Psyllid ID: psy14266

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MEQRSKNDGRSISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
cccccccccccccccccccccccccccccccccHHHHEEccccccccccccccccEEEccccEEEEEcccHHcccccccccccccccccccccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccccEEEEEccccccHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccccEEEccccEEEccccEEEEccccccccccccccc
cHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEcccEEEEEcHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHcccHHcEccccEEccccccccHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHccccEccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccEEEccccEEccHHHHHccccccccccHccccHHccHHHHHHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccEcccccEEEccccEEEEEEEHHcccccHcccc
meqrskndgrsisavplmhepkpvplmhepklsfqvrdfnnskksdnypsrynrqrcfavIPVLVLADSEIIKHVLIkdfdvftdrgffeanetdepimrnlfgltgdEWRKMrnkmsptftsgkikemfplmescGRNVVSILTKYINKKNESIDVKEYLGRYMTdligstvfgmeinalenpdcefRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLsyreqnnikrNDFINIMMELrkndpditEELITAQCFLFFiagfdtsstvLTFSLYELAKNKSIQSTLRKEINDTkakyggeltYESLILDWIILSSIVILLYYLKTIFISYQYwksrnvpflrptfpfgnvyeaitmqrpthfvYQDIYMEIKfglkspfagifttttpvlvLADSEIIKHVLikdfdvftdrdITEELITAQCFVFFIagfdtsstvLTFSLYELAKNKSIQSTLRKEINDTkakyggeltyesydemplLDRVIKESLRmytplgqldritgrsyqlpntdividkgtkmfiplyglhhdpeiyptl
meqrskndgrsisavplmhepkpvpLMHEPKLSFQVRDFNNSKKsdnypsrynrqrCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFeanetdepimrnlfgltgdewrKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKyinkknesidVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNlsyreqnnikrNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELaknksiqstlRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELaknksiqstlrkeindtkakyggeltyesydemPLLDRVIKESLRMYTPLgqldritgrsyqlpNTDIVIDKGTKMFIPLYglhhdpeiyptl
MEQRSKNDGRSISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYEslildwiilssivillYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
***************************************************YNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMR*****TFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDP******
*EQRSKNDGRSISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKD***FTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
**********SISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
MEQRSKNDGRSISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQRSKNDGRSISAVPLMHEPKPVPLMHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNNIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query560 2.2.26 [Sep-21-2011]
P33270506 Cytochrome P450 6a2 OS=Dr yes N/A 0.475 0.525 0.362 7e-51
Q27594504 Cytochrome P450 6a9 OS=Dr no N/A 0.521 0.579 0.356 2e-50
Q9V4U7509 Probable cytochrome P450 no N/A 0.469 0.516 0.377 9e-49
Q9V771502 Probable cytochrome P450 no N/A 0.467 0.521 0.371 1e-47
Q964R0524 Cytochrome P450 6k1 OS=Bl N/A N/A 0.469 0.501 0.355 2e-47
Q9V774504 Probable cytochrome P450 no N/A 0.507 0.563 0.392 3e-47
Q9V770501 Probable cytochrome P450 no N/A 0.469 0.524 0.357 4e-47
Q9V4U9493 Probable cytochrome P450 no N/A 0.464 0.527 0.385 5e-47
P13527509 Cytochrome P450 6A1 OS=Mu N/A N/A 0.473 0.520 0.347 7e-47
Q9V773501 Probable cytochrome P450 no N/A 0.473 0.528 0.330 2e-46
>sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 Back     alignment and function desciption
 Score =  202 bits (513), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 171/279 (61%), Gaps = 13/279 (4%)

Query: 62  PVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTF 121
           P   + D+++ K++LIKDF  F DRG F  N  D+P+ ++LF L G +W+ MR +++PTF
Sbjct: 79  PAAFIVDTQLAKNILIKDFSNFADRGQFH-NGRDDPLTQHLFNLDGKKWKDMRQRLTPTF 137

Query: 122 TSGKIKEMFPLMESCGRNVVSILTKYI--NKKNESIDVKEYLGRYMTDLIGSTVFGMEIN 179
           TSGK+K MFP +       V ++T+ +   +    +++KE + R+ TD+IG+  FG+E N
Sbjct: 138 TSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECN 197

Query: 180 ALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQN 239
            L  P  +FR + +++       +++ + V   P +   L   MM     QFF+ LV+  
Sbjct: 198 TLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVHQFFMRLVNDT 257

Query: 240 LSYREQNNIKRNDFINIMMELRK------NDPDITEEL----ITAQCFLFFIAGFDTSST 289
           ++ RE+ N KRNDF+N+++EL++      ++ ++ E +    + AQ F+F++AGF+TSS+
Sbjct: 258 IALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSS 317

Query: 290 VLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESL 328
            +++ LYELA+N+ IQ  LR EI     +  G+LTYES+
Sbjct: 318 TMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESI 356
Is involved in the breakdown of synthetic insecticides and may be involved in the metabolism of insect hormones.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 Back     alignment and function description
>sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 Back     alignment and function description
>sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 Back     alignment and function description
>sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V774|C6A21_DROME Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 Back     alignment and function description
>sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 Back     alignment and function description
>sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 Back     alignment and function description
>sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
340723206 717 PREDICTED: cytochrome P450 6k1-like [Bom 0.873 0.682 0.303 7e-66
340723507500 PREDICTED: cytochrome P450 6a2-like [Bom 0.544 0.61 0.397 7e-57
40646527509 cytochrome P450 CYP6P8 [Anopheles minimu 0.535 0.589 0.385 1e-56
156553634501 PREDICTED: probable cytochrome P450 6a14 0.473 0.528 0.419 4e-56
194753287504 GF12636 [Drosophila ananassae] gi|190620 0.491 0.545 0.393 4e-56
40646525509 cytochrome P450 CYP6P7 [Anopheles minimu 0.467 0.514 0.418 5e-56
310775888509 P450 monooxygenase [Bactrocera dorsalis] 0.475 0.522 0.384 1e-55
332026902502 Cytochrome P450 6A1 [Acromyrmex echinati 0.532 0.593 0.4 2e-55
340723503499 PREDICTED: probable cytochrome P450 6a14 0.512 0.575 0.402 2e-55
332026877501 Putative cytochrome P450 6a14 [Acromyrme 0.466 0.520 0.420 3e-55
>gi|340723206|ref|XP_003399985.1| PREDICTED: cytochrome P450 6k1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  258 bits (658), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 172/566 (30%), Positives = 287/566 (50%), Gaps = 77/566 (13%)

Query: 62  PVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPI-MRNLFGLTGDEWRKMRNKMSPT 120
           P L++ D E++KHVL+KDFD F DR +  A+E D+ +   N+  +    W+ +R K++P 
Sbjct: 67  PHLLIRDPELVKHVLVKDFDYFPDR-YACADEKDDRLGYANVVMMKNPGWKSLRPKLTPI 125

Query: 121 FTSGKIKEMFPLMESCGRNVVSIL-TKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEIN 179
           FT GK++ MF LM      +   L + ++    + ++ K+    + TD IGS  FG+++ 
Sbjct: 126 FTPGKLRTMFDLMLVVADELGMYLDSLHLEGDGKVVEFKDICASFATDTIGSVAFGLKLG 185

Query: 180 ALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQN 239
           +LENP   FR+  +++        + ++++   P + K++      RK   F   +    
Sbjct: 186 SLENPKTPFREYGRKIFYSNFYRNVELLIISFSPQLIKYMKPKFFGRKATNFLRSVFWDA 245

Query: 240 LSYREQNNIKRNDFINIMMELRK---NDPDITE-----ELITAQCFLFFIAGFDTSSTVL 291
           +  R  +  KRND I++++E+RK   ND ++ +     E + AQ  + F AGF+TSS+ +
Sbjct: 246 IDQRVDSAQKRNDLIDVLLEIRKTYMNDENLKDYNFDGEDLLAQAAILFAAGFETSSSTM 305

Query: 292 TFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLI----LDWIILSSI---VILLYY 344
           +F+L+ELA N  +Q TLR EI D   K GG++TY+ ++    LD +I  S+    ++ Y 
Sbjct: 306 SFTLHELAVNPDVQKTLRAEIQDALEKTGGKITYDMIMTLPYLDMVISESLRKYPVVGYT 365

Query: 345 LKTIFISYQ--------------YWKSRNVPFLRPTFPFGNVY------EAITMQRPTHF 384
            +     Y+              Y     + +    FP  N Y      E     RP+ F
Sbjct: 366 DRNTLADYKVPNSDLVLEKGTPIYISIMGLHYDSRYFPNPNKYDPHRFTEEAKSTRPS-F 424

Query: 385 VY------QDIYMEIKFGLKSPFAGIFTTTTPVLVLADSEIIK----------------- 421
            Y        I + ++ GL     G+      V +L D E++                  
Sbjct: 425 AYLPFGAGPRICLGMRLGLMQSKLGV------VQILKDYEVLPCEKTKIPIVLDPKGIMT 478

Query: 422 ------HVLIKDFDVFTDRDITE---ELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKS 472
                 H+ I+      +  + E   + + AQ  +FFI+G +TSS  ++F+L+ELA N  
Sbjct: 479 TALGGVHLNIRKITTAYNLHVPEFDGDDLVAQAIMFFISGIETSSIAISFTLHELAVNPD 538

Query: 473 IQSTLRKEINDTKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPN 532
           +Q  LR EI+D   K GG++TY+    +P LD V+ E+LR Y  +G LDR+T   Y+LPN
Sbjct: 539 LQKKLRAEIHDALEKSGGKITYDMITTLPYLDMVMSETLRKYPSVGHLDRVTLADYKLPN 598

Query: 533 TDIVIDKGTKMFIPLYGLHHDPEIYP 558
           +D+V++KGT +FI + GLH+D   +P
Sbjct: 599 SDLVLEKGTPIFISIMGLHYDSRYFP 624

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340723507|ref|XP_003400131.1| PREDICTED: cytochrome P450 6a2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|40646527|gb|AAR88142.1| cytochrome P450 CYP6P8 [Anopheles minimus] Back     alignment and taxonomy information
>gi|156553634|ref|XP_001600283.1| PREDICTED: probable cytochrome P450 6a14 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|194753287|ref|XP_001958948.1| GF12636 [Drosophila ananassae] gi|190620246|gb|EDV35770.1| GF12636 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|40646525|gb|AAR88141.1| cytochrome P450 CYP6P7 [Anopheles minimus] Back     alignment and taxonomy information
>gi|310775888|gb|ADP22304.1| P450 monooxygenase [Bactrocera dorsalis] Back     alignment and taxonomy information
>gi|332026902|gb|EGI67003.1| Cytochrome P450 6A1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340723503|ref|XP_003400129.1| PREDICTED: probable cytochrome P450 6a14-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332026877|gb|EGI66978.1| Putative cytochrome P450 6a14 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
FB|FBgn0039006515 Cyp6d4 "Cyp6d4" [Drosophila me 0.366 0.398 0.347 2.4e-56
FB|FBgn0033981504 Cyp6a21 "Cyp6a21" [Drosophila 0.467 0.519 0.403 6.5e-51
FB|FBgn0038194508 Cyp6d5 "Cyp6d5" [Drosophila me 0.375 0.413 0.306 1.8e-50
FB|FBgn0000473506 Cyp6a2 "Cytochrome P450-6a2" [ 0.471 0.521 0.364 1.8e-48
FB|FBgn0013771504 Cyp6a9 "Cytochrome P450-6a9" [ 0.467 0.519 0.378 4.7e-48
FB|FBgn0013773499 Cyp6a22 "Cyp6a22" [Drosophila 0.469 0.527 0.360 2e-47
FB|FBgn0033978502 Cyp6a23 "Cyp6a23" [Drosophila 0.464 0.517 0.381 2.6e-47
FB|FBgn0015714501 Cyp6a17 "Cytochrome P450-6a17" 0.510 0.570 0.346 1.4e-46
FB|FBgn0033304493 Cyp6a13 "Cyp6a13" [Drosophila 0.460 0.523 0.388 2.7e-45
FB|FBgn0039519507 Cyp6a18 "Cyp6a18" [Drosophila 0.467 0.516 0.369 1.5e-44
FB|FBgn0039006 Cyp6d4 "Cyp6d4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 2.4e-56, Sum P(2) = 2.4e-56
 Identities = 73/210 (34%), Positives = 124/210 (59%)

Query:    62 PVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTF 121
             P +++ D+++ + VL +DF  F DRG +   E D P+  N+F L G  WR MR+ +SP F
Sbjct:    78 PAVLIRDADLARRVLAQDFASFHDRGVYVDEERD-PLSANIFSLRGQSWRSMRHMLSPCF 136

Query:   122 TSGKIKEMFPLMESCGRNVVSILTKYINKKN-ESIDVKEYLGRYMTDLIGSTVFGMEINA 180
             TSGK+K MF   E  G  +V+ L K + ++  + +D+K+ +  Y  D+I ST+FG+++N+
Sbjct:   137 TSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIFGLDVNS 196

Query:   181 LENPDCEFRKVSKEMLNPKLRFRIVM-ILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQN 239
              ENPD +FRK+   +     RF  +  +++ L+P+I +FL  +          L +V + 
Sbjct:   197 FENPDNKFRKLVS-LARANNRFNAMFGMMIFLVPSIAQFLFRIGFKNPVGLAMLQIVKET 255

Query:   240 LSYREQNNIKRNDFINIMMELRKNDPDITE 269
             + YRE++ I R D + ++++LR N   I E
Sbjct:   256 VEYREKHGIVRKDLLQLLIQLR-NTGKIDE 284
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0022416 "chaeta development" evidence=IGI
GO:0035220 "wing disc development" evidence=IGI
FB|FBgn0033981 Cyp6a21 "Cyp6a21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038194 Cyp6d5 "Cyp6d5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000473 Cyp6a2 "Cytochrome P450-6a2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013771 Cyp6a9 "Cytochrome P450-6a9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013773 Cyp6a22 "Cyp6a22" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033978 Cyp6a23 "Cyp6a23" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015714 Cyp6a17 "Cytochrome P450-6a17" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039519 Cyp6a18 "Cyp6a18" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
pfam00067461 pfam00067, p450, Cytochrome P450 9e-43
pfam00067461 pfam00067, p450, Cytochrome P450 1e-27
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 6e-17
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-15
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-15
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-13
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 9e-11
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 9e-10
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 3e-09
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-08
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 6e-08
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-07
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-07
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-07
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 4e-07
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 8e-07
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-06
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-05
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-05
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-04
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 3e-04
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 8e-04
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 0.001
PLN02648480 PLN02648, PLN02648, allene oxide synthase 0.002
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 0.003
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 0.003
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  158 bits (402), Expect = 9e-43
 Identities = 79/287 (27%), Positives = 131/287 (45%), Gaps = 18/287 (6%)

Query: 62  PVLVLADSEIIKHVLIKDFDVFTDRG--FFEANETDEPIMRNLFGLTGDEWRKMRNKMSP 119
           PV+VL+  E +K VLIK  + F+ R    + A      + + +    G  WR++R  ++P
Sbjct: 45  PVVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSRGPFLGKGIVFANGPRWRQLRRFLTP 104

Query: 120 TFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEIN 179
           TFTS       P +E   R++V  L K   +    ID+ + L R   ++I S +FG    
Sbjct: 105 TFTSFGKLSFEPRVEEEARDLVEKLRKTAGE-PGVIDITDLLFRAALNVICSILFGERFG 163

Query: 180 ALENP-DCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNV-----QFFL 233
           +LE+P   E  K  +E+    L       L+ L P ++ F        K           
Sbjct: 164 SLEDPKFLELVKAVQELS--SLLSSPSPQLLDLFPILKYFPGPHGRKLKRARKKIKDLLD 221

Query: 234 DLVHQNLSYREQNNIKRNDFINIMMELRKNDP--DITEELITAQCFLFFIAGFDTSSTVL 291
            L+ +     +       DF++ ++  ++ +    +T+E + A     F AG DT+S+ L
Sbjct: 222 KLIEERRETLDSAKKSPRDFLDALLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTL 281

Query: 292 TFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESL----ILDWII 334
           +++LYELAK+  +Q  LR+EI D         TY+ L     LD +I
Sbjct: 282 SWALYELAKHPEVQEKLREEI-DEVIGDKRSPTYDDLQNMPYLDAVI 327

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 560
KOG0156|consensus489 100.0
KOG0158|consensus499 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02687 517 flavonoid 3'-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
KOG0157|consensus497 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03018 534 homomethionine N-hydroxylase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02738 633 carotene beta-ring hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
KOG0159|consensus519 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02648480 allene oxide synthase 100.0
KOG0684|consensus486 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
KOG0158|consensus499 99.25
KOG0156|consensus489 99.1
PLN03234499 cytochrome P450 83B1; Provisional 99.01
PLN02971543 tryptophan N-hydroxylase 98.99
KOG0159|consensus519 98.91
PLN02394503 trans-cinnamate 4-monooxygenase 98.9
KOG0157|consensus497 98.89
PLN02426502 cytochrome P450, family 94, subfamily C protein 98.88
PLN03195516 fatty acid omega-hydroxylase; Provisional 98.87
PLN02290516 cytokinin trans-hydroxylase 98.85
PLN00168519 Cytochrome P450; Provisional 98.84
PTZ00404482 cytochrome P450; Provisional 98.84
PLN02500490 cytochrome P450 90B1 98.84
PLN02966502 cytochrome P450 83A1 98.83
PLN02183516 ferulate 5-hydroxylase 98.83
PLN02738633 carotene beta-ring hydroxylase 98.82
PLN03112514 cytochrome P450 family protein; Provisional 98.82
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 98.78
PLN02655466 ent-kaurene oxidase 98.73
PLN02774463 brassinosteroid-6-oxidase 98.72
PLN02936489 epsilon-ring hydroxylase 98.71
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 98.7
PLN03018534 homomethionine N-hydroxylase 98.69
PLN02687517 flavonoid 3'-monooxygenase 98.68
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.62
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 98.62
PLN02196463 abscisic acid 8'-hydroxylase 98.61
PLN02302490 ent-kaurenoic acid oxidase 98.53
PLN02987472 Cytochrome P450, family 90, subfamily A 98.46
KOG0684|consensus486 98.35
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.15
PLN02648480 allene oxide synthase 98.07
>KOG0156|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.4e-54  Score=457.93  Aligned_cols=368  Identities=24%  Similarity=0.349  Sum_probs=283.1

Q ss_pred             CCCCCCCCcccccCCccccccc-cccccchhhccCCCCCCcceeecccceEEEeCHHHHHHHHhhcCCCcccCccc-ccc
Q psy14266         15 VPLMHEPKPVPLMHEPKLSFQV-RDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFDVFTDRGFF-EAN   92 (560)
Q Consensus        15 ~~~pPGP~~lP~lG~~~~~~~~-~~~~~~~~~~k~g~~yg~~~~ig~~~~Vvv~~pe~vreil~~~~~~f~~r~~~-~~~   92 (560)
                      .++||||+++|++||+++.... ....+.++.++|||+|.+.  +|..|+||++|+++++|++.+++..|++|+.. ...
T Consensus        25 ~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~--lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~  102 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLR--LGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATL  102 (489)
T ss_pred             CCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEE--ecCceEEEECCHHHHHHHHHhCCccccCCCCchhhH
Confidence            7899999999999998643333 2225557888999999666  99999999999999999999999999999962 111


Q ss_pred             cccccccCCcccc-CChhHHHhhhhhc-CCCChHHHhhhHHHHHHHHHHHHHHHHHHHhcCCCceeHHHHHHHHHHHHHH
Q psy14266         93 ETDEPIMRNLFGL-TGDEWRKMRNKMS-PTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIG  170 (560)
Q Consensus        93 ~~~~~~~~~l~~~-~g~~wr~~Rk~l~-~~f~~~~l~~~~~~i~~~~~~l~~~l~~~~~~~~~~vdl~~~l~~~t~dii~  170 (560)
                      ......+.+++.. +|+.||.+||+.. ..++.+.++.....-.++++.+++.+.+ .. .+++||+...+..++.++|+
T Consensus       103 ~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~-~~~~vdl~~~l~~~~~nvI~  180 (489)
T KOG0156|consen  103 KYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SK-KGEPVDLSELLDLLVGNVIC  180 (489)
T ss_pred             HHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cC-CCceeeHHHHHHHHHHHHHH
Confidence            2333344555554 9999999999865 5577788888877778888998888887 22 22789999999999999999


Q ss_pred             HhhcCCccCCCCCCC-hhHHHHHHHhhchhhHHHHHHHHHHhch-hhHHHh---hhhhhhhhhHHHHHHHHHHHHHHHHh
Q psy14266        171 STVFGMEINALENPD-CEFRKVSKEMLNPKLRFRIVMILVLLIP-NIRKFL---SGLMMDRKNVQFFLDLVHQNLSYREQ  245 (560)
Q Consensus       171 ~~~fG~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~~~---~~~~~~~~~~~~l~~~~~~~i~~~~~  245 (560)
                      +++||.++...+.+. .++.+++.+....    ...+...+++| ++....   ............+...+++.++++..
T Consensus       181 ~~~fG~rf~~~~~~~~~~~~~l~~~~~~~----~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~  256 (489)
T KOG0156|consen  181 RMLFGRRFEEEDEEEFLELKELVEESLEL----LGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHRE  256 (489)
T ss_pred             HHHhCCccccCCchHHHHHHHHHHHHHHH----hCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            999999987642222 2244444444332    22222334444 222221   11112222222345555555555433


Q ss_pred             c--CCCCCcHHHHHHHhhhcCCCCCHHHHHHHHhHheecCchhhHHHHHHHHHHHhcCchHHHHHHHHHHHHhhhcCCCC
Q psy14266        246 N--NIKRNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGEL  323 (560)
Q Consensus       246 ~--~~~~~dll~~Ll~~~~~~~~l~~~~i~~~~~~ll~AG~dTTa~tL~w~l~~L~~~Pevq~kLr~EI~~~~~~~~~~~  323 (560)
                      .  .....|+++.++...+++..                                                         
T Consensus       257 ~~~~~~~~D~vD~lL~~~~~~~~---------------------------------------------------------  279 (489)
T KOG0156|consen  257 KIGDEEGRDFVDALLKLMKEEKA---------------------------------------------------------  279 (489)
T ss_pred             hhccCCCCcHHHHHHHhhccccc---------------------------------------------------------
Confidence            2  12237999999987544321                                                         


Q ss_pred             chhhhhHHHHHHHHHHHHhhheeeeEEEEeeeeccCCCCccCCCCccchHHHHHhcCCCcchhHHHHHHhhhcCCCCeee
Q psy14266        324 TYESLILDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAG  403 (560)
Q Consensus       324 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  403 (560)
                                                                                                      
T Consensus       280 --------------------------------------------------------------------------------  279 (489)
T KOG0156|consen  280 --------------------------------------------------------------------------------  279 (489)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eeccCceeEEecChHHHHHHHhcccccccCCCCCHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHhCchHHHHHHHHHHH
Q psy14266        404 IFTTTTPVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEIND  483 (560)
Q Consensus       404 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ag~~t~~~~l~~~~~~l~~~p~~~~~~~~Ei~~  483 (560)
                                                   . .+++++|...|..+++||+||||+++.|++.+|++||++|+|+++||++
T Consensus       280 -----------------------------~-~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~  329 (489)
T KOG0156|consen  280 -----------------------------E-GLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDE  329 (489)
T ss_pred             -----------------------------C-CCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHH
Confidence                                         0 3899999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCChhhhcCCccHHHHHHhhhcCCCCCcc-eeeecCCceecCCCceEecCCCeEEEcccccCCCCCCCCCC
Q psy14266        484 TKAKYGGELTYESYDEMPLLDRVIKESLRMYTPLGQ-LDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL  560 (560)
Q Consensus       484 ~~~~~~~~~~~~~~~~~~~l~avi~E~lRl~~~~~~-~~r~~~~~~~~~~~g~~ipkgt~v~~~~~~~~~d~~~~~~~  560 (560)
                      ++|. ++.++.+|+.+||||+|||+|++|+||++|. ++|.+.+|+.++  ||.|||||.|++++|++||||++|+|+
T Consensus       330 vvG~-~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~--Gy~IPkgT~v~vn~~ai~rDp~vw~dP  404 (489)
T KOG0156|consen  330 VVGK-GRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIG--GYDIPKGTTVLVNLWAIHRDPKVWEDP  404 (489)
T ss_pred             HhCC-CCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEc--CEEcCCCCEEEEeehhhhcCCccCCCc
Confidence            9998 5669999999999999999999999999999 799999999999  999999999999999999999999985

>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 4e-27
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-14
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 5e-27
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-14
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-27
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 3e-14
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-06
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 8e-08
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-07
3qi8_B 472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-04
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 6e-07
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-06
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-06
3hf2_A 482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-04
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-06
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 4e-06
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-06
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-04
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-06
3m4v_A 482 Crystal Structure Of The A330p Mutant Of Cytochrome 3e-04
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-04
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-06
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-04
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-06
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-04
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-06
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 2e-04
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-06
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-04
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-06
2hpd_A 471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-04
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-04
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-06
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-04
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-06
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-04
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-06
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-04
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 2e-06
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 2e-04
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-06
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-04
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-06
2nnb_A 471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-04
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-06
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-04
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-06
3psx_A 487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 4e-04
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 2e-06
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 2e-04
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-06
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-04
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-06
4dud_A 471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 6e-04
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 4e-06
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 2e-04
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 4e-06
4duf_A 471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 6e-04
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 4e-06
4duc_A 472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 5e-04
1fah_A471 Structure Of Cytochrome P450 Length = 471 5e-06
1fah_A 471 Structure Of Cytochrome P450 Length = 471 7e-04
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 5e-06
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 8e-04
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 5e-06
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 8e-04
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-06
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-04
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 5e-06
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 7e-06
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 6e-06
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 8e-04
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 7e-06
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 7e-06
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 7e-06
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 7e-06
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 8e-06
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 1e-05
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-05
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 1e-05
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 1e-05
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 1e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-05
4dua_A 471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 6e-04
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 2e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 2e-05
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-05
4dub_A 472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 6e-04
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-05
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 5e-05
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 3e-04
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-04
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 3e-04
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 3e-04
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-04
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 5e-04
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 8e-04
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 8e-04
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (298), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 168/315 (53%), Gaps = 41/315 (13%)
Query: 21  PKPVPLM------HEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKH 74
           P P+P +      H+    F + D    KK       Y+ Q+     PVL + D ++IK 
Sbjct: 21  PTPLPFLGNILSYHK---GFCMFDMECHKKYGKVWGFYDGQQ-----PVLAITDPDMIKT 72
Query: 75  VLIKD-FDVFTDRGFFEANETDEPI--MRNLFGLTGDE-WRKMRNKMSPTFTSGKIKEMF 130
           VL+K+ + VFT+R  F       P+  M++   +  DE W+++R+ +SPTFTSGK+KEM 
Sbjct: 73  VLVKECYSVFTNRRPFG------PVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMV 126
Query: 131 PLMESCGRNVVSILTKYINKKNES---IDVKEYLGRYMTDLIGSTVFGMEINALENPDCE 187
           P++   G     +L + + ++ E+   + +K+  G Y  D+I ST FG+ I++L NP   
Sbjct: 127 PIIAQYG----DVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDP 182
Query: 188 FRKVSKEMLNPKLR---FRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYRE 244
           F + +K++L        F  + +   LIP I + L+  +  R+   F    V +    R 
Sbjct: 183 FVENTKKLLRFDFLDPFFLSITVFPFLIP-ILEVLNICVFPREVTNFLRKSVKRMKESRL 241
Query: 245 QNNIK-RNDFINIMMELR-----KNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYEL 298
           ++  K R DF+ +M++ +     ++   +++  + AQ  +F  AG++T+S+VL+F +YEL
Sbjct: 242 EDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYEL 301
Query: 299 AKNKSIQSTLRKEIN 313
           A +  +Q  L++EI+
Sbjct: 302 ATHPDVQQKLQEEID 316
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-106
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 9e-51
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-17
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-40
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 9e-28
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 9e-38
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-33
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-37
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-27
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-36
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 6e-25
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-36
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-29
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-34
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-27
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-34
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-27
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-30
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-29
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-30
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-23
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 7e-30
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-27
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-29
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-25
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-28
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-27
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 7e-27
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 9e-27
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-26
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-24
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-25
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-18
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-22
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-19
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-20
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-17
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-16
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 8e-12
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-14
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-08
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-13
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-09
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-13
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 4e-08
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-13
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 7e-08
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-13
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-08
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-13
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-08
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-13
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-10
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-05
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-12
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-08
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-12
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 8e-08
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-11
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 8e-05
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-04
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-04
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 4e-04
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 4e-04
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
 Score =  327 bits (841), Expect = e-106
 Identities = 90/330 (27%), Positives = 165/330 (50%), Gaps = 26/330 (7%)

Query: 21  PKPVPL---MHEPKLSFQVRDFNNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLI 77
           P P+P    +      F + D    KK       Y+ Q+     PVL + D ++IK VL+
Sbjct: 19  PTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQ-----PVLAITDPDMIKTVLV 73

Query: 78  KD-FDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESC 136
           K+ + VFT+R  F        +   +     +EW+++R+ +SPTFTSGK+KEM P++   
Sbjct: 74  KECYSVFTNRRPFG---PVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQY 130

Query: 137 GRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINALENPDCEFRKVSKEML 196
           G  +V  L +   +  + + +K+  G Y  D+I ST FG+ I++L NP   F + +K++L
Sbjct: 131 GDVLVRNLRREA-ETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLL 189

Query: 197 NPKLRFRIVMILVLL--IPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYR-EQNNIKRNDF 253
                    + + +   +  I + L+  +  R+   F    V +    R E     R DF
Sbjct: 190 RFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDF 249

Query: 254 INIMMELRKNDPD-----ITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTL 308
           + +M++ + +        +++  + AQ  +F  AG++T+S+VL+F +YELA +  +Q  L
Sbjct: 250 LQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKL 309

Query: 309 RKEINDTKAKYGGELTYESLI----LDWII 334
           ++EI+          TY++++    LD ++
Sbjct: 310 QEEIDAVLPN-KAPPTYDTVLQMEYLDMVV 338
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.96
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.89
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.06
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 98.87
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 98.86
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 98.85
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 98.83
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 98.82
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 98.82
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.81
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 98.8
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 98.79
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.79
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 98.78
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 98.77
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 98.77
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 98.77
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 98.76
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 98.75
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 98.74
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 98.71
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 98.7
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.69
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 98.67
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 98.6
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 98.54
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 98.47
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.46
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.36
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 98.36
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.34
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 98.33
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 98.31
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.3
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 98.27
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.26
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 98.26
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.26
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.24
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 98.23
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.23
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 98.23
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 98.22
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.22
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 98.21
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.21
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.19
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 98.19
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.18
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 98.16
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.14
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.14
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.12
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 98.12
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 98.12
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 98.1
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 98.1
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 98.1
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.09
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.08
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 98.07
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.06
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 98.06
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 98.05
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.05
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.03
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 97.99
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 97.98
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 97.98
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 97.97
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 97.95
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 97.92
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 97.84
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 97.76
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 97.45
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 97.42
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 97.14
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-50  Score=433.31  Aligned_cols=370  Identities=28%  Similarity=0.509  Sum_probs=286.1

Q ss_pred             CCCCCCCcccccCCcccccccccc-ccchhhccCCCCCCcceeecccceEEEeCHHHHHHHHhhc-CCCcccCccccccc
Q psy14266         16 PLMHEPKPVPLMHEPKLSFQVRDF-NNSKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKD-FDVFTDRGFFEANE   93 (560)
Q Consensus        16 ~~pPGP~~lP~lG~~~~~~~~~~~-~~~~~~~k~g~~yg~~~~ig~~~~Vvv~~pe~vreil~~~-~~~f~~r~~~~~~~   93 (560)
                      +.||||+++|++||++. +..+.. .+.+|.++||++|++.  +|+.++|+++||+++++++.++ .+.|.+++...   
T Consensus        14 ~~~PGP~~~PliGn~~~-~~~~~~~~~~~~~~~yG~i~~~~--~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~~---   87 (485)
T 3nxu_A           14 LGIPGPTPLPFLGNILS-YHKGFCMFDMECHKKYGKVWGFY--DGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFG---   87 (485)
T ss_dssp             HTCCCCCCBTTTBTGGG-GGGCHHHHHHHHHHHHCSEEEEE--ETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCCS---
T ss_pred             CCCCCCCCcCeecCcHH-hhcChHHHHHHHHHHcCCeEEEE--eCCCCEEEECCHHHHHHHHhccchhhccCCcccc---
Confidence            56899999999999854 333322 2347889999998776  8999999999999999999876 56677765441   


Q ss_pred             ccccccCCccccCChhHHHhhhhhcCCCChHHHhhhHHHHHHHHHHHHHHHHHHHhcCCCceeHHHHHHHHHHHHHHHhh
Q psy14266         94 TDEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTV  173 (560)
Q Consensus        94 ~~~~~~~~l~~~~g~~wr~~Rk~l~~~f~~~~l~~~~~~i~~~~~~l~~~l~~~~~~~~~~vdl~~~l~~~t~dii~~~~  173 (560)
                      .....+.+++..+|+.|+++|++++++|++++++.+.+.+.++++++++.+.+... +++++|+.+.+..+++|+++.++
T Consensus        88 ~~~~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~-~g~~~d~~~~~~~~~~dvi~~~~  166 (485)
T 3nxu_A           88 PVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAE-TGKPVTLKDVFGAYSMDVITSTS  166 (485)
T ss_dssp             CCGGGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HTCCEEHHHHHHHHHHHHHHHHH
T ss_pred             cccccccCccccCCcHHHHHHhhcChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhc-cCCcCcHHHHHHHHHHHHHHHHH
Confidence            12244567888999999999999999999999999999999999999999987544 46789999999999999999999


Q ss_pred             cCCccCCCCCCChhHHHHHHHhhchhhHHHHHHHHHHhchhhHHHhhhh---hhhhhhHHHHHHHHHHHHHHHHhc-CCC
Q psy14266        174 FGMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGL---MMDRKNVQFFLDLVHQNLSYREQN-NIK  249 (560)
Q Consensus       174 fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~~~~~---~~~~~~~~~l~~~~~~~i~~~~~~-~~~  249 (560)
                      ||.+++..++....+............. .........+|++.......   .........+.+.+.+.++.+... ...
T Consensus       167 fG~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (485)
T 3nxu_A          167 FGVNIDSLNNPQDPFVENTKKLLRFDFL-DPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKH  245 (485)
T ss_dssp             HSCCCCGGGCTTCHHHHHHTTSCCCCTT-SHHHHHHHHCTTHHHHHHHTTCCSSCHHHHHHHHHHHHHHHHHHHHCC---
T ss_pred             cCCccccccCCCcHHHHHHHHHhchhhH-HHHHHHHHHhhhhHHHHHHhhhhhchHHHHHHHHHHHHHHHHHHHhccCCC
Confidence            9999887655444555555444332111 01111233455544332211   112233344555555555544332 234


Q ss_pred             CCcHHHHHHHhhhcCCCCCHHHHHHHHhHheecCchhhHHHHHHHHHHHhcCchHHHHHHHHHHHHhhhcCCCCchhhhh
Q psy14266        250 RNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLI  329 (560)
Q Consensus       250 ~~dll~~Ll~~~~~~~~l~~~~i~~~~~~ll~AG~dTTa~tL~w~l~~L~~~Pevq~kLr~EI~~~~~~~~~~~~~~~l~  329 (560)
                      ..|+++.+++...+...                                                               
T Consensus       246 ~~d~l~~ll~~~~~~~~---------------------------------------------------------------  262 (485)
T 3nxu_A          246 RVDFLQLMIDSQNSKET---------------------------------------------------------------  262 (485)
T ss_dssp             CCCHHHHHHHHHC-------------------------------------------------------------------
T ss_pred             cccHHHHHHHhhhcccc---------------------------------------------------------------
Confidence            46888888875432110                                                               


Q ss_pred             HHHHHHHHHHHHhhheeeeEEEEeeeeccCCCCccCCCCccchHHHHHhcCCCcchhHHHHHHhhhcCCCCeeeeeccCc
Q psy14266        330 LDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTT  409 (560)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  409 (560)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (485)
T 3nxu_A          263 --------------------------------------------------------------------------------  262 (485)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eeEEecChHHHHHHHhcccccccCCCCCHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHhCchHHHHHHHHHHHHHhhcC
Q psy14266        410 PVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYG  489 (560)
Q Consensus       410 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ag~~t~~~~l~~~~~~l~~~p~~~~~~~~Ei~~~~~~~~  489 (560)
                              +             .+..+++++++++++.+++||+|||+++|+|++++|++||++|+|+++||+++.+. +
T Consensus       263 --------~-------------~~~~l~~~ei~~~~~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~-~  320 (485)
T 3nxu_A          263 --------E-------------SHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-K  320 (485)
T ss_dssp             -------------------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSTT-T
T ss_pred             --------c-------------cccCCCHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHhcc-C
Confidence                    0             01168999999999999999999999999999999999999999999999999987 6


Q ss_pred             CCCChhhhcCCccHHHHHHhhhcCCCCCcceeeecCCceecCCCceEecCCCeEEEcccccCCCCCCCCCC
Q psy14266        490 GELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL  560 (560)
Q Consensus       490 ~~~~~~~~~~~~~l~avi~E~lRl~~~~~~~~r~~~~~~~~~~~g~~ipkgt~v~~~~~~~~~d~~~~~~~  560 (560)
                      +.++++++.+||||+|||+|+|||+|+++.++|.+.+|++++  ||.|||||.|+++.+++||||++|+|.
T Consensus       321 ~~~~~~~~~~lpyl~a~i~E~lRl~p~~~~~~R~~~~d~~i~--g~~Ip~Gt~V~~~~~~~~~d~~~~~dp  389 (485)
T 3nxu_A          321 APPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEIN--GMFIPKGVVVMIPSYALHRDPKYWTEP  389 (485)
T ss_dssp             CCCCHHHHHHCHHHHHHHHHHHHHSCSCSCEEEECCSCEEET--TEEECTTCEEEECHHHHHTCTTTCSST
T ss_pred             CCCCHHHHhcChHHHHHHHHHHhcCCCccCcceeeCCCeeEC--CEEECCCCEEEEchHHhcCChhhcCCc
Confidence            789999999999999999999999999999999999999999  999999999999999999999999874
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 560
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-23
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-09
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-21
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-08
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-19
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-07
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 0.003
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-18
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-04
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-14
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-12
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 7e-08
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-07
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 7e-06
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-05
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-04
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  100 bits (250), Expect = 2e-23
 Identities = 40/258 (15%), Positives = 87/258 (33%), Gaps = 10/258 (3%)

Query: 62  PVLVLADSEIIKHVLIKDFDVFTDRGFFEANETDEPIMRNLFGLTGDEWRKMRNKMSPTF 121
           PV+VL  ++ I+  L+   + F+ RG     +        +    G+ WR +R     T 
Sbjct: 47  PVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPI-FQGYGVIFANGERWRALRRFSLATM 105

Query: 122 TSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVFGMEINAL 181
               + +   + E        ++ +    K   +D         +++I S VFG   +  
Sbjct: 106 RDFGMGKRS-VEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYK 164

Query: 182 ENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLS 241
           +        +  +  +    F    +  L    ++ F        +N+Q     + Q++ 
Sbjct: 165 DPVFLRLLDLFFQSFSLISSFSS-QVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVE 223

Query: 242 YREQNNIKRN-------DFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFS 294
                    N         + +  +      +   + +       F AG +T+ST L + 
Sbjct: 224 KHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYG 283

Query: 295 LYELAKNKSIQSTLRKEI 312
              + K   +   ++KEI
Sbjct: 284 FLLMLKYPHVTERVQKEI 301
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.96
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.94
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.92
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.92
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.91
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.59
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.58
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.58
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 98.47
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.3
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 98.25
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.05
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.84
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 97.82
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 97.6
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 97.44
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 97.3
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 97.24
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 96.75
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 96.38
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 96.22
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 95.81
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 95.81
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 95.59
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 93.34
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 92.16
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.2e-47  Score=403.41  Aligned_cols=368  Identities=27%  Similarity=0.472  Sum_probs=279.8

Q ss_pred             CCCCCCcccccCCcccccccccccc-chhhccCCCCCCcceeecccceEEEeCHHHHHHHHhhcCC-CcccCcccccccc
Q psy14266         17 LMHEPKPVPLMHEPKLSFQVRDFNN-SKKSDNYPSRYNRQRCFAVIPVLVLADSEIIKHVLIKDFD-VFTDRGFFEANET   94 (560)
Q Consensus        17 ~pPGP~~lP~lG~~~~~~~~~~~~~-~~~~~k~g~~yg~~~~ig~~~~Vvv~~pe~vreil~~~~~-~f~~r~~~~~~~~   94 (560)
                      .+|||+++||+||++. +..+...+ .++.++||++|.+.  +|+.++|+|+||+++++++.++.. .++.++..   ..
T Consensus        10 ~iPGP~~~P~iG~~~~-~~~~~~~~~~~~~~kyG~i~~~~--l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~---~~   83 (472)
T d1tqna_          10 GIPGPTPLPFLGNILS-YHKGFCMFDMECHKKYGKVWGFY--DGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF---GP   83 (472)
T ss_dssp             TCCCCCCBTTTBTGGG-GGGCHHHHHHHHHHHHCSEEEEE--ETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCC---SC
T ss_pred             CCCCCCCcCceeEHHH-hhCCHHHHHHHHHHHhCCEEEEE--ECCeeEEEECCHHHHHHHHhcCCcccccCCccc---cc
Confidence            4689999999999854 44444333 37889999988765  899999999999999999976543 34443332   22


Q ss_pred             cccccCCccccCChhHHHhhhhhcCCCChHHHhhhHHHHHHHHHHHHHHHHHHHhcCCCceeHHHHHHHHHHHHHHHhhc
Q psy14266         95 DEPIMRNLFGLTGDEWRKMRNKMSPTFTSGKIKEMFPLMESCGRNVVSILTKYINKKNESIDVKEYLGRYMTDLIGSTVF  174 (560)
Q Consensus        95 ~~~~~~~l~~~~g~~wr~~Rk~l~~~f~~~~l~~~~~~i~~~~~~l~~~l~~~~~~~~~~vdl~~~l~~~t~dii~~~~f  174 (560)
                      ....+.++++.+|+.|+++|+++.+.|+...+..+.+.+.+.++.+++.|.+... .+..+|+.+.+.++++++++.++|
T Consensus        84 ~~~~~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~-~~~~~dl~~~~~~~~~~v~~~~~~  162 (472)
T d1tqna_          84 VGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAE-TGKPVTLKDVFGAYSMDVITSTSF  162 (472)
T ss_dssp             CGGGGGSTTTCCHHHHHHHHHHTTGGGSHHHHHTTHHHHHHHHHHHHHHHHHHHH-HSSCEEHHHHHHHHHHHHHHHTSS
T ss_pred             ccccCCceeccCcHHHHHhhhhcCccccchhhhcccchhhhhhhccccccccccc-ccccchhhhhhhccchhhhhheec
Confidence            3345678899999999999999999999999999999999999999999987765 467899999999999999999999


Q ss_pred             CCccCCCCCCChhHHHHHHHhhchhhHHHHHHHHHHhchhhHHHhhhhhhhhhhHHHHHHHHHHHHHHHHhcC-----CC
Q psy14266        175 GMEINALENPDCEFRKVSKEMLNPKLRFRIVMILVLLIPNIRKFLSGLMMDRKNVQFFLDLVHQNLSYREQNN-----IK  249 (560)
Q Consensus       175 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~-----~~  249 (560)
                      |.+++..++...++............. .........+|++....... ......+.+.+.+...+++.++..     ..
T Consensus       163 G~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (472)
T d1tqna_         163 GVNIDSLNNPQDPFVENTKKLLRFDFL-DPFFLSITVFPFLIPILEVL-NICVFPREVTNFLRKSVKRMKESRLEDTQKH  240 (472)
T ss_dssp             CCCCCGGGCTTCHHHHHHTTCCCCCTT-SHHHHHHHHCGGGHHHHHHT-TCCSSCHHHHHHHHHHHHHHHTTTTTTCSCC
T ss_pred             ccccccccccchhhhHHHHHHhhhhhc-cchhcccccccccccccccc-cccccchhhhHHHHHHHHHhhhccccccccc
Confidence            999887665555555554443322111 11111223344443332211 222233344455555554443321     12


Q ss_pred             CCcHHHHHHHhhhcCCCCCHHHHHHHHhHheecCchhhHHHHHHHHHHHhcCchHHHHHHHHHHHHhhhcCCCCchhhhh
Q psy14266        250 RNDFINIMMELRKNDPDITEELITAQCFLFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYGGELTYESLI  329 (560)
Q Consensus       250 ~~dll~~Ll~~~~~~~~l~~~~i~~~~~~ll~AG~dTTa~tL~w~l~~L~~~Pevq~kLr~EI~~~~~~~~~~~~~~~l~  329 (560)
                      ..+..+.++.......                                                                
T Consensus       241 ~~~~~~~~~~~~~~~~----------------------------------------------------------------  256 (472)
T d1tqna_         241 RVDFLQLMIDSQNSKE----------------------------------------------------------------  256 (472)
T ss_dssp             CCCHHHHHHHHHCC------------------------------------------------------------------
T ss_pred             ccchhhhhhhcccccc----------------------------------------------------------------
Confidence            2344444443321110                                                                


Q ss_pred             HHHHHHHHHHHHhhheeeeEEEEeeeeccCCCCccCCCCccchHHHHHhcCCCcchhHHHHHHhhhcCCCCeeeeeccCc
Q psy14266        330 LDWIILSSIVILLYYLKTIFISYQYWKSRNVPFLRPTFPFGNVYEAITMQRPTHFVYQDIYMEIKFGLKSPFAGIFTTTT  409 (560)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  409 (560)
                                                                                                      
T Consensus       257 --------------------------------------------------------------------------------  256 (472)
T d1tqna_         257 --------------------------------------------------------------------------------  256 (472)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eeEEecChHHHHHHHhcccccccCCCCCHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHhCchHHHHHHHHHHHHHhhcC
Q psy14266        410 PVLVLADSEIIKHVLIKDFDVFTDRDITEELITAQCFVFFIAGFDTSSTVLTFSLYELAKNKSIQSTLRKEINDTKAKYG  489 (560)
Q Consensus       410 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ag~~t~~~~l~~~~~~l~~~p~~~~~~~~Ei~~~~~~~~  489 (560)
                                          ...+..+++++++++++.+++||+|||+++++|++++|++||++|+|+++||.++.+. +
T Consensus       257 --------------------~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~-~  315 (472)
T d1tqna_         257 --------------------TESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-K  315 (472)
T ss_dssp             ----------------------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTT-T
T ss_pred             --------------------cccccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccc-c
Confidence                                0012379999999999999999999999999999999999999999999999999987 6


Q ss_pred             CCCChhhhcCCccHHHHHHhhhcCCCCCcceeeecCCceecCCCceEecCCCeEEEcccccCCCCCCCCCC
Q psy14266        490 GELTYESYDEMPLLDRVIKESLRMYTPLGQLDRITGRSYQLPNTDIVIDKGTKMFIPLYGLHHDPEIYPTL  560 (560)
Q Consensus       490 ~~~~~~~~~~~~~l~avi~E~lRl~~~~~~~~r~~~~~~~~~~~g~~ipkgt~v~~~~~~~~~d~~~~~~~  560 (560)
                      ...+.+++.++|||+|||+||||+||+++.++|.+.+|+.++  ||.|||||.|+++.+++||||++|+|.
T Consensus       316 ~~~~~~~l~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~--g~~ipkGt~v~~~~~~~~~d~~~~~dp  384 (472)
T d1tqna_         316 APPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEIN--GMFIPKGVVVMIPSYALHRDPKYWTEP  384 (472)
T ss_dssp             CCCCHHHHHHCHHHHHHHHHHHHHCCTTCCEEEECCSCEEET--TEEECTTCEEEECHHHHHTCTTTSSST
T ss_pred             ccchHHHhhccccccceeeeccccCCcccccccccccCcccc--CceeCCCCEEEEechhhhcCchhCCCc
Confidence            788999999999999999999999999999999999999999  999999999999999999999999874
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure