Psyllid ID: psy14246
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 193683435 | 506 | PREDICTED: agrin-like [Acyrthosiphon pis | 0.968 | 0.547 | 0.564 | 2e-83 | |
| 357630335 | 281 | hypothetical protein KGM_12264 [Danaus p | 0.965 | 0.982 | 0.513 | 3e-75 | |
| 389610989 | 295 | follistatin [Papilio polytes] | 0.965 | 0.935 | 0.520 | 3e-74 | |
| 307201084 | 516 | Agrin [Harpegnathos saltator] | 0.993 | 0.550 | 0.513 | 1e-73 | |
| 383865913 | 518 | PREDICTED: agrin-like [Megachile rotunda | 0.993 | 0.548 | 0.513 | 4e-73 | |
| 345495433 | 504 | PREDICTED: LOW QUALITY PROTEIN: agrin-li | 0.993 | 0.563 | 0.501 | 3e-72 | |
| 332027628 | 446 | Agrin [Acromyrmex echinatior] | 0.961 | 0.616 | 0.510 | 6e-72 | |
| 380011677 | 497 | PREDICTED: agrin-like [Apis florea] | 0.965 | 0.555 | 0.501 | 1e-71 | |
| 340728181 | 497 | PREDICTED: agrin-like [Bombus terrestris | 0.965 | 0.555 | 0.501 | 3e-71 | |
| 350402980 | 497 | PREDICTED: agrin-like [Bombus impatiens] | 0.965 | 0.555 | 0.501 | 3e-71 |
| >gi|193683435|ref|XP_001945453.1| PREDICTED: agrin-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 315 bits (807), Expect = 2e-83, Method: Compositional matrix adjust.
Identities = 163/289 (56%), Positives = 205/289 (70%), Gaps = 12/289 (4%)
Query: 1 MAFCMSQERNKNGAI-ACPVSCEGEKERIICGSDGNVYSSECEMRMLNCGSECDLKKSTC 59
MAFC+SQERN+ G+ ACPV+C+ EK+R+ CGSDGNVY SECEM+MLNCG +
Sbjct: 227 MAFCLSQERNRVGSSNACPVNCDKEKDRLTCGSDGNVYRSECEMKMLNCGQQTK------ 280
Query: 60 GEKVVPVPLHHC-PTTALCNH-QCDDRREFVCGSDNKFYKSPCEMKRENCGVGIELSHLG 117
+KV V L C CN QC D + +CG+D + YK+ C++ + C GI+++HLG
Sbjct: 281 -KKVTKVDLEKCRARINKCNKGQCPDDADPICGNDAQNYKNQCQLDQATCLRGIQMAHLG 339
Query: 118 PCNNISAHRENCPVNCDQAPLDGPICGSDGNVYKTNCQMKLLTCGQGVVRVSKRHCQTTR 177
C+++ + E CP +C+ + P+C SDGNVY++ C +K+ TCGQ VV V HC TT
Sbjct: 340 KCSSLLS-TEKCPQSCENE-REEPVCASDGNVYRSECDLKMNTCGQKVVAVPPHHCPTTA 397
Query: 178 HCRESCWRVSKPTCGSDGNIYSNACRMKSKNCGKHVYVVPIKRCLQGFHFKGCARICPTI 237
C + C + + CGSD +Y N C MK +NCGKHVYVVP+KRCL GF FKGC R+CPT+
Sbjct: 398 LCHQQCDKTKEFVCGSDNKLYRNECEMKRENCGKHVYVVPMKRCLTGFQFKGCQRVCPTL 457
Query: 238 YDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQCGQPTEEPKNYLY 286
YDPICGTD KTYSNDCFL+MENCRSRSLV K YHG CGQPTEEPKNYLY
Sbjct: 458 YDPICGTDLKTYSNDCFLEMENCRSRSLVSKQYHGVCGQPTEEPKNYLY 506
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357630335|gb|EHJ78526.1| hypothetical protein KGM_12264 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|389610989|dbj|BAM19105.1| follistatin [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|307201084|gb|EFN81016.1| Agrin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383865913|ref|XP_003708416.1| PREDICTED: agrin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345495433|ref|XP_001602525.2| PREDICTED: LOW QUALITY PROTEIN: agrin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332027628|gb|EGI67698.1| Agrin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380011677|ref|XP_003689924.1| PREDICTED: agrin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340728181|ref|XP_003402406.1| PREDICTED: agrin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350402980|ref|XP_003486665.1| PREDICTED: agrin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| FB|FBgn0052354 | 662 | CG32354 [Drosophila melanogast | 0.993 | 0.429 | 0.42 | 2.2e-66 | |
| UNIPROTKB|O96790 | 351 | O96790 "Serine protease inhibi | 0.832 | 0.678 | 0.314 | 7e-22 | |
| WB|WBGene00009257 | 1189 | F29G6.1 [Caenorhabditis elegan | 0.671 | 0.161 | 0.253 | 1.5e-19 | |
| UNIPROTKB|I3LGD9 | 2039 | I3LGD9 "Uncharacterized protei | 0.888 | 0.124 | 0.267 | 2.5e-19 | |
| MGI|MGI:87961 | 1950 | Agrn "agrin" [Mus musculus (ta | 0.867 | 0.127 | 0.287 | 1e-18 | |
| RGD|2067 | 1959 | Agrn "agrin" [Rattus norvegicu | 0.877 | 0.128 | 0.277 | 1.7e-18 | |
| UNIPROTKB|F1P3E3 | 1952 | AGRN "Agrin" [Gallus gallus (t | 0.895 | 0.131 | 0.270 | 3.2e-17 | |
| UNIPROTKB|F1NWQ6 | 1998 | AGRN "Agrin" [Gallus gallus (t | 0.895 | 0.128 | 0.270 | 3.3e-17 | |
| UNIPROTKB|P31696 | 2081 | AGRN "Agrin" [Gallus gallus (t | 0.891 | 0.122 | 0.270 | 5.6e-17 | |
| UNIPROTKB|O00468 | 2067 | AGRN "Agrin" [Homo sapiens (ta | 0.877 | 0.121 | 0.266 | 3.1e-16 |
| FB|FBgn0052354 CG32354 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 675 (242.7 bits), Expect = 2.2e-66, P = 2.2e-66
Identities = 126/300 (42%), Positives = 183/300 (61%)
Query: 1 MAFCMSQERNKNGAIACPVSCE----GEKERIICGSDGNVYSSECEMRMLNCGSEC-DLK 55
+++CMSQER+ + ACP C + +CGSDGN+YSS CE++MLNCG + ++
Sbjct: 365 LSYCMSQERH-GASDACPTECPKSDTDSSSQYVCGSDGNIYSSLCELKMLNCGPQRKSIQ 423
Query: 56 KST---CGEKVVPVP-LHHCPT-TALCNHQCDDRR-EFVCGSDNKFYKSPCEMKRENCGV 109
K + C ++ L C +L +R + +CG+D K Y + CE+ C
Sbjct: 424 KVSMDKCKNRLTRCKQLPPCKDFNSLFGSIFSSKRNDKLCGTDAKTYNNECELAHATCLR 483
Query: 110 GIELSHLGPCNNISAHRENCPVNCDQAPLDG-PICGSDGNVYKTNCQMKLLTCGQGVVRV 168
G+ L+H+GPC ++++ ++C C +A L+ P+CGSDGN + + C+ K TC VV V
Sbjct: 484 GVNLAHIGPCTDLNSPTKDCGDACTRADLEQQPVCGSDGNTFASMCEFKRRTCDLRVVPV 543
Query: 169 SKRHCQTTRHCRESCWRVSKPT--CGSDGNIYSNACRMKSKNCGKHVYVVPIKRCLQGFH 226
S ++C T C C P+ CGSD N+Y + C M+ +NCGKHV+VVP+KRCL F
Sbjct: 544 SLKNCALTADCESDC-DAQPPSFVCGSDNNLYKSECHMRKENCGKHVFVVPLKRCLAAFQ 602
Query: 227 FKGCARICPTIYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQCGQPTEEPKNYLY 286
KGCARICP ++P+CG+DNKTY NDCFL++ENCR+ V Y+G CG+P N+LY
Sbjct: 603 LKGCARICPREFEPVCGSDNKTYLNDCFLEIENCRANQTVNVNYYGACGRPEAPSTNFLY 662
|
|
| UNIPROTKB|O96790 O96790 "Serine protease inhibitor dipetalogastin" [Dipetalogaster maximus (taxid:72496)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009257 F29G6.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LGD9 I3LGD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWQ6 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31696 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00468 AGRN "Agrin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| smart00280 | 46 | smart00280, KAZAL, Kazal type serine protease inhi | 2e-10 | |
| pfam00050 | 48 | pfam00050, Kazal_1, Kazal-type serine protease inh | 8e-09 | |
| cd00104 | 41 | cd00104, KAZAL_FS, Kazal type serine protease inhi | 2e-08 | |
| cd01327 | 45 | cd01327, KAZAL_PSTI, Kazal-type pancreatic secreto | 9e-08 | |
| pfam07648 | 42 | pfam07648, Kazal_2, Kazal-type serine protease inh | 4e-06 | |
| smart00280 | 46 | smart00280, KAZAL, Kazal type serine protease inhi | 3e-04 | |
| cd00104 | 41 | cd00104, KAZAL_FS, Kazal type serine protease inhi | 7e-04 | |
| smart00280 | 46 | smart00280, KAZAL, Kazal type serine protease inhi | 0.004 |
| >gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
Score = 54.6 bits (132), Expect = 2e-10
Identities = 19/45 (42%), Positives = 25/45 (55%)
Query: 230 CARICPTIYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQC 274
C CP YDP+CG+D TYSN+C L C S ++ + G C
Sbjct: 2 CPEACPREYDPVCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46
|
Kazal type serine protease inhibitors and follistatin-like domains. Length = 46 |
| >gnl|CDD|200959 pfam00050, Kazal_1, Kazal-type serine protease inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|238648 cd01327, KAZAL_PSTI, Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| cd01327 | 45 | KAZAL_PSTI Kazal-type pancreatic secretory trypsin | 99.56 | |
| smart00280 | 46 | KAZAL Kazal type serine protease inhibitors. Kazal | 99.55 | |
| PF00050 | 48 | Kazal_1: Kazal-type serine protease inhibitor doma | 99.37 | |
| smart00280 | 46 | KAZAL Kazal type serine protease inhibitors. Kazal | 99.34 | |
| PF07648 | 42 | Kazal_2: Kazal-type serine protease inhibitor doma | 99.33 | |
| cd01327 | 45 | KAZAL_PSTI Kazal-type pancreatic secretory trypsin | 99.33 | |
| cd00104 | 41 | KAZAL_FS Kazal type serine protease inhibitors and | 99.31 | |
| cd01328 | 86 | FSL_SPARC Follistatin-like SPARC (secreted protein | 99.1 | |
| PF07648 | 42 | Kazal_2: Kazal-type serine protease inhibitor doma | 99.08 | |
| cd00104 | 41 | KAZAL_FS Kazal type serine protease inhibitors and | 99.07 | |
| PF00050 | 48 | Kazal_1: Kazal-type serine protease inhibitor doma | 99.03 | |
| cd01328 | 86 | FSL_SPARC Follistatin-like SPARC (secreted protein | 98.92 | |
| KOG4578|consensus | 421 | 98.35 | ||
| KOG4578|consensus | 421 | 98.23 | ||
| cd01330 | 54 | KAZAL_SLC21 The kazal-type serine protease inhibit | 97.41 | |
| cd01330 | 54 | KAZAL_SLC21 The kazal-type serine protease inhibit | 97.39 | |
| KOG3555|consensus | 434 | 97.25 | ||
| KOG3555|consensus | 434 | 96.28 | ||
| KOG4004|consensus | 259 | 95.63 | ||
| KOG4004|consensus | 259 | 95.62 | ||
| smart00057 | 69 | FIMAC factor I membrane attack complex. | 95.45 | |
| smart00057 | 69 | FIMAC factor I membrane attack complex. | 94.59 | |
| KOG3626|consensus | 735 | 91.3 | ||
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 90.81 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 90.8 | |
| KOG3626|consensus | 735 | 86.58 |
| >cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
Probab=99.56 E-value=2.7e-15 Score=99.45 Aligned_cols=43 Identities=44% Similarity=0.892 Sum_probs=41.3
Q ss_pred CCCCCcCCCcccCCCceecccchhhhhhhcCCCceeEeeeccC
Q psy14246 232 RICPTIYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQC 274 (286)
Q Consensus 232 ~~C~~~~~PVCGsDg~TY~N~C~l~~~~C~~~~~i~v~~~G~C 274 (286)
..||.+|+|||||||+||.|+|+|+.++|..+..|+++|.|+|
T Consensus 3 ~~Cp~~~~PVCGsDg~TY~N~C~l~~~~c~~~~~i~~~~~G~C 45 (45)
T cd01327 3 FGCPKDYDPVCGTDGVTYSNECLLCAENLKRQTNIRIKHDGEC 45 (45)
T ss_pred CCCCCCCCceeCCCCCEeCCHhHHHHHHhccCCCeEEeecCCC
Confidence 4799999999999999999999999999999999999999998
|
|
| >smart00280 KAZAL Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00280 KAZAL Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
| >PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 | Back alignment and domain information |
|---|
| >cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
| >cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin | Back alignment and domain information |
|---|
| >PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 | Back alignment and domain information |
|---|
| >cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin | Back alignment and domain information |
|---|
| >KOG4578|consensus | Back alignment and domain information |
|---|
| >KOG4578|consensus | Back alignment and domain information |
|---|
| >cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake | Back alignment and domain information |
|---|
| >cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake | Back alignment and domain information |
|---|
| >KOG3555|consensus | Back alignment and domain information |
|---|
| >KOG3555|consensus | Back alignment and domain information |
|---|
| >KOG4004|consensus | Back alignment and domain information |
|---|
| >KOG4004|consensus | Back alignment and domain information |
|---|
| >smart00057 FIMAC factor I membrane attack complex | Back alignment and domain information |
|---|
| >smart00057 FIMAC factor I membrane attack complex | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 286 | ||||
| 2p6a_D | 315 | The Structure Of The Activin:follistatin 315 Comple | 7e-07 | ||
| 2p6a_D | 315 | The Structure Of The Activin:follistatin 315 Comple | 2e-06 | ||
| 2b0u_C | 288 | The Structure Of The Follistatin:activin Complex Le | 2e-06 | ||
| 1y1b_A | 48 | Solution Structure Of Anemonia Elastase Inhibitor L | 5e-05 | ||
| 1tgs_I | 56 | Three-Dimensional Structure Of The Complex Between | 3e-04 | ||
| 3sek_C | 209 | Crystal Structure Of The Myostatin:follistatin-Like | 4e-04 | ||
| 3b4v_C | 237 | X-Ray Structure Of Activin In Complex With Fstl3 Le | 5e-04 | ||
| 2leo_A | 66 | Solution Structure Of Esophageal Cancer-Related Gen | 6e-04 | ||
| 1tbr_R | 103 | Crystal Structure Of Insect Derived Double Domain K | 8e-04 |
| >pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 | Back alignment and structure |
|
| >pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 | Back alignment and structure |
| >pdb|2B0U|C Chain C, The Structure Of The Follistatin:activin Complex Length = 288 | Back alignment and structure |
| >pdb|1Y1B|A Chain A, Solution Structure Of Anemonia Elastase Inhibitor Length = 48 | Back alignment and structure |
| >pdb|1TGS|I Chain I, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 56 | Back alignment and structure |
| >pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 | Back alignment and structure |
| >pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 | Back alignment and structure |
| >pdb|2LEO|A Chain A, Solution Structure Of Esophageal Cancer-Related Gene 2 Length = 66 | Back alignment and structure |
| >pdb|1TBR|R Chain R, Crystal Structure Of Insect Derived Double Domain Kazal Inhibitor Rhodniin In Complex With Thrombin Length = 103 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 2e-14 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 6e-09 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 8e-06 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 2e-05 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 2e-05 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 1e-11 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 1e-05 | |
| 1uvf_A | 61 | Serine proteinase inhibitor kazal type 5; trypsin | 4e-11 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 7e-11 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 1e-05 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 8e-11 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 2e-10 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 3e-07 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 3e-07 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 1e-05 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 1e-05 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 2e-09 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 2e-09 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 3e-09 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 5e-07 | |
| 1pce_A | 60 | PEC-60; proteinase inhibitor(kazal type); NMR {Sus | 6e-09 | |
| 1cgj_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 8e-09 | |
| 1tgs_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 9e-09 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 1e-08 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 2e-04 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 1e-08 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 2e-08 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 2e-05 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 3e-05 | |
| 1r0r_I | 51 | Ovomucoid, omtky3; high resolution, serine proteas | 5e-08 | |
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 6e-08 | |
| 1bus_A | 57 | Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru | 7e-08 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 8e-08 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 3e-07 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 8e-06 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 3e-04 |
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
Score = 66.7 bits (162), Expect = 2e-14
Identities = 27/98 (27%), Positives = 38/98 (38%), Gaps = 2/98 (2%)
Query: 179 CRESCWRVSKPTCGSDGNIYSNACRMKSKNC--GKHVYVVPIKRCLQGFHFKGCARICPT 236
+C CGSDG YSN C + + V C C
Sbjct: 4 EPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGD 63
Query: 237 IYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQC 274
Y P+CG+D+ TY N+C L+ + S V+ + G C
Sbjct: 64 EYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPC 101
|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
| >1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 | Back alignment and structure |
|---|
| >1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Length = 56 | Back alignment and structure |
|---|
| >1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Length = 56 | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Length = 62 | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Length = 75 | Back alignment and structure |
|---|
| >1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Length = 51 | Back alignment and structure |
|---|
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 | Back alignment and structure |
|---|
| >1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Length = 57 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 | Back alignment and structure |
|---|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Length = 46 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 99.97 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 99.97 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 99.97 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 99.96 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 99.95 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 99.91 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 99.89 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 99.89 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 99.88 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 99.87 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 99.86 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 99.86 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 99.84 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 99.81 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 99.51 | |
| 1cgj_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.44 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 99.44 | |
| 1r0r_I | 51 | Ovomucoid, omtky3; high resolution, serine proteas | 99.42 | |
| 1tgs_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.41 | |
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 99.41 | |
| 1uvf_A | 61 | Serine proteinase inhibitor kazal type 5; trypsin | 99.4 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 99.11 | |
| 1bus_A | 57 | Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru | 99.39 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 99.37 | |
| 1pce_A | 60 | PEC-60; proteinase inhibitor(kazal type); NMR {Sus | 99.37 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 99.35 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 99.33 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 99.32 | |
| 3pis_D | 42 | Kazal-type serine protease inhibitor SPI-1; typica | 99.28 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 99.24 | |
| 4gi3_C | 83 | Greglin; kazal type inhibitor, hydrolase-hydrolase | 99.23 | |
| 3pis_D | 42 | Kazal-type serine protease inhibitor SPI-1; typica | 99.22 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 99.2 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 99.2 | |
| 1cgj_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.19 | |
| 1r0r_I | 51 | Ovomucoid, omtky3; high resolution, serine proteas | 99.16 | |
| 1bus_A | 57 | Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru | 99.16 | |
| 1tgs_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.15 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 98.76 | |
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 99.14 | |
| 1uvf_A | 61 | Serine proteinase inhibitor kazal type 5; trypsin | 99.13 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 99.13 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 99.12 | |
| 1pce_A | 60 | PEC-60; proteinase inhibitor(kazal type); NMR {Sus | 99.1 | |
| 1h0z_A | 68 | Serine protease inhibitor kazal-type 5, contains h | 99.01 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 99.01 | |
| 1h0z_A | 68 | Serine protease inhibitor kazal-type 5, contains h | 99.0 | |
| 4gi3_C | 83 | Greglin; kazal type inhibitor, hydrolase-hydrolase | 98.92 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 98.79 | |
| 2wcy_A | 155 | Complement component C7; immune system, disulfide | 98.72 | |
| 2wcy_A | 155 | Complement component C7; immune system, disulfide | 98.65 | |
| 3tjq_A | 140 | Serine protease HTRA1; hydrolase; 2.00A {Homo sapi | 98.53 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 98.45 | |
| 1hdl_A | 55 | HF6478, serine proteinase inhibitor lekti; putativ | 98.28 | |
| 1hdl_A | 55 | HF6478, serine proteinase inhibitor lekti; putativ | 98.22 | |
| 3tjq_A | 140 | Serine protease HTRA1; hydrolase; 2.00A {Homo sapi | 98.19 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 87.97 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 85.24 |
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
Probab=99.97 E-value=3.3e-32 Score=246.50 Aligned_cols=174 Identities=27% Similarity=0.677 Sum_probs=126.5
Q ss_pred ccccCCCCC--CCceEcCCCceecccccchhhhccCC--ceeeccCCCCCCCC-----------------CCC-CCCCCC
Q psy14246 76 LCNHQCDDR--REFVCGSDNKFYKSPCEMKRENCGVG--IELSHLGPCNNISA-----------------HRE-NCPVNC 133 (286)
Q Consensus 76 ~C~~~C~~~--~~PVCGsdG~tY~n~C~l~~a~C~~~--i~~~~~G~C~~~~~-----------------~~~-~C~~~C 133 (286)
.|+..|+.. +.||||+||+||.|+|+|++++|+.+ |.++|+|+|...-. ..+ .|+..|
T Consensus 88 vC~~~C~~~~~~~PVCGsDG~TY~N~C~L~~a~C~~~~~i~v~~~G~C~~~C~~~~C~~g~~C~~d~~~~~~Cv~C~~~C 167 (288)
T 3hh2_C 88 VCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRIC 167 (288)
T ss_dssp EECCCCTTCCCCSCEEETTSCEESSHHHHHHHHHHTCTTCCEEEESSCCBSSTTCCCSTTCEEEECTTSBEEEECCCCCC
T ss_pred eCCccCCCCCCCCceECCCCCEechhhHHHHHHhccCCceEEEeceeeeccccCccCCCCCcccccCCCCcccccCCCCC
Confidence 356788886 79999999999999999999999875 89999999974210 011 366678
Q ss_pred CCCC-CCCCeecCCCcEEecccceecccccC--CcEEEeccCCcccCcccccCCCCCCCeecCCCccccccccccccccC
Q psy14246 134 DQAP-LDGPICGSDGNVYKTNCQMKLLTCGQ--GVVRVSKRHCQTTRHCRESCWRVSKPTCGSDGNIYSNACRMKSKNCG 210 (286)
Q Consensus 134 ~~~~-~~~PVCGsDG~TY~n~C~l~~~~C~~--~~~~~~~g~C~~~~~C~~~C~~~~~PVCGsDG~TY~N~C~l~~~~C~ 210 (286)
+... .+.|||||||+||+|+|+|++++|.. .+.+.+.|+|.....| ..+ +|. .| ..|.+...
T Consensus 168 p~~~~~~~pVCGsDg~TY~n~C~l~~a~C~~~~~i~v~~~G~C~~~~sC----~~~---~C~-~g----~~C~~d~~--- 232 (288)
T 3hh2_C 168 PEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSC----EDI---QCT-GG----KKCLWDFK--- 232 (288)
T ss_dssp CC-----CCEEETTSCEESSHHHHHHHHHHHTSCCCEEEESCCCCCSSG----GGC---CCC-TT----CEEEEETT---
T ss_pred CCccCCCCceECCCCCEEcCHHHHHHHHhcCCCceEEEecCcccccccc----ccc---ccC-CC----Cccccccc---
Confidence 7631 25899999999999999999999985 4677899999754323 221 121 11 12211000
Q ss_pred CceeEeecccccCCcccccCCCCCCC--cCCCcccCCCceecccchhhhhhhcCCCceeEeeeccCC
Q psy14246 211 KHVYVVPIKRCLQGFHFKGCARICPT--IYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQCG 275 (286)
Q Consensus 211 ~~~~~~~~~~C~~~~~~~~C~~~C~~--~~~PVCGsDg~TY~N~C~l~~~~C~~~~~i~v~~~G~C~ 275 (286)
...++|. .|+..||. +++|||||||+||+|+|+|+.++|+++..|+|+|.|+|.
T Consensus 233 -----~g~~~C~------~C~~~Cp~~~~~~pVCgsdg~TY~n~C~l~~a~C~~~~~i~~~~~G~C~ 288 (288)
T 3hh2_C 233 -----VGRGRCS------LCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN 288 (288)
T ss_dssp -----TTEEEEE------CCCCCCC-----CCEEETTSCEESSHHHHHHHHHHHTBCCCEEEESCCC
T ss_pred -----CCCcccc------CCCCCCCCccCCCccCCCCCCEeCCHhHHhHHHhcCCCceEEecCCCCC
Confidence 0112331 47889995 599999999999999999999999999999999999994
|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A | Back alignment and structure |
|---|
| >1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... | Back alignment and structure |
|---|
| >1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A | Back alignment and structure |
|---|
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A | Back alignment and structure |
|---|
| >1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A | Back alignment and structure |
|---|
| >3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} | Back alignment and structure |
|---|
| >3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... | Back alignment and structure |
|---|
| >1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* | Back alignment and structure |
|---|
| >1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A | Back alignment and structure |
|---|
| >1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 | Back alignment and structure |
|---|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A | Back alignment and structure |
|---|
| >1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 | Back alignment and structure |
|---|
| >4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A | Back alignment and structure |
|---|
| >1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A | Back alignment and structure |
|---|
| >3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 286 | ||||
| d2busa_ | 57 | g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B | 9e-09 | |
| d2busa_ | 57 | g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B | 8e-04 | |
| d2busa_ | 57 | g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B | 0.002 | |
| d1h0za_ | 68 | g.68.1.2 (A:) Serine proteinase inhibitor lekti {H | 1e-08 | |
| d1hpta_ | 56 | g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( | 3e-08 | |
| d1hpta_ | 56 | g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( | 0.001 | |
| d1r0ri_ | 51 | g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris | 5e-08 | |
| d1r0ri_ | 51 | g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris | 0.003 | |
| d2erwa1 | 53 | g.68.1.1 (A:4-56) Blood-sucking insect-derived try | 7e-08 | |
| d1pcea_ | 60 | g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta | 7e-08 | |
| d1pcea_ | 60 | g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta | 0.002 | |
| d1z7kb1 | 62 | g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea | 8e-08 | |
| d1z7kb1 | 62 | g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea | 0.001 | |
| d1tgsi_ | 56 | g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su | 1e-07 | |
| d1tgsi_ | 56 | g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su | 0.001 | |
| d1tbrr2 | 52 | g.68.1.1 (R:52-103) Blood-sucking insect-derived t | 1e-07 | |
| d1tbrr2 | 52 | g.68.1.1 (R:52-103) Blood-sucking insect-derived t | 2e-04 | |
| d2f3ci1 | 46 | g.68.1.1 (I:5-50) Blood-sucking insect-derived try | 3e-07 | |
| d2f3ci1 | 46 | g.68.1.1 (I:5-50) Blood-sucking insect-derived try | 9e-04 | |
| d1lr7a2 | 48 | g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra | 2e-05 | |
| d1lr7a2 | 48 | g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra | 0.001 | |
| d1hdla_ | 55 | g.68.1.2 (A:) Serine proteinase inhibitor lekti {H | 3e-04 | |
| d1nuba3 | 58 | g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec | 0.001 | |
| d1ldtl_ | 46 | g.68.1.1 (L:) Leech derived tryptase inhibitor (LD | 0.002 |
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 | Back information, alignment and structure |
|---|
class: Small proteins fold: Kazal-type serine protease inhibitors superfamily: Kazal-type serine protease inhibitors family: Ovomucoid domain III-like domain: Seminal plasma inhibitor IIa species: Cow (Bos taurus) [TaxId: 9913]
Score = 48.8 bits (116), Expect = 9e-09
Identities = 13/49 (26%), Positives = 21/49 (42%)
Query: 226 HFKGCARICPTIYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQC 274
FK C +P CG++ +TY N C +S + + G+C
Sbjct: 9 EFKDPKVYCTRESNPHCGSNGETYGNKCAFCKAVMKSGGKINLKHRGKC 57
|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 | Back information, alignment and structure |
|---|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 | Back information, alignment and structure |
|---|
| >d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Length = 46 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d1tbrr2 | 52 | Blood-sucking insect-derived tryptase inhibitor {B | 99.59 | |
| d2erwa1 | 53 | Blood-sucking insect-derived tryptase inhibitor {T | 99.58 | |
| d2busa_ | 57 | Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta | 99.57 | |
| d1r0ri_ | 51 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.56 | |
| d2f3ci1 | 46 | Blood-sucking insect-derived tryptase inhibitor {T | 99.55 | |
| d1tgsi_ | 56 | Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax | 99.54 | |
| d1hpta_ | 56 | Secretory trypsin inhibitor {Human (Homo sapiens) | 99.53 | |
| d1lr7a2 | 48 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 99.53 | |
| d1pcea_ | 60 | PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | 99.49 | |
| d1z7kb1 | 62 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.48 | |
| d1nuba3 | 58 | Domain of BM-40/SPARC/osteonectin {Human (Homo sap | 99.42 | |
| d1tbrr2 | 52 | Blood-sucking insect-derived tryptase inhibitor {B | 99.4 | |
| d1tgsi_ | 56 | Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax | 99.39 | |
| d2erwa1 | 53 | Blood-sucking insect-derived tryptase inhibitor {T | 99.39 | |
| d2busa_ | 57 | Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta | 99.38 | |
| d1lr7a2 | 48 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 99.38 | |
| d1hpta_ | 56 | Secretory trypsin inhibitor {Human (Homo sapiens) | 99.37 | |
| d2f3ci1 | 46 | Blood-sucking insect-derived tryptase inhibitor {T | 99.36 | |
| d1r0ri_ | 51 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.34 | |
| d1pcea_ | 60 | PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | 99.32 | |
| d1z7kb1 | 62 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.27 | |
| d1nuba3 | 58 | Domain of BM-40/SPARC/osteonectin {Human (Homo sap | 99.25 | |
| d1h0za_ | 68 | Serine proteinase inhibitor lekti {Human (Homo sap | 99.2 | |
| d1ldtl_ | 46 | Leech derived tryptase inhibitor (LDTI-C) {Medicin | 99.17 | |
| d1ldtl_ | 46 | Leech derived tryptase inhibitor (LDTI-C) {Medicin | 98.9 | |
| d1h0za_ | 68 | Serine proteinase inhibitor lekti {Human (Homo sap | 98.83 | |
| d1hdla_ | 55 | Serine proteinase inhibitor lekti {Human (Homo sap | 98.36 | |
| d1hdla_ | 55 | Serine proteinase inhibitor lekti {Human (Homo sap | 98.28 |
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Kazal-type serine protease inhibitors superfamily: Kazal-type serine protease inhibitors family: Ovomucoid domain III-like domain: Blood-sucking insect-derived tryptase inhibitor species: Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]
Probab=99.59 E-value=3.1e-16 Score=104.47 Aligned_cols=49 Identities=31% Similarity=0.594 Sum_probs=45.7
Q ss_pred ccCCCCCCCcCCCcccCCCceecccchhhhhhhcCCCceeEeeeccCCC
Q psy14246 228 KGCARICPTIYDPICGTDNKTYSNDCFLQMENCRSRSLVQKLYHGQCGQ 276 (286)
Q Consensus 228 ~~C~~~C~~~~~PVCGsDg~TY~N~C~l~~~~C~~~~~i~v~~~G~C~~ 276 (286)
..|+..|+..|+|||||||+||.|+|+|+.++|+.+..|+|+|.|+|..
T Consensus 4 ~vC~~~c~~~~~PVCGsDg~TY~n~C~l~~~~C~~~~~i~v~~~G~C~s 52 (52)
T d1tbrr2 4 DVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT 52 (52)
T ss_dssp CTTGGGTTCCCCCEEETTTEEESSHHHHHHHTTTTSTTCCEEEESSCCC
T ss_pred ccCCCCCccCCcccCCCCCCEecCHhHHHHHHhcCCCceEEeecccCCC
Confidence 3578889999999999999999999999999999999999999999963
|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} | Back information, alignment and structure |
|---|
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|