Psyllid ID: psy14386


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MTSLTEELQEFNELCREAYAVHCTEIHSKQPTSEPSQDVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPVNSDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH
cccHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccEEEEEEEEEEcccHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccHcEEcccccccccccccccccEccccHHHEHEcccccccccccccccccEccccHHHEHEEEccccccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccEEccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccccccccccccccccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHH
MTSLTEELQEFNELCREAYAVHCTeihskqptsepsqdVNYILSHMETyrqmpqqtipvtpvlsngvlvgaltngvpvnsddgdkggdaqskstvvksdlikdpiasddnmedgymdepetdinpkevidtgkpeskslhkcdrcpkkfsSLAKYNFhvsnhgvdkpfqcfkcekrfrsklgldeheakhtgryeyecnacgkgfqnksYLIVHQRvhstdkpyacktcprsfktkQTLLDhenrhmgvkpysceicgrgfitkglckshqkihsgndnrqypcpvckklfvskscnicgqsftqfspMAIHkrlhtgerpyscelcNKAFVSRSTLMVHKKKH
MTSLTEELQEFNELCREAYAVHCTEihskqptsepsQDVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPvnsddgdkggdaqskstvvksdlikdpiasddnmeDGYMdepetdinpkevidtgkpeskslhkcdRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTdkpyacktcprsFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKihsgndnrqypCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFvsrstlmvhkkkh
MTSLTEELQEFNELCREAYAVHCTEIHSKQPTSEPSQDVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPVNSDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH
**********FNELCREAYAVHCTEI************VNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGV********************************************************************CPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRST********
**SLTE*LQEFN***************************NYILSHMETYRQMPQQTIPV********************SDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKK**
********QEFNELCREAYAVHCTEIH**********DVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPVNSDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRS*********
**********FNELCREAYAVHCTEIHSKQPTSEPSQDVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPVNSDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSLTEELQEFNELCREAYAVHCTEIHSKQPTSEPSQDVNYILSHMETYRQMPQQTIPVTPVLSNGVLVGALTNGVPVNSDDGDKGGDAQSKSTVVKSDLIKDPIASDDNMEDGYMDEPETDINPKEVIDTGKPESKSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
Q3ZCX4644 Zinc finger protein 568 O yes N/A 0.584 0.312 0.406 6e-42
P17025639 Zinc finger protein 182 O no N/A 0.590 0.317 0.398 8e-42
Q5R9S5620 Zinc finger protein 182 O no N/A 0.590 0.327 0.398 1e-41
Q6ZN57461 Zinc finger protein 2 hom no N/A 0.613 0.457 0.382 1e-41
Q8N184647 Zinc finger protein 567 O no N/A 0.584 0.310 0.410 2e-41
Q5MCW4 686 Zinc finger protein 569 O no N/A 0.587 0.294 0.413 2e-41
Q6P3V2 769 Zinc finger protein 585A no N/A 0.738 0.330 0.366 8e-41
Q5RB30 769 Zinc finger protein 585B no N/A 0.738 0.330 0.370 9e-41
Q6PF04 617 Zinc finger protein 613 O no N/A 0.590 0.329 0.393 9e-41
Q5RDX1 737 Zinc finger protein 585A no N/A 0.738 0.344 0.366 1e-40
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/219 (40%), Positives = 119/219 (54%), Gaps = 18/219 (8%)

Query: 142 CDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNAC 201
           C  C K FS  +    H+ NH  +KP++C +C K F  K  L  H+  HTG   YEC+ C
Sbjct: 420 CSECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSEC 479

Query: 202 GKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGF 261
           GK F   S LI HQR+H+ +KPYAC  C ++F  K  L +HE  H G KPY C  CG+ F
Sbjct: 480 GKAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAF 539

Query: 262 ITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKS----------------CNICGQSFTQ 305
             +     H+KIH+G   + + C  C K F   S                CN CG++F+Q
Sbjct: 540 SQRQNLLEHEKIHTG--EKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQ 597

Query: 306 FSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH 344
            S + IH R HTGE+P+ C  C KAF  R++L +HK+ H
Sbjct: 598 CSLLIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGH 636




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=1 SV=2 Back     alignment and function description
>sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=2 SV=3 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 Back     alignment and function description
>sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 Back     alignment and function description
>sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 Back     alignment and function description
>sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
189235352 703 PREDICTED: similar to zinc finger protei 0.706 0.345 0.450 5e-71
322795691 762 hypothetical protein SINV_05698 [Solenop 0.590 0.266 0.575 8e-71
307176776 722 Zinc finger protein 235 [Camponotus flor 0.590 0.281 0.575 8e-71
332027106 761 Zinc finger protein 484 [Acromyrmex echi 0.590 0.266 0.575 1e-70
383862547 734 PREDICTED: zinc finger protein 45-like [ 0.697 0.326 0.442 1e-69
380021511 759 PREDICTED: zinc finger protein 571-like 0.697 0.316 0.445 2e-69
340713358 720 PREDICTED: zinc finger protein 45-like [ 0.665 0.318 0.460 2e-69
350415803 720 PREDICTED: zinc finger protein 585B-like 0.665 0.318 0.460 2e-69
226823200 718 zinc finger protein [Nasonia vitripennis 0.590 0.282 0.501 5e-69
242018396 591 zinc finger protein, putative [Pediculus 0.648 0.377 0.522 2e-65
>gi|189235352|ref|XP_001816157.1| PREDICTED: similar to zinc finger protein 25 [Tribolium castaneum] gi|270003626|gb|EFA00074.1| hypothetical protein TcasGA2_TC002889 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 186/324 (57%), Gaps = 81/324 (25%)

Query: 102 KDPIASDDNMEDGYMDEPET--DINPKEVIDTGKPESKSLHK-------CDRCPKKFSSL 152
           K+P ++ D+    + D+PE   +   ++ +    PE  +  K       C  C K + + 
Sbjct: 379 KNPDSNSDDSGGDFADDPEQTEEDENEDNLQIAVPEKGTSKKKIWSPKVCTECGKSYKTN 438

Query: 153 AKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLI 212
            K N H+  H  +KP++C  CEK FRSK+GL +H AKHTG+Y+Y C+ CGKGFQ KSYL+
Sbjct: 439 YKLNEHMRKHTGEKPYKCNDCEKEFRSKIGLAQHAAKHTGKYDYACSICGKGFQCKSYLM 498

Query: 213 VHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQK 272
           VHQRVHS +KPY C TC R+FKTKQ+LLDH NRH+GVKPY+CE CGRGFITKGLCK+HQK
Sbjct: 499 VHQRVHSDEKPYPCLTCGRNFKTKQSLLDHTNRHLGVKPYTCETCGRGFITKGLCKAHQK 558

Query: 273 IHSGNDNRQYP----------------------------CPVCKKLFVSK---------- 294
           +H+G DNR+Y                             C VC K F++K          
Sbjct: 559 VHTGLDNRKYSCKVCNKMFVSKSYLQTHLRIHTGEKPFICEVCGKGFLTKVDLRIHTTMH 618

Query: 295 ----------------------------------SCNICGQSFTQFSPMAIHKRLHTGER 320
                                             SC++CGQ+FTQF+PMAIHKRLHTGER
Sbjct: 619 TGEKSYVCEMCGKAFARRDALRCHRRSHTGERPYSCDLCGQTFTQFTPMAIHKRLHTGER 678

Query: 321 PYSCELCNKAFVSRSTLMVHKKKH 344
           PY+CE C K FVSRST+M H KKH
Sbjct: 679 PYACESCGKTFVSRSTMMSHAKKH 702




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322795691|gb|EFZ18370.1| hypothetical protein SINV_05698 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307176776|gb|EFN66176.1| Zinc finger protein 235 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332027106|gb|EGI67202.1| Zinc finger protein 484 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383862547|ref|XP_003706745.1| PREDICTED: zinc finger protein 45-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021511|ref|XP_003694607.1| PREDICTED: zinc finger protein 571-like [Apis florea] Back     alignment and taxonomy information
>gi|340713358|ref|XP_003395211.1| PREDICTED: zinc finger protein 45-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415803|ref|XP_003490755.1| PREDICTED: zinc finger protein 585B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|226823200|ref|NP_001152818.1| zinc finger protein [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242018396|ref|XP_002429663.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212514648|gb|EEB16925.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
UNIPROTKB|F1MQU6 622 F1MQU6 "Uncharacterized protei 0.598 0.331 0.406 8.6e-47
UNIPROTKB|E2RKW7606 ZNF300 "Uncharacterized protei 0.767 0.435 0.341 7.3e-43
UNIPROTKB|F1MBW2 744 F1MBW2 "Uncharacterized protei 0.590 0.272 0.398 3.1e-46
UNIPROTKB|F1MVJ7 903 F1MVJ7 "Uncharacterized protei 0.636 0.242 0.401 5.4e-46
UNIPROTKB|E1BKB3606 ZNF568 "Uncharacterized protei 0.584 0.331 0.415 6.2e-46
UNIPROTKB|J9P607505 J9P607 "Uncharacterized protei 0.590 0.401 0.380 7.6e-46
UNIPROTKB|J9P3R2 612 J9P3R2 "Uncharacterized protei 0.587 0.330 0.422 1e-45
UNIPROTKB|F1RKP8646 ZNF568 "Uncharacterized protei 0.584 0.311 0.410 4.4e-45
UNIPROTKB|F1RW59622 ZNF182 "Uncharacterized protei 0.590 0.326 0.398 5.6e-45
UNIPROTKB|P17025639 ZNF182 "Zinc finger protein 18 0.590 0.317 0.398 5.6e-45
UNIPROTKB|F1MQU6 F1MQU6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 8.6e-47, Sum P(2) = 8.6e-47
 Identities = 91/224 (40%), Positives = 125/224 (55%)

Query:   137 KSLHKCDRCPKKFSSLAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEY 196
             K L KCD C K FS  +    H + H  +KP++C +C K FR K  L  H+  HTG   Y
Sbjct:   173 KKLFKCDICGKVFSRNSNLAVHQTVHTDEKPYKCDECGKAFRVKSSLLSHQTVHTGEKPY 232

Query:   197 ECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEI 256
             +CN CGK F+ KS L+ HQ +H+ +KPY C  C ++F+ K +LL H+  H G KPY C+ 
Sbjct:   233 KCNDCGKAFRIKSSLLSHQTIHTGEKPYKCDECGKAFRVKSSLLSHKTIHTGEKPYKCDE 292

Query:   257 CGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKS----------------CNICG 300
             CG+ F  K +  SHQ +H+G   + Y C  C K F  KS                CN CG
Sbjct:   293 CGKAFHVKSILLSHQTVHTGE--KLYKCDECGKAFRVKSSLLSHQTVHTGEKPYKCNDCG 350

Query:   301 QSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH 344
             ++F   S +  H+ +HTGE+PY C+ C KAF  +S L+ H+  H
Sbjct:   351 KAFRVKSSLLSHQTIHTGEKPYKCDECGKAFHVKSILLSHQTVH 394


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|E2RKW7 ZNF300 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBW2 F1MBW2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVJ7 F1MVJ7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKB3 ZNF568 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P607 J9P607 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3R2 J9P3R2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKP8 ZNF568 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW59 ZNF182 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P17025 ZNF182 "Zinc finger protein 182" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
KOG1074|consensus958 100.0
KOG2462|consensus279 100.0
KOG2462|consensus279 99.97
KOG3608|consensus467 99.94
KOG3608|consensus 467 99.9
KOG3623|consensus1007 99.9
KOG1074|consensus 958 99.89
KOG3623|consensus 1007 99.87
KOG3576|consensus267 99.78
KOG3576|consensus267 99.77
PLN03086567 PRLI-interacting factor K; Provisional 99.52
PLN03086567 PRLI-interacting factor K; Provisional 99.44
PHA00733128 hypothetical protein 99.3
KOG3993|consensus500 99.2
PHA00733128 hypothetical protein 99.19
PHA0276855 hypothetical protein; Provisional 99.12
PHA0276855 hypothetical protein; Provisional 99.1
KOG3993|consensus500 99.07
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.99
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.91
PHA0061644 hypothetical protein 98.6
PHA0073279 hypothetical protein 98.5
PHA0061644 hypothetical protein 98.48
PHA0073279 hypothetical protein 98.35
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.19
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.14
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.11
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.03
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.91
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.85
COG5189423 SFP1 Putative transcriptional repressor regulating 97.82
COG5189423 SFP1 Putative transcriptional repressor regulating 97.8
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.74
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.73
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.63
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.62
smart0035526 ZnF_C2H2 zinc finger. 97.41
KOG2231|consensus 669 97.41
KOG2231|consensus 669 97.11
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.08
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.06
PRK04860160 hypothetical protein; Provisional 96.99
smart0035526 ZnF_C2H2 zinc finger. 96.96
COG5048467 FOG: Zn-finger [General function prediction only] 96.9
KOG2785|consensus 390 96.84
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.78
COG5048467 FOG: Zn-finger [General function prediction only] 96.69
PRK04860160 hypothetical protein; Provisional 96.64
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.56
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.52
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.48
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.36
KOG1146|consensus 1406 96.33
KOG1146|consensus 1406 96.1
KOG2482|consensus423 95.66
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.41
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.2
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.73
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.6
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.56
KOG2785|consensus390 94.04
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.6
KOG4173|consensus253 93.59
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.49
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.25
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.82
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.81
KOG2482|consensus423 92.55
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 91.07
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 89.94
KOG4173|consensus253 89.33
KOG2893|consensus 341 89.15
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 87.76
PF1371937 zinc_ribbon_5: zinc-ribbon domain 87.75
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.57
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 87.53
COG404965 Uncharacterized protein containing archaeal-type C 87.48
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 87.1
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 87.01
PRK04023 1121 DNA polymerase II large subunit; Validated 87.01
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 86.52
KOG2893|consensus 341 86.3
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.16
KOG1842|consensus 505 86.08
KOG4124|consensus442 85.51
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.5
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 84.84
PF0135241 KRAB: KRAB box; InterPro: IPR001909 The Krueppel-a 84.81
COG404965 Uncharacterized protein containing archaeal-type C 84.62
COG1198 730 PriA Primosomal protein N' (replication factor Y) 83.4
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 82.64
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 81.87
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 81.82
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 81.57
PHA0062659 hypothetical protein 81.48
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 80.73
smart00531147 TFIIE Transcription initiation factor IIE. 80.72
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 80.61
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 80.26
>KOG1074|consensus Back     alignment and domain information
Probab=100.00  E-value=6.4e-36  Score=276.10  Aligned_cols=149  Identities=35%  Similarity=0.735  Sum_probs=133.1

Q ss_pred             eecCccCCccCCHHHHHHHHHHcCCCCCcccCCCccccCChHHHHHHHHHhCCC----Cceecc---ccCcccCChhHHH
Q psy14386        196 YECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPRSFKTKQTLLDHENRHMGV----KPYSCE---ICGRGFITKGLCK  268 (344)
Q Consensus       196 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~----k~~~C~---~C~k~f~~~~~L~  268 (344)
                      -+|-+|.+...-++.|+.|.|+|+|++||+|.+||+.|.++.+|+.||-+|...    -+|.|+   +|.+.|.+.-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            789999999999999999999999999999999999999999999999998644    458999   9999999999999


Q ss_pred             HHHhhhcCCCC-----------CCcCCCCCCCccCCCC------------------------------------------
Q psy14386        269 SHQKIHSGNDN-----------RQYPCPVCKKLFVSKS------------------------------------------  295 (344)
Q Consensus       269 ~H~~~h~~~~~-----------~~~~C~~C~~~f~~~~------------------------------------------  295 (344)
                      .|+++|.+...           .--+|..|.+.|..-.                                          
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            99999984211           1125777777763210                                          


Q ss_pred             --------------------------------------------------------------------------------
Q psy14386        296 --------------------------------------------------------------------------------  295 (344)
Q Consensus       296 --------------------------------------------------------------------------------  295 (344)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             ------------------------------------CcccccccCChhhHHHHHHHccCCCcccccccchhccChHHHHH
Q psy14386        296 ------------------------------------CNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMV  339 (344)
Q Consensus       296 ------------------------------------C~~C~k~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~  339 (344)
                                                          |..||+.|...++|..|+|+|+|+|||.|.+|+++|.++.+|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                                99999999999999999999999999999999999999999999


Q ss_pred             HhhhC
Q psy14386        340 HKKKH  344 (344)
Q Consensus       340 H~~~H  344 (344)
                      ||.+|
T Consensus       926 HMgtH  930 (958)
T KOG1074|consen  926 HMGTH  930 (958)
T ss_pred             hhccc
Confidence            99988



>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG1842|consensus Back     alignment and domain information
>KOG4124|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF01352 KRAB: KRAB box; InterPro: IPR001909 The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) [] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-32
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-12
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-11
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 4e-12
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-10
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-10
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-10
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-10
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 6e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-08
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 8e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-04
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 8e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 8e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-07
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-07
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 9e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 7e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-06
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 9e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 8e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 8e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2ytp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 136 bits (343), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 70/180 (38%), Positives = 97/180 (53%), Gaps = 14/180 (7%) Query: 165 DKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPY 224 +KP+ C +C K F L EH+ HTG Y+C CGK F +K L HQR H+ +KPY Sbjct: 19 EKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPY 78 Query: 225 ACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPC 284 C C +SF + L H+ H G KPY+C CG+ F ++HQ+ H+G + Y C Sbjct: 79 KCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTG--EKPYKC 136 Query: 285 PVCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH 344 P CG+SF++ + H+R HTGE+PY C C K+F R L VH++ H Sbjct: 137 PE------------CGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH 184
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YTP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 687- 719) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-51
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-45
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-43
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-41
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-40
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-23
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-31
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-31
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-30
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-30
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-16
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-26
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 9e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 8e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 9e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 9e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 8e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  167 bits (425), Expect = 5e-51
 Identities = 69/179 (38%), Positives = 96/179 (53%), Gaps = 14/179 (7%)

Query: 166 KPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYA 225
           KP+ C +C K F     L EH+  HTG   Y+C  CGK F +K  L  HQR H+ +KPY 
Sbjct: 20  KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK 79

Query: 226 CKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCP 285
           C  C +SF  +  L  H+  H G KPY+C  CG+ F      ++HQ+ H+G         
Sbjct: 80  CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTG--------- 130

Query: 286 VCKKLFVSKSCNICGQSFTQFSPMAIHKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH 344
             +K +    C  CG+SF++   +  H+R HTGE+PY C  C K+F  R  L VH++ H
Sbjct: 131 --EKPYK---CPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.84
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.84
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.83
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.83
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.82
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.82
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.81
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.79
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.77
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.76
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.74
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.73
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.71
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.68
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.67
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.66
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.66
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.65
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.64
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.64
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.63
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.63
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.61
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.59
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.59
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.59
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.57
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.56
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.54
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.54
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.53
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.52
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.52
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.52
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.52
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.52
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.48
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.47
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.46
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.45
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.42
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.4
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.38
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.34
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.33
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.32
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.31
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.31
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.31
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.29
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.28
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.24
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.24
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.23
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.22
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.21
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.19
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.18
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.17
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.16
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.15
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.15
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.14
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.1
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.04
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.99
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.97
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.92
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.92
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.91
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.91
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.9
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.88
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.86
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.79
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.76
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.69
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.65
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.65
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.64
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.63
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.62
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.52
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.51
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.49
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.49
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.48
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.46
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.45
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.42
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.41
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.4
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.4
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.75
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.38
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.38
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.36
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.36
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.36
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.36
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.34
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.34
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.33
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.33
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.32
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.3
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.3
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.3
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.29
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.28
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.61
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.26
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.57
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.55
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.22
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.54
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.52
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.18
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.16
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.07
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.03
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.74
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.64
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.32
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.23
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.16
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.9
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.88
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.65
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.7
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.65
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 92.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.42
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 90.2
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.35
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.04
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.78
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 83.34
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 83.13
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 82.3
2k5c_A95 Uncharacterized protein PF0385; structural genomic 81.68
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.51
2yqq_A56 Zinc finger HIT domain-containing protein 3; struc 81.2
2dkt_A143 Ring finger and CHY zinc finger domain- containing 80.81
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.61
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.58
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=4.5e-42  Score=284.28  Aligned_cols=179  Identities=39%  Similarity=0.813  Sum_probs=129.1

Q ss_pred             HHHHHHHHHhcCCCCccccccccccccChHHHHHHHHHhcCCCceecCccCCccCCHHHHHHHHHHcCCCCCcccCCCcc
Q psy14386        152 LAKYNFHVSNHGVDKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVHSTDKPYACKTCPR  231 (344)
Q Consensus       152 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  231 (344)
                      ...|..|+..|.++++|.|+.|++.|.....|..|++.|.+.++|.|+.|++.|.....|..|+++|.++++|.|+.|++
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   85 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGK   85 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCC
T ss_pred             hccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCC
Confidence            34577788888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             ccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhhcCCCCCCcCCCCCCCccCCCCCcccccccCChhhHHH
Q psy14386        232 SFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIHSGNDNRQYPCPVCKKLFVSKSCNICGQSFTQFSPMAI  311 (344)
Q Consensus       232 ~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~~~C~~C~~~f~~~~C~~C~k~f~~~~~L~~  311 (344)
                      .|.+...|..|+++|+++++|.|+.|++.|.+...|..|+++|+++  ++|.|            ++||+.|...+.|..
T Consensus        86 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~--~~~~C------------~~C~~~f~~~~~L~~  151 (190)
T 2i13_A           86 SFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGE--KPYKC------------PECGKSFSREDNLHT  151 (190)
T ss_dssp             EESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCC--CCEEC------------TTTCCEESCHHHHHH
T ss_pred             ccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCC--CCeEC------------CCCCcccCCHHHHHH
Confidence            8888888888888888888888888888888888888888888876  77764            455667777788888


Q ss_pred             HHHHccCCCcccccccchhccChHHHHHHhhhC
Q psy14386        312 HKRLHTGERPYSCELCNKAFVSRSTLMVHKKKH  344 (344)
Q Consensus       312 H~~~H~~~k~~~C~~C~~~f~~~~~L~~H~~~H  344 (344)
                      |+++|++++||+|++|+++|.+...|..|+++|
T Consensus       152 H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H  184 (190)
T 2i13_A          152 HQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH  184 (190)
T ss_dssp             HHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC
T ss_pred             HHHhcCCCCCeECCCCCCccCCHHHHHHHHHhc
Confidence            888888888888888888888888888888877



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2yqq_A Zinc finger HIT domain-containing protein 3; structure genomics, ZF-HIT domain, TRIP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.002
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.004
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.6 bits (123), Expect = 1e-09
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 165 DKPFQCFKCEKRFRSKLGLDEHEAKHTGRYEYECNACGKGFQNKSYLIVHQRVH 218
           DK + C +C K F  K   D H + H G   Y C  CGK F+ K +L+ H ++H
Sbjct: 1   DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.68
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.41
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.37
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.34
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.33
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.32
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.31
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.29
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.29
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.25
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.24
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.23
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.16
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.12
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.1
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.07
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.05
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.03
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.99
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.93
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.92
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.89
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.79
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.72
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.71
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.65
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.63
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.63
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.47
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.23
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.23
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.19
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.09
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.05
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.0
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.99
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.93
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.9
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.9
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.87
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.83
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.77
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.74
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.74
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.73
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.72
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.65
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.64
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.6
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.59
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.51
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.51
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.45
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.36
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.21
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.2
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.13
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.12
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.07
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.99
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.94
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.68
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.67
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.66
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.52
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.41
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.34
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.32
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.98
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.81
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.62
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.44
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.23
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.23
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.22
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.17
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.1
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.95
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.68
d1y0jb136 U-shaped transcription factor, different fingers { 94.31
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.05
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.76
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.45
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.43
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.36
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.14
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.85
d1y0jb136 U-shaped transcription factor, different fingers { 91.83
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.79
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.31
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.79
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.75
d1v65a_64 hypotheical protein 2610044O15Rik {Mouse (Mus musc 89.68
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.56
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.62
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.53
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.33
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 86.7
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 86.44
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.21
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.17
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.64
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=1.3e-18  Score=109.25  Aligned_cols=53  Identities=42%  Similarity=0.853  Sum_probs=45.1

Q ss_pred             CCCcccCCCccccCChHHHHHHHHHhCCCCceeccccCcccCChhHHHHHHhhh
Q psy14386        221 DKPYACKTCPRSFKTKQTLLDHENRHMGVKPYSCEICGRGFITKGLCKSHQKIH  274 (344)
Q Consensus       221 ~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~h  274 (344)
                      ||||.| .||++|.....|..|+++|+|++||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            578888 48888888888888888888888888888888888888888888876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v65a_ a.212.1.1 (A:) hypotheical protein 2610044O15Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure