~~~~~~~~~~kvvi~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  264 (408)
                      ++++++++++|++++  +++++|||+|+++||+.+.+++. .+|++++..                              
T Consensus       478 l~~~~~l~~~g~l~p--~~~~~~~l~~~~eA~~~l~~g~~-~GKvVl~~~------------------------------  524 (795)
T 3slk_A          478 LHELVELFEGRVLEP--LPVTAWDVRQAPEALRHLSQARH-VGKLVLTMP------------------------------  524 (795)
T ss_dssp             HHHHHHHHHTTSCCC--CCEEEEEGGGHHHHHHHHHHTCC-CBEEEEECC------------------------------
T ss_pred             HHHHHHHHHcCCcCC--CcceeEcHHHHHHHHHHHhcCCc-cceEEEecC------------------------------
Confidence            889999999999864  68999999999999999988754 345555421                              


Q ss_pred             ccCCCCccceeEEeeccceeeeCCCCCCcccccccchhhhhhhhhhccCcCCCCEEEEEec-chhHHHHHHHHH-HhCCC
Q psy1413         265 ATPPDHGNLSRYYRHAADFCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGA-GPIGLVTLLTAR-ALGAS  342 (408)
Q Consensus       265 ~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~aa~~~~~~~~~~~~~~~~~~~~~~~lv~G~-G~~G~~~~~~~~-~~Ga~  342 (408)
                                              +                       .++++++|||+|+ |++|+.+++++. ..|++
T Consensus       525 ------------------------~-----------------------~~~~~~~~lItGg~~GlG~aiA~~la~~~Ga~  557 (795)
T 3slk_A          525 ------------------------P-----------------------VWDAAGTVLVTGGTGALGAEVARHLVIERGVR  557 (795)
T ss_dssp             ------------------------C-----------------------CCCTTSEEEEETTTSHHHHHHHHHHHHTSSCC
T ss_pred             ------------------------c-----------------------ccccccceeeccCCCCcHHHHHHHHHHHcCCc
Confidence                                    1                       1478899999999 999999999998 79999


Q ss_pred             eEEEEecChh---h----HHHHHHcCCCeEEecCCCCChHHHHHHHHHHhcCCCCceEEEcccch
Q psy1413         343 RVVITDILEH---K----LKTAKEMGADATVLIDRNHSLEEISTHIIELLQGEQPDKTIDCSGIE  400 (408)
Q Consensus       343 ~vv~~~~~~~---~----~~~~~~~ga~~~i~~~~~~~~~~~~~~~~~~~~~~~~d~i~d~~g~~  400 (408)
                      +|++++|++.   +    .+.+++.|+...+...|..+.+++++.+.++....++|.+|++.|..
T Consensus       558 ~vvl~~R~~~~~~~~~~~~~~l~~~G~~v~~~~~Dvsd~~~v~~~~~~~~~~~~id~lVnnAGv~  622 (795)
T 3slk_A          558 NLVLVSRRGPAASGAAELVAQLTAYGAEVSLQACDVADRETLAKVLASIPDEHPLTAVVHAAGVL  622 (795)
T ss_dssp             EEEEEESSGGGSTTHHHHHHHHHHTTCEEEEEECCTTCHHHHHHHHHTSCTTSCEEEEEECCCCC
T ss_pred             EEEEeccCccchHHHHHHHHHHHhcCCcEEEEEeecCCHHHHHHHHHHHHHhCCCEEEEECCCcC
Confidence            9999999832   2    23445678877777778888899999988876545899999999864



>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 5e-20
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 1e-07
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 4e-17
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 3e-13
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 2e-16
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 4e-12
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 3e-16
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 1e-15
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 7e-13
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 1e-04
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 1e-12
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 6e-08
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 8e-12
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 2e-11
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 6e-11
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 7e-11
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 2e-10
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 2e-10
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 3e-10
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 2e-09
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 5e-09
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 1e-08
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 7e-07
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 1e-06
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 1e-06
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 3e-06
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 5e-06
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 7e-06
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 1e-05
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 4e-04
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 2e-05
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 2e-05
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 4e-05
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 1e-04
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 4e-04
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 5e-04
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 0.001
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 0.001
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 0.001
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 0.002
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 0.003
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.0 bits (209), Expect = 5e-20
 Identities = 48/107 (44%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 223 AGNAIKVMIHCDRVAIEPGVPCRTCTYCKEGRYNLCRQIFFCATPPDHGNLSRYYRHAAD 282
            G+++K +   DRVAIEPG P     +CK GRYNL   IFFCATPPD GNL R+Y+H A 
Sbjct: 78  VGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAA 137

Query: 283 FCHKLPDHVSLEEGALLEPLSVGVHACRRAGVTLGSKVLITGAGPIG 329
           FC+KLPD+V         PL   + A       LG K+++    P  
Sbjct: 138 FCYKLPDNVKPLV-THRFPLEKALEAFETFKKGLGLKIML-KCDPSD 182


>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.81
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.78
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.76
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.75
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.74
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.74
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.74
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.73
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.72
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.72
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.72
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.72
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.72
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.71
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.71
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.71
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.7
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.7
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.69
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.68
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.68
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.67
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.67
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.67
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.65
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.65
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.63
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.63
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.63
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.63
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.6
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.6
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.6
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.59
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.59
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.58
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.57
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.57
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.57
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.56
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.52
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.51
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.51
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.49
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.48
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.46
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.46
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.42
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.41
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.4
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.4
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.38
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.38
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.35
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.35
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.34
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.3
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.26
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.24
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.24
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.21
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.17
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.16
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.14
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.12
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.11
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.09
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.08
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.02
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.0
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.98
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.96
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.94
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.93
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.92
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 98.92
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 98.92
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.9
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.86
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.7
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.65
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 98.62
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.6
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 98.55
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.54
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.51
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.49
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.49
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.48
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.47
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.47
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.46
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 98.42
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.38
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 98.31
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.3
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 98.19
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.14
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.12
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.11
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 98.1
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.1
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.08
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.07
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 98.07
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 98.04
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.01
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.01
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.99
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.99
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.99
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.98
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.98
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 97.98
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.97
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.96
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 97.94
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.93
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.91
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.91
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 97.91
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.91
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 97.91
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.9
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.89
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.89
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 97.87
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.87
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.87
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 97.86
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 97.85
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.85
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.82
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.81
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.74
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.73
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.73
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.72
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.7
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.63
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.61
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.57
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.57
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.55
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.52
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.47
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.42
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 97.41
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 97.39
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.39
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 97.31
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.31
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.29
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.29
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 97.23
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.22
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.1
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 97.06
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.03
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 97.0
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.94
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 96.89
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.86
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.78
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.71
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.59
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 96.5
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.31
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.29
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 96.24
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.18
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.12
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.91
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.81
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 95.77
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 95.62
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.6
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 95.55
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.48
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.35
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 95.2
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.17
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.17
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.15
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 95.06
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 95.05
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.0
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.0
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.81
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 94.8
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.77
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.77
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.57
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.57
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.51
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.5
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.49
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.48
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.47
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.44
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.42
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.41
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.37
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.35
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.33
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.3
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.22
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 94.06
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 93.99
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.92
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 93.81
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.72
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.7
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.68
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.64
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.58
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 93.57
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.52
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.45
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.31
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.14
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.89
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.82
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 92.79
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.63
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.6
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.55
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.54
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.27
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.26
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 92.14
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 92.08
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.08
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 91.94
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.9
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 91.72
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.61
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.57
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 91.41
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 91.41
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 91.31
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 91.26
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.16
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.06
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 91.04
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 90.98
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 90.93
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.82
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.81
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 90.79
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 90.77
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 90.76
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.74
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.59
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.56
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 90.55
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.55
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.44
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.15
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.12
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 89.77
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 89.62
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.61
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 89.47
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.46
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 89.43
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 89.35
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 89.16
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.99
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.98
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 88.98
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 88.9
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.65
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.61
d1wkva1 382 O-acetylserine sulfhydrylase (Cysteine synthase) { 88.11
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 88.1
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 87.86
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.79
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 87.79
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.65
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 87.62
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 87.61
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.5
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 87.41
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.41
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.31
d1fcja_ 302 O-acetylserine sulfhydrylase (Cysteine synthase) { 87.25
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 87.15
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.14
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 87.09
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 86.9
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.82
d2bhsa1 292 O-acetylserine sulfhydrylase (Cysteine synthase) { 86.82
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 86.72
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.66
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 86.56
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 86.51
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.5
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.31
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.26
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 86.17
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 86.16
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 86.02
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 86.0
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.9
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 85.7
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 85.53
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.53
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 85.48
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 85.31
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 85.18
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 84.96
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 84.96
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 84.76
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 84.54
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 84.41
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 84.41
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.39
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.0
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 83.77
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.65
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 83.63
d1y7la1 310 O-acetylserine sulfhydrylase (Cysteine synthase) { 83.59
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 83.09
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 82.92
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 82.91
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 82.58
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 82.5
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 82.44
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 82.35
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 82.27
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 82.25
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 82.16
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.07
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 81.35
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 81.32
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 81.14
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 81.12
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 80.85
d1z7wa1 320 O-acetylserine sulfhydrylase (Cysteine synthase) { 80.77
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 80.77
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 80.76
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 80.73
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 80.69
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 80.66
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 80.23
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Bacterial secondary alcohol dehydrogenase
species: Clostridium beijerinckii [TaxId: 1520]
Probab=99.81  E-value=2.1e-20  Score=157.66  Aligned_cols=113  Identities=24%  Similarity=0.416  Sum_probs=105.1

Q ss_pred             CCcccccccc-hhhhhhhhhhccCcCCCCEEEEEecchhHHHHHHHHHHhCCCeEEEEecChhhHHHHHHcCCCeEEecC
Q psy1413         291 VSLEEGALLE-PLSVGVHACRRAGVTLGSKVLITGAGPIGLVTLLTARALGASRVVITDILEHKLKTAKEMGADATVLID  369 (408)
Q Consensus       291 ~~~~~aa~~~-~~~~~~~~~~~~~~~~~~~~lv~G~G~~G~~~~~~~~~~Ga~~vv~~~~~~~~~~~~~~~ga~~~i~~~  369 (408)
                      +|+++|++++ +++|+|+++++..++++++++|+|+|++|++++|+++.+|+++|++++++++|++.++++|+++++|++
T Consensus         1 ip~e~A~~l~~~~~ta~~a~~~a~~~~g~~VlI~GaG~vGl~~~q~ak~~Ga~~Vi~~d~~~~r~~~a~~lGa~~~i~~~   80 (174)
T d1jqba2           1 MPLENAVMITDMMTTGFHGAELADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYK   80 (174)
T ss_dssp             SCHHHHHTTTTHHHHHHHHHHHTTCCTTCCEEEECCSHHHHHHHHHHHTTTCSCEEEECCCHHHHHHHHHHTCSEEECGG
T ss_pred             CCHHHHHHhhhHHHHHHHHHHHhCCCCCCEEEEEcCCcchhhhhhhhhcccccccccccchhhhHHHHHhhCcccccccc
Confidence            4778898885 789999999999999999999999999999999999999998899999999999999999999999998


Q ss_pred             CCCChHHHHHHHHHHhcCCCCceEEEcccchhhhhhcC
Q psy1413         370 RNHSLEEISTHIIELLQGEQPDKTIDCSGIESTIKLGM  407 (408)
Q Consensus       370 ~~~~~~~~~~~~~~~~~~~~~d~i~d~~g~~~~~~~~~  407 (408)
                      +    ++..+.++++++++++|++|||+|++.++++++
T Consensus        81 ~----~~~~~~v~~~t~g~G~D~vid~~g~~~~~~~a~  114 (174)
T d1jqba2          81 N----GHIEDQVMKLTNGKGVDRVIMAGGGSETLSQAV  114 (174)
T ss_dssp             G----SCHHHHHHHHTTTSCEEEEEECSSCTTHHHHHH
T ss_pred             c----hhHHHHHHHHhhccCcceEEEccCCHHHHHHHH
Confidence            7    778899999999999999999999999888765



>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure