Psyllid ID: psy14250

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYVQTSIP
cccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccccccc
ccEEEcEEEcccEEEEcccccccccEEEEEccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEEHHHHHHHHcccccccccccccccc
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLgavhdgsppptylggpgaekcrwedgfimsdlrhtekgfkwspcsvssfhhflngdtatclfnsphedeslprvlpgkllsldaqcrkdrgtsacFIRYVQTSIP
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAqcrkdrgtsaCFIRYVQTSIP
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYVQTSIP
****HSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNS********RVLPGKLLSLDAQCRKDRGTSACFIRYVQ****
*PVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLG********W*DGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYV*****
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYVQTSIP
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYVQTSIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRVLPGKLLSLDAQCRKDRGTSACFIRYVQTSIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q8TE57 1224 A disintegrin and metallo yes N/A 0.792 0.099 0.354 2e-11
Q9UP79 889 A disintegrin and metallo no N/A 0.785 0.136 0.357 2e-11
Q8BNJ2 833 A disintegrin and metallo yes N/A 0.792 0.146 0.330 4e-11
Q8TE60 1221 A disintegrin and metallo no N/A 0.837 0.105 0.346 1e-10
Q9ESP7 630 A disintegrin and metallo no N/A 0.720 0.176 0.344 1e-10
Q4VC17 1219 A disintegrin and metallo no N/A 0.792 0.100 0.361 2e-10
O75173 837 A disintegrin and metallo no N/A 0.792 0.145 0.338 2e-10
Q5RFQ8 837 A disintegrin and metallo no N/A 0.792 0.145 0.338 3e-10
Q69Z28 1222 A disintegrin and metallo no N/A 0.792 0.099 0.340 4e-10
Q9TT93 839 A disintegrin and metallo no N/A 0.792 0.145 0.338 7e-10
>sp|Q8TE57|ATS16_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Homo sapiens GN=ADAMTS16 PE=2 SV=3 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 63/144 (43%), Gaps = 22/144 (15%)

Query: 4   THSFAYVGGACVVNKRLEKVNSVAIIEDTG-GFSGIIVAAHEVGHLLGAVHDGSPPPTYL 62
           T  FA + G C       K  S  I EDTG G +  I  AHE GH  G +HDG       
Sbjct: 401 TLGFAPISGMC------SKYRSCTINEDTGLGLAFTI--AHESGHNFGMIHDGE------ 446

Query: 63  GGPGAEKCRWEDGFIMSDLRHTEKG-FKWSPCSVSSFHHFLNGDTATCLFNSPH--EDES 119
                  C+  +G IMS       G F WSPCS    H FL+   A CL + P   ++  
Sbjct: 447 ----GNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQYLHKFLSTAQAICLADQPKPVKEYK 502

Query: 120 LPRVLPGKLLSLDAQCRKDRGTSA 143
            P  LPG+L   + QC+   G  A
Sbjct: 503 YPEKLPGELYDANTQCKWQFGEKA 526

Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q9UP79|ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens GN=ADAMTS8 PE=2 SV=2 Back     alignment and function description
>sp|Q8BNJ2|ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus GN=Adamts4 PE=2 SV=2 Back     alignment and function description
>sp|Q8TE60|ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens GN=ADAMTS18 PE=1 SV=3 Back     alignment and function description
>sp|Q9ESP7|ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus GN=Adamts4 PE=2 SV=2 Back     alignment and function description
>sp|Q4VC17|ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus GN=Adamts18 PE=2 SV=2 Back     alignment and function description
>sp|O75173|ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens GN=ADAMTS4 PE=1 SV=3 Back     alignment and function description
>sp|Q5RFQ8|ATS4_PONAB A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Pongo abelii GN=ADAMTS4 PE=2 SV=1 Back     alignment and function description
>sp|Q69Z28|ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus GN=Adamts16 PE=2 SV=2 Back     alignment and function description
>sp|Q9TT93|ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus GN=ADAMTS4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
242017921 916 conserved hypothetical protein [Pediculu 0.922 0.155 0.964 8e-78
322790200 1246 hypothetical protein SINV_03225 [Solenop 0.805 0.099 0.924 4e-77
328706357 595 PREDICTED: A disintegrin and metalloprot 0.922 0.238 0.957 8e-77
328706355 782 PREDICTED: A disintegrin and metalloprot 0.922 0.181 0.957 9e-77
357628561 837 A disintegrin and metalloproteinase with 0.922 0.169 0.936 1e-76
112983064 693 A disintegrin and metalloproteinase with 0.922 0.204 0.936 2e-76
340728819 768 PREDICTED: A disintegrin and metalloprot 0.922 0.184 0.943 4e-76
380013200 768 PREDICTED: A disintegrin and metalloprot 0.922 0.184 0.943 6e-76
110748908 767 PREDICTED: A disintegrin and metalloprot 0.922 0.185 0.943 6e-76
350402806 764 PREDICTED: A disintegrin and metalloprot 0.922 0.185 0.943 6e-76
>gi|242017921|ref|XP_002429432.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514364|gb|EEB16694.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 139/142 (97%)

Query: 4   THSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLG 63
           T  FAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPP+YLG
Sbjct: 438 TAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLG 497

Query: 64  GPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRV 123
           GPGAEKCRWEDGFIMSDLRHTEKGFKWS CSV+SFHHFLNGDTATCLFNSPHEDESLPRV
Sbjct: 498 GPGAEKCRWEDGFIMSDLRHTEKGFKWSSCSVASFHHFLNGDTATCLFNSPHEDESLPRV 557

Query: 124 LPGKLLSLDAQCRKDRGTSACF 145
           LPGKLLSLDAQCRKDRGTSACF
Sbjct: 558 LPGKLLSLDAQCRKDRGTSACF 579

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322790200|gb|EFZ15199.1| hypothetical protein SINV_03225 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328706357|ref|XP_001949655.2| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 16-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706355|ref|XP_003243066.1| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 16-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357628561|gb|EHJ77852.1| A disintegrin and metalloproteinase with thrombospondin motifs like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|112983064|ref|NP_001036935.1| A disintegrin and metalloproteinase with thrombospondin motifs like precursor [Bombyx mori] gi|55416036|dbj|BAD69560.1| A disintegrin and metalloproteinase with thrombospondin motifs like [Bombyx mori] Back     alignment and taxonomy information
>gi|340728819|ref|XP_003402711.1| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380013200|ref|XP_003690654.1| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 3-like [Apis florea] Back     alignment and taxonomy information
>gi|110748908|ref|XP_392978.3| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350402806|ref|XP_003486610.1| PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 3-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0034903 1102 CG9850 [Drosophila melanogaste 0.922 0.128 0.859 3.5e-66
MGI|MGI:1339949 833 Adamts4 "a disintegrin-like an 0.831 0.153 0.340 3.8e-12
UNIPROTKB|F1N7N4 1072 ADAMTS16 "Uncharacterized prot 0.792 0.113 0.368 5.3e-12
UNIPROTKB|F1S1A7 836 ADAMTS4 "Uncharacterized prote 0.779 0.143 0.344 6.2e-12
UNIPROTKB|F1NL57 639 ADAMTS8 "Uncharacterized prote 0.779 0.187 0.343 6.8e-12
UNIPROTKB|Q2XQZ0570 ADAMTS16 "A disintegrin and me 0.824 0.222 0.344 7.3e-12
ZFIN|ZDB-GENE-070815-1 1244 adamts18 "ADAM metallopeptidas 0.837 0.103 0.359 8.1e-12
RGD|621242 630 Adamts4 "ADAM metallopeptidase 0.831 0.203 0.333 1.1e-11
UNIPROTKB|F1PP07 1114 ADAMTS16 "Uncharacterized prot 0.824 0.114 0.350 1.5e-11
UNIPROTKB|Q8TE57 1224 ADAMTS16 "A disintegrin and me 0.824 0.103 0.344 2.1e-11
FB|FBgn0034903 CG9850 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 680 (244.4 bits), Expect = 3.5e-66, P = 3.5e-66
 Identities = 122/142 (85%), Positives = 132/142 (92%)

Query:     4 THSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLG 63
             T  FAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPP+YLG
Sbjct:   435 TAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLG 494

Query:    64 GPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRV 123
             GPGA++CRWEDG+IMSDLRHTE+GF+WS C+V SFHHFLNGDTATCL N+PHED +L R 
Sbjct:   495 GPGAQRCRWEDGYIMSDLRHTERGFRWSACTVQSFHHFLNGDTATCLHNAPHEDSALGRS 554

Query:   124 LPGKLLSLDAQCRKDRGTSACF 145
             LPG LLSLDAQCR+DRGT ACF
Sbjct:   555 LPGTLLSLDAQCRRDRGTYACF 576
GO:0005575 "cellular_component" evidence=ND
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008283 "cell proliferation" evidence=NAS
MGI|MGI:1339949 Adamts4 "a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7N4 ADAMTS16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1A7 ADAMTS4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL57 ADAMTS8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2XQZ0 ADAMTS16 "A disintegrin and metalloproteinase with thrombospondin motifs 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070815-1 adamts18 "ADAM metallopeptidase with thrombospondin type 1 motif, 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|621242 Adamts4 "ADAM metallopeptidase with thrombospondin type 1 motif, 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP07 ADAMTS16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TE57 ADAMTS16 "A disintegrin and metalloproteinase with thrombospondin motifs 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
cd04272220 cd04272, ZnMc_salivary_gland_MPs, Zinc-dependent m 2e-42
cd04273207 cd04273, ZnMc_ADAMTS_like, Zinc-dependent metallop 1e-19
cd04267192 cd04267, ZnMc_ADAM_like, Zinc-dependent metallopro 1e-12
pfam01421198 pfam01421, Reprolysin, Reprolysin (M12B) family zi 6e-11
cd04269194 cd04269, ZnMc_adamalysin_II_like, Zinc-dependent m 1e-09
pfam13582123 pfam13582, Reprolysin_3, Metallo-peptidase family 9e-08
pfam13583195 pfam13583, Reprolysin_4, Metallo-peptidase family 2e-07
pfam13574173 pfam13574, Reprolysin_2, Metallo-peptidase family 1e-06
pfam13688193 pfam13688, Peptidase_M84, Metallo-peptidase family 4e-05
cd00203167 cd00203, ZnMc, Zinc-dependent metalloprotease 9e-05
cd04270244 cd04270, ZnMc_TACE_like, Zinc-dependent metallopro 8e-04
cd04271228 cd04271, ZnMc_ADAM_fungal, Zinc-dependent metallop 0.004
>gnl|CDD|239800 cd04272, ZnMc_salivary_gland_MPs, Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information 
 Score =  139 bits (353), Expect = 2e-42
 Identities = 47/110 (42%), Positives = 66/110 (60%), Gaps = 9/110 (8%)

Query: 3   VTHSFAYVGGACVVNKRLEKVNSVAIIEDTGG-FSGIIVAAHEVGHLLGAVHDGSPPPTY 61
            T  +AYVGGAC  N        VA+ EDT G + G+    HE+ HLLGA HDGSPPP++
Sbjct: 117 GTGGYAYVGGACTEN-------RVAMGEDTPGSYYGVYTMTHELAHLLGAPHDGSPPPSW 169

Query: 62  LGG-PGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCL 110
           + G PG+  C W+DG+IMS + + E+ +++S CS     +      A+CL
Sbjct: 170 VKGHPGSLDCPWDDGYIMSYVVNGERQYRFSQCSQRQIRNVFRRLGASCL 219

Metalloproteases secreted by the salivary glands of arthropods. Length = 220
>gnl|CDD|239801 cd04273, ZnMc_ADAMTS_like, Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>gnl|CDD|239795 cd04267, ZnMc_ADAM_like, Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>gnl|CDD|216491 pfam01421, Reprolysin, Reprolysin (M12B) family zinc metalloprotease Back     alignment and domain information
>gnl|CDD|239797 cd04269, ZnMc_adamalysin_II_like, Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>gnl|CDD|222240 pfam13582, Reprolysin_3, Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>gnl|CDD|222241 pfam13583, Reprolysin_4, Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>gnl|CDD|222233 pfam13574, Reprolysin_2, Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>gnl|CDD|222320 pfam13688, Peptidase_M84, Metallo-peptidase family M84 Back     alignment and domain information
>gnl|CDD|238124 cd00203, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239798 cd04270, ZnMc_TACE_like, Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>gnl|CDD|239799 cd04271, ZnMc_ADAM_fungal, Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 99.93
KOG3607|consensus 716 99.93
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 99.92
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 99.92
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 99.92
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 99.91
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 99.87
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 99.87
KOG3658|consensus 764 99.86
KOG3538|consensus 845 99.79
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 99.78
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.56
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 99.51
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 99.46
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 98.85
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 97.92
PRK13267179 archaemetzincin-like protein; Reviewed 97.7
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 97.68
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 97.38
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 97.34
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 97.27
COG1913181 Predicted Zn-dependent proteases [General function 97.16
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 97.01
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 96.64
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 96.57
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 96.42
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 96.32
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 96.24
PF05548314 Peptidase_M11: Gametolysin peptidase M11; InterPro 96.21
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 96.11
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 96.08
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 95.9
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 95.74
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 95.73
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 95.56
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 95.43
KOG3714|consensus 411 95.3
KOG1565|consensus 469 94.91
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 94.71
TIGR03296286 M6dom_TIGR03296 M6 family metalloprotease domain. 93.87
COG3824136 Predicted Zn-dependent protease [General function 90.48
PF12725318 DUF3810: Protein of unknown function (DUF3810); In 90.47
PF12044423 Metallopep: Putative peptidase family; InterPro: I 90.04
PF06114122 DUF955: Domain of unknown function (DUF955); Inter 89.35
COG2856213 Predicted Zn peptidase [Amino acid transport and m 87.17
TIGR0223238 myxo_disulf_rpt Myxococcus cysteine-rich repeat. T 86.54
PF0626297 DUF1025: Possibl zinc metallo-peptidase; InterPro: 85.3
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 84.96
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 82.63
KOG4525|consensus 614 82.6
COG4783 484 Putative Zn-dependent protease, contains TPR repea 82.4
TIGR00181591 pepF oligoendopeptidase F. This family represents 81.02
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information 
Probab=99.93  E-value=1.9e-26  Score=179.65  Aligned_cols=103  Identities=46%  Similarity=0.858  Sum_probs=88.1

Q ss_pred             CceeeeeccCCcccCCccCCccceEEEEeeCCC-ccchhhhHHhhhhhcCCCCCCCCCC-CCCCCCCCCCCCCCCCceec
Q psy14250          2 PVTHSFAYVGGACVVNKRLEKVNSVAIIEDTGG-FSGIIVAAHEVGHLLGAVHDGSPPP-TYLGGPGAEKCRWEDGFIMS   79 (154)
Q Consensus         2 ~~~~G~A~~g~~C~~~~~~~~~~s~~i~~~~~~-~~~a~~~AHElGH~lG~~HD~~~~~-~~~~~~~~~~C~~~~~~IMs   79 (154)
                      ..+.|+||+|++|+..       +++++++.+. +.++.++||||||+|||.||++..+ .+.+++++..|+++++|||+
T Consensus       116 ~~~~G~A~~g~~C~~~-------~~~~~~d~~~~~~~~~~~AHElGH~lG~~HD~~~~~~~~~~~~~~~~C~~~~~~IM~  188 (220)
T cd04272         116 TGTGGYAYVGGACTEN-------RVAMGEDTPGSYYGVYTMTHELAHLLGAPHDGSPPPSWVKGHPGSLDCPWDDGYIMS  188 (220)
T ss_pred             cCccceEeecCccCCC-------ceeEeecCCCCcccHHHHHHHHHHHhCCCCCCCCCCccCCCCCccCcCCCCCCeEEe
Confidence            3567999999999954       5788888753 6779999999999999999998755 35667888999988899999


Q ss_pred             cCCCCCCCCccccCcHHHHHhhhcCCCCcccc
Q psy14250         80 DLRHTEKGFKWSPCSVSSFHHFLNGDTATCLF  111 (154)
Q Consensus        80 ~~~~~~~~~~fS~CS~~~i~~~l~~~~~~CL~  111 (154)
                      +.....+++.||+||+++|++||.+..+.||.
T Consensus       189 ~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~  220 (220)
T cd04272         189 YVVNGERQYRFSQCSQRQIRNVFRRLGASCLH  220 (220)
T ss_pred             eccCCCCCCccCcchHHHHHHHHcCCCccccC
Confidence            97655677899999999999999998899984

Metalloproteases secreted by the salivary glands of arthropods.
>KOG3607|consensus Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>KOG3658|consensus Back     alignment and domain information
>KOG3538|consensus Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>KOG3714|consensus Back     alignment and domain information
>KOG1565|consensus Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>COG3824 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF06114 DUF955: Domain of unknown function (DUF955); InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function Back     alignment and domain information
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02232 myxo_disulf_rpt Myxococcus cysteine-rich repeat Back     alignment and domain information
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4525|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00181 pepF oligoendopeptidase F Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2rjp_A316 Crystal Structure Of Adamts4 With Inhibitor Bound L 3e-11
2jih_A300 Crystal Structure Of Human Adamts-1 Catalytic Domai 2e-08
3q2g_A297 Adamts1 In Complex With A Novel N-Hydroxyformamide 2e-08
2rjq_A 378 Crystal Structure Of Adamts5 With Inhibitor Bound L 3e-08
1kuf_A203 High-Resolution Crystal Structure Of A Snake Venom 4e-06
3b8z_A217 High Resolution Crystal Structure Of The Catalytic 7e-06
3ljt_A218 Crystal Structure Of The Catalytic Domain Of Adamts 7e-06
3hy7_A221 Crystal Structure Of The Catalytic Domain Of Adamts 8e-06
3k7l_A 422 Structures Of Two Elapid Snake Venom Metalloproteas 1e-05
3k7n_A 397 Structures Of Two Elapid Snake Venom Metalloproteas 1e-05
1kug_A203 Crystal Structure Of A Taiwan Habu Venom Metallopro 2e-05
1wni_A201 Crystal Structure Of H2-Proteinase Length = 201 6e-05
2e3x_A 427 Crystal Structure Of Russell's Viper Venom Metallop 2e-04
1nd1_A202 Amino Acid Sequence And Crystal Structure Of Bap1, 8e-04
>pdb|2RJP|A Chain A, Crystal Structure Of Adamts4 With Inhibitor Bound Length = 316 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 57/133 (42%), Gaps = 11/133 (8%)
Query: 4   THSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLG 63
           T   A VG  C      +   S AI+ED G       AAH++GH+   +HD S P   L 
Sbjct: 117 TLGMADVGTVC------DPARSCAIVEDDG-LQSAFTAAHQLGHVFNMLHDNSKPCISLN 169
Query: 64  GPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPRV 123
           GP +   R     +M+   H +    WSPCS      FL+     CL + P     LP  
Sbjct: 170 GPLSTS-RHVMAPVMA---HVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVT 225
Query: 124 LPGKLLSLDAQCR 136
            PGK    D QC+
Sbjct: 226 FPGKDYDADRQCQ 238
>pdb|2JIH|A Chain A, Crystal Structure Of Human Adamts-1 Catalytic Domain And Cysteine-rich Domain (complex-form) Length = 300 Back     alignment and structure
>pdb|3Q2G|A Chain A, Adamts1 In Complex With A Novel N-Hydroxyformamide Inhibitors Length = 297 Back     alignment and structure
>pdb|2RJQ|A Chain A, Crystal Structure Of Adamts5 With Inhibitor Bound Length = 378 Back     alignment and structure
>pdb|1KUF|A Chain A, High-Resolution Crystal Structure Of A Snake Venom Metalloproteinase From Taiwan Habu Length = 203 Back     alignment and structure
>pdb|3B8Z|A Chain A, High Resolution Crystal Structure Of The Catalytic Domain Of Adamts-5 (Aggrecanase-2) Length = 217 Back     alignment and structure
>pdb|3LJT|A Chain A, Crystal Structure Of The Catalytic Domain Of Adamts-5 In Complex With An Amino-2-Indanol Compound Length = 218 Back     alignment and structure
>pdb|3HY7|A Chain A, Crystal Structure Of The Catalytic Domain Of Adamts-5 In Complex With Marimastat Length = 221 Back     alignment and structure
>pdb|3K7L|A Chain A, Structures Of Two Elapid Snake Venom Metalloproteases With Distinct Activities Highlight The Disulfide Patterns In The D Domain Of Adamalysin Family Proteins Length = 422 Back     alignment and structure
>pdb|3K7N|A Chain A, Structures Of Two Elapid Snake Venom Metalloproteases With Distinct Activities Highlight The Disulfide Patterns In The D Domain Of Adamalysin Family Proteins Length = 397 Back     alignment and structure
>pdb|1KUG|A Chain A, Crystal Structure Of A Taiwan Habu Venom Metalloproteinase Complexed With Its Endogenous Inhibitor Penw Length = 203 Back     alignment and structure
>pdb|1WNI|A Chain A, Crystal Structure Of H2-Proteinase Length = 201 Back     alignment and structure
>pdb|2E3X|A Chain A, Crystal Structure Of Russell's Viper Venom Metalloproteinase Length = 427 Back     alignment and structure
>pdb|1ND1|A Chain A, Amino Acid Sequence And Crystal Structure Of Bap1, A Metalloproteinase From Bothrops Asper Snake Venom That Exerts Multiple Tissue-Damaging Activities Length = 202 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2v4b_A300 Adamts-1; zymogen, protease, hydrolase, metallopro 2e-30
2rjp_A316 Adamts-4; metalloprotease domain, aggrecanase, cle 3e-30
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 3e-27
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 5e-24
4dd8_A208 Disintegrin and metalloproteinase domain-containi 1e-17
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 1e-17
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 2e-17
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 5e-17
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 5e-17
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 6e-17
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 6e-16
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 2e-15
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 1e-12
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 2e-12
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 6e-12
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 7e-12
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 2e-11
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 6e-11
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 2e-10
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 2e-09
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Length = 300 Back     alignment and structure
 Score =  110 bits (276), Expect = 2e-30
 Identities = 38/134 (28%), Positives = 54/134 (40%), Gaps = 14/134 (10%)

Query: 4   THSFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPTYLG 63
           T   A VG  C      +   S ++IED G  +    A HE+GH+    HD +     L 
Sbjct: 117 TLGMADVGTVC------DPSRSCSVIEDDGLQAAFTTA-HELGHVFNMPHDDAKQCASLN 169

Query: 64  GPGAEKCRWEDGFIMSD-LRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHEDESLPR 122
           G   +        +M+  L + +    WSPCS      FL+     CL + P     LP 
Sbjct: 170 GVNQDSH------MMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPG 223

Query: 123 VLPGKLLSLDAQCR 136
            LPG     + QC+
Sbjct: 224 DLPGTSYDANRQCQ 237
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Length = 316 Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Length = 378 Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Length = 217 Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Length = 208 Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Length = 203 Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Length = 214 Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Length = 202 Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Length = 202 Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Length = 202 Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Length = 197 Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Length = 197 Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 427 Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Length = 427 Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Length = 419 Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Length = 397 Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Length = 288 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Length = 510 Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Length = 422 Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 99.97
2v4b_A300 Adamts-1; zymogen, protease, hydrolase, metallopro 99.97
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 99.97
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 99.97
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 99.97
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 99.97
2rjp_A316 Adamts-4; metalloprotease domain, aggrecanase, cle 99.97
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 99.97
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 99.97
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 99.96
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 99.94
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 99.93
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 99.93
4dd8_A208 Disintegrin and metalloproteinase domain-containi 99.93
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 99.93
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 99.93
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 99.93
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 99.92
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 99.92
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 99.87
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 99.03
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 98.77
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 98.62
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 98.14
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 97.8
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 97.67
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 97.59
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 97.5
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 97.5
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 97.42
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 97.4
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 97.38
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 97.34
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 97.29
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 97.21
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 97.19
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 97.06
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 96.99
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 96.93
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 96.82
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 96.67
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 96.3
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 96.04
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 96.01
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 95.58
1sat_A 471 Serratia protease; parallel beta helix, parallel b 95.49
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 95.4
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 95.36
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 95.35
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 95.01
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 94.91
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 93.94
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 92.78
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 88.71
3cqb_A107 Probable protease HTPX homolog; heat shock protein 86.56
3e11_A114 Predicted zincin-like metalloprotease; DUF1025 fam 83.33
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
Probab=99.97  E-value=4.3e-32  Score=228.43  Aligned_cols=122  Identities=25%  Similarity=0.535  Sum_probs=104.4

Q ss_pred             ceeeeeccCCcccCCccCCccceEEEEeeCC--CccchhhhHHhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCceecc
Q psy14250          3 VTHSFAYVGGACVVNKRLEKVNSVAIIEDTG--GFSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSD   80 (154)
Q Consensus         3 ~~~G~A~~g~~C~~~~~~~~~~s~~i~~~~~--~~~~a~~~AHElGH~lG~~HD~~~~~~~~~~~~~~~C~~~~~~IMs~   80 (154)
                      .++|+||+|+||++.+      +++|+++.+  .+..|.+|||||||+|||.||...          +.|. .+.|||++
T Consensus       109 ~t~GlA~vg~~C~~~~------s~gi~~d~~~~~~~~a~t~AHElGHnlGm~HD~~~----------c~C~-~~~cIM~~  171 (427)
T 2e3x_A          109 NTLGITFLAGMCQAYR------SVGIVQEQGNRNFKTAVIMAHELSHNLGMYHDGKN----------CICN-DSSCVMSP  171 (427)
T ss_dssp             GCCEEECTTCTTCTTT------SEEEEECCTTCHHHHHHHHHHHHHHTTTCCCCCTT----------CCCT-TSSCTTCS
T ss_pred             ceeeEeeecccCCCCc------ceEEEEeCCCccceeeeehHHHHHHhhCCccCCCC----------CcCC-CCCcEECC
Confidence            5789999999999974      689999875  356789999999999999999986          5675 47899999


Q ss_pred             CCCCCCCCccccCcHHHHHhhhcCCCCcccccCCCCC-CCCCCCCCCeEECcccccccccCC
Q psy14250         81 LRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSPHED-ESLPRVLPGKLLSLDAQCRKDRGT  141 (154)
Q Consensus        81 ~~~~~~~~~fS~CS~~~i~~~l~~~~~~CL~~~p~~~-~~~~~~cgn~~~e~~eqCd~~~g~  141 (154)
                      .....+++.||+||+++|.+||.++.+.||.+.|... ....++|||++||++|||||.+..
T Consensus       172 ~~~~~~~~~FS~CS~~~i~~~l~~~~~~CL~n~P~~~~~~~~~~CGN~~ve~gEeCDCG~~~  233 (427)
T 2e3x_A          172 VLSDQPSKLFSNCSIHDYQRYLTRYKPKCIFNPPLRKDIVSPPVCGNEIWEEGEECDCGSPA  233 (427)
T ss_dssp             SCCSSCCSCCCHHHHHHHHHHHHHHCCSTTSSCCCGGGCCSCCCTTSSCCCTTCSCCCCCST
T ss_pred             cccCCCCcccCcccHHHHHhhhccCCCCcccCCCCcccccccccCCCceecCCeeecCCChh
Confidence            7655678899999999999999987889999998664 334689999999999999997654
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure
>3cqb_A Probable protease HTPX homolog; heat shock protein HTPX domain, PSI-2, protein structure INI structural genomics; HET: MSE; 1.86A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1kufa_201 d.92.1.9 (A:) Snake venom metalloprotease {Taiwan 5e-19
d1bswa_197 d.92.1.9 (A:) Snake venom metalloprotease {Five-pa 4e-18
d1r55a_203 d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 8e-18
d1quaa_197 d.92.1.9 (A:) Snake venom metalloprotease {Chinese 1e-16
d1atla_200 d.92.1.9 (A:) Snake venom metalloprotease {Western 2e-16
d1nd1a_202 d.92.1.9 (A:) Snake venom metalloprotease {Terciop 3e-16
d2i47a1254 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, 6e-13
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Reprolysin-like
domain: Snake venom metalloprotease
species: Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]

 Score = 77.5 bits (190), Expect = 5e-19
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 20/113 (17%)

Query: 4   THSFAYVGGACVVNKRLEKVNSVAIIEDTGG--FSGIIVAAHEVGHLLGAVHDGSPPPTY 61
           T  +AYVG  C      ++  SVA+++D     F   +   HE+GH LG  HD       
Sbjct: 107 TIGWAYVGRMC------DEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGMEHDD------ 154

Query: 62  LGGPGAEKCRWEDGFIMSDLRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSP 114
                 +KC+  D  IMS +   ++   +S CS   +  FL  D   C+ N+P
Sbjct: 155 -----KDKCKC-DTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAP 201
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Length = 197 Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Length = 197 Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Length = 200 Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Length = 202 Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 99.93
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 99.93
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 99.93
d1atla_200 Snake venom metalloprotease {Western diamonback ra 99.92
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 99.9
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 99.84
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 97.73
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 97.68
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 97.66
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 97.6
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 97.55
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 97.51
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 97.49
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 97.45
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 97.4
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 97.36
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 97.22
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 96.64
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 96.58
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 96.52
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 96.49
d1asta_200 Astacin {European fresh water crayfish (Astacus as 95.83
d3e11a1113 Uncharacterized protein Acel_2062 {Acidothermus ce 87.15
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Reprolysin-like
domain: ADAM33
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=7.2e-27  Score=176.26  Aligned_cols=99  Identities=26%  Similarity=0.367  Sum_probs=81.3

Q ss_pred             ceeeeeccCCcccCCccCCccceEEEEeeCCC--ccchhhhHHhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCceecc
Q psy14250          3 VTHSFAYVGGACVVNKRLEKVNSVAIIEDTGG--FSGIIVAAHEVGHLLGAVHDGSPPPTYLGGPGAEKCRWEDGFIMSD   80 (154)
Q Consensus         3 ~~~G~A~~g~~C~~~~~~~~~~s~~i~~~~~~--~~~a~~~AHElGH~lG~~HD~~~~~~~~~~~~~~~C~~~~~~IMs~   80 (154)
                      .++|+||+|++|++.+      ++++.++.+.  +..|.++||||||+|||.||.+.+++.      +.| +.++|||++
T Consensus       102 ~~~G~A~~g~~C~~~~------~~~i~~~~~~~~~~~a~v~AHElGH~lG~~HD~~~~~~~------~~~-~~~~~IM~~  168 (203)
T d1r55a_         102 ATVGLAPVEGMCRAES------SGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGCCVE------AAA-ESGGCVMAA  168 (203)
T ss_dssp             GCCEECCTTCTTCTTT------CEEEEECCSSSHHHHHHHHHHHHHHHTTCCCCCTTCCCS------SCG-GGTCBTTCS
T ss_pred             CceeeecCCCcCCCCc------ceEEEEeCCCchhHHHHHHHHHHHHhcCCccCCCCcccc------CCC-CCCCEeccc
Confidence            4679999999999874      6888888763  346789999999999999999875311      123 257899998


Q ss_pred             CCCCCCCCccccCcHHHHHhhhcCCCCcccccCC
Q psy14250         81 LRHTEKGFKWSPCSVSSFHHFLNGDTATCLFNSP  114 (154)
Q Consensus        81 ~~~~~~~~~fS~CS~~~i~~~l~~~~~~CL~~~p  114 (154)
                      ..+...++.||+||+++|.+||.++.+.||.|.|
T Consensus       169 ~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~n~P  202 (203)
T d1r55a_         169 ATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAP  202 (203)
T ss_dssp             SCCSSCCCBCCHHHHHHHHHHHHTTTTGGGGSCC
T ss_pred             ccCCCCCCCcCHhHHHHHHHHHhcCCCCcCCCCC
Confidence            7665677899999999999999998899999988
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure