Psyllid ID: psy14393


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS
cccccccHHHHHHHHHcccccccccEEEEEccccccccccEEEEEEcccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcc
ccccHccccccHHHHcccHHHHHccEEEEEccccccccccEEEEEEccccEEEEEEEccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcc
mldeeiggsqgmsLFVTTDAFKKMNvgcaldegiaspTEVFALFNGERTIWQmkihcpgtpghgsllhentAAEKVNYIMNKFLALREEEKNKLkanknltigdvTTINITMLS
mldeeiggsqgmSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEKnklkanknltigdvttinitmls
MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFlalreeeknklkanknlTIGDVTTINITMLS
************SLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREE****LKANKNLTIGDVTTINI****
MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEK*****N*NLTIGDVTTINITMLS
********SQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS
*****IGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
P37111 407 Aminoacylase-1 OS=Sus scr yes N/A 0.964 0.270 0.504 9e-28
Q6AYS7 408 Aminoacylase-1A OS=Rattus yes N/A 0.973 0.272 0.468 3e-26
Q03154 408 Aminoacylase-1 OS=Homo sa no N/A 0.973 0.272 0.477 3e-26
Q6PTT0 408 Aminoacylase-1B OS=Rattus no N/A 0.973 0.272 0.468 6e-26
Q99JW2 408 Aminoacylase-1 OS=Mus mus yes N/A 0.973 0.272 0.459 1e-25
Q5RFB0 408 Aminoacylase-1 OS=Pongo a yes N/A 0.973 0.272 0.468 2e-25
Q55DP8 408 Aminoacylase-1 OS=Dictyos yes N/A 0.973 0.272 0.469 2e-21
>sp|P37111|ACY1_PIG Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2 Back     alignment and function desciption
 Score =  122 bits (305), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 3   DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
           DEE+GG QGM LFV    F+ +  G ALDEG+ASPT+ F +F  ER+ W +++   G PG
Sbjct: 146 DEEVGGHQGMELFVKRPEFQALRAGFALDEGLASPTDAFTVFYSERSPWWLRVTSTGKPG 205

Query: 63  HGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITML 113
           HGS   E+TAAEK++ ++N  LA RE+EK +L++N+ L  G VT++N+TML
Sbjct: 206 HGSRFIEDTAAEKLHKVINSILAFREKEKQRLQSNQ-LKPGAVTSVNLTML 255




Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
Sus scrofa (taxid: 9823)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 Back     alignment and function description
>sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 Back     alignment and function description
>sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 Back     alignment and function description
>sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 Back     alignment and function description
>sp|Q55DP8|ACY1_DICDI Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
91090496 411 PREDICTED: similar to aminoacylase, puta 0.982 0.272 0.642 1e-37
357630813 399 hypothetical protein KGM_00092 [Danaus p 0.973 0.278 0.630 2e-35
114052174 411 aminoacylase [Bombyx mori] gi|87248447|g 0.982 0.272 0.598 6e-33
432857165 419 PREDICTED: aminoacylase-1A-like [Oryzias 0.973 0.264 0.558 6e-33
410919749 419 PREDICTED: aminoacylase-1A-like [Takifug 0.973 0.264 0.585 1e-32
348534238 419 PREDICTED: aminoacylase-1A-like [Oreochr 0.973 0.264 0.549 2e-32
340726792 401 PREDICTED: aminoacylase-1-like [Bombus t 0.964 0.274 0.576 1e-31
350421698 401 PREDICTED: aminoacylase-1-like [Bombus i 0.964 0.274 0.567 2e-31
326927775 392 PREDICTED: aminoacylase-1-like, partial 0.973 0.283 0.531 2e-31
363738588 413 PREDICTED: aminoacylase-1-like isoform 1 0.973 0.268 0.522 7e-31
>gi|91090496|ref|XP_969212.1| PREDICTED: similar to aminoacylase, putative [Tribolium castaneum] gi|270013867|gb|EFA10315.1| hypothetical protein TcasGA2_TC012531 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 85/112 (75%)

Query: 3   DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
           DEEIGG  GM  FV T  FK +NVG ALDEG+ASP E FA+FNGER IW + IHCPG PG
Sbjct: 150 DEEIGGEDGMRKFVHTKEFKDLNVGFALDEGMASPNEEFAVFNGERCIWHLHIHCPGQPG 209

Query: 63  HGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS 114
           HGSLL +NTA EKV Y++NKF   R +EK KLK N + TIGDVTT+N+T ++
Sbjct: 210 HGSLLLDNTAGEKVTYLLNKFFEFRRQEKKKLKDNPSRTIGDVTTVNLTQMT 261




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357630813|gb|EHJ78690.1| hypothetical protein KGM_00092 [Danaus plexippus] Back     alignment and taxonomy information
>gi|114052174|ref|NP_001040228.1| aminoacylase [Bombyx mori] gi|87248447|gb|ABD36276.1| aminoacylase [Bombyx mori] Back     alignment and taxonomy information
>gi|432857165|ref|XP_004068561.1| PREDICTED: aminoacylase-1A-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|410919749|ref|XP_003973346.1| PREDICTED: aminoacylase-1A-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|348534238|ref|XP_003454610.1| PREDICTED: aminoacylase-1A-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|340726792|ref|XP_003401737.1| PREDICTED: aminoacylase-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350421698|ref|XP_003492928.1| PREDICTED: aminoacylase-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|326927775|ref|XP_003210064.1| PREDICTED: aminoacylase-1-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|363738588|ref|XP_003642033.1| PREDICTED: aminoacylase-1-like isoform 1 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
ZFIN|ZDB-GENE-040426-755 420 acy1 "aminoacylase 1" [Danio r 0.973 0.264 0.477 4.6e-25
FB|FBgn0039049 413 CG6726 [Drosophila melanogaste 0.973 0.268 0.468 4.3e-23
FB|FBgn0039050 402 CG17110 [Drosophila melanogast 0.982 0.278 0.464 4.5e-23
FB|FBgn0037818 401 CG6465 [Drosophila melanogaste 0.973 0.276 0.486 1.3e-22
FB|FBgn0039053 401 CG6738 [Drosophila melanogaste 0.982 0.279 0.482 1.7e-22
FB|FBgn0039052 401 CG6733 [Drosophila melanogaste 0.982 0.279 0.473 6.7e-22
FB|FBgn0039051 400 CG17109 [Drosophila melanogast 0.982 0.28 0.455 5.6e-21
UNIPROTKB|P37111 407 ACY1 "Aminoacylase-1" [Sus scr 0.964 0.270 0.423 5.3e-19
WB|WBGene00007507 399 C10C5.3 [Caenorhabditis elegan 0.982 0.280 0.419 8.2e-19
WB|WBGene00007509 397 C10C5.5 [Caenorhabditis elegan 0.982 0.282 0.410 1.3e-18
ZFIN|ZDB-GENE-040426-755 acy1 "aminoacylase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 4.6e-25, P = 4.6e-25
 Identities = 53/111 (47%), Positives = 71/111 (63%)

Query:     3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
             DEE+GG +GM  FV    F+K+N+G ALDEG+A+PT  + +F GER  W + + CPG+PG
Sbjct:   158 DEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPG 217

Query:    63 HGSLLHENTAAEKVNYIMNKFXXXXXXXXXXXXXXXXXTIGDVTTINITML 113
             HGS   ENTAAEK+  ++N F                 T+GDVTTIN+TM+
Sbjct:   218 HGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMV 268




GO:0005737 "cytoplasm" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0004046 "aminoacylase activity" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
FB|FBgn0039049 CG6726 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039050 CG17110 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037818 CG6465 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039053 CG6738 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039052 CG6733 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039051 CG17109 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P37111 ACY1 "Aminoacylase-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00007507 C10C5.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00007509 C10C5.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P37111ACY1_PIG3, ., 5, ., 1, ., 1, 40.50450.96490.2702yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
cd05646 391 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I lik 1e-58
TIGR01880 400 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid am 6e-46
pfam01546 310 pfam01546, Peptidase_M20, Peptidase family M20/M25 6e-04
cd08659 365 cd08659, M20_ArgE_DapE_like, Peptidase M20 acetylo 0.002
cd05675 426 cd05675, M20_yscS_like, M20 Peptidase, carboxypept 0.002
>gnl|CDD|193524 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I like subfamily Back     alignment and domain information
 Score =  184 bits (470), Expect = 1e-58
 Identities = 65/112 (58%), Positives = 83/112 (74%)

Query: 3   DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
           DEEIGG  GM  FV T+ FKK+NVG ALDEG+ASPTE + +F GER+ W + I   GTPG
Sbjct: 138 DEEIGGHDGMEKFVKTEEFKKLNVGFALDEGLASPTEEYRVFYGERSPWWVVITASGTPG 197

Query: 63  HGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS 114
           HGS L +NTA EK+  ++ KF+  REE+  +LK+N  LTIGDVT++N+TML 
Sbjct: 198 HGSKLLDNTAGEKLMKVIEKFMEFREEQFQRLKSNGKLTIGDVTSVNLTMLK 249


Peptidase M20 family, Aminoacylase-I like (AcyI-like; Acylase I; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14) subfamily. Acylase I is involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) and is considered as a potential target of antimicrobial agents. Porcine AcyI is also shown to deacetylate certain quorum-sensing N-acylhomoserine lactones, while the rat enzyme has been implicated in degradation of chemotactic peptides of commensal bacteria. Prokaryotic arginine synthesis usually involves the transfer of an acetyl group to glutamate by ornithine acetyltransferase in order to form ornithine. However, Escherichia coli acetylornithine deacetylase (acetylornithinase, ArgE) (EC 3.5.1.16) catalyzes the deacylation of N2-acetyl-L-ornithine to yield ornithine and acetate. Phylogenetic evidence suggests that the clustering of the arg genes in one continuous sequence pattern arose in an ancestor common to Enterobacteriaceae and Vibrionaceae, where ornithine acetyltransferase was lost and replaced by a deacylase. Length = 391

>gnl|CDD|233615 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information
>gnl|CDD|216562 pfam01546, Peptidase_M20, Peptidase family M20/M25/M40 Back     alignment and domain information
>gnl|CDD|193570 cd08659, M20_ArgE_DapE_like, Peptidase M20 acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (ArgE/DapE)-like Back     alignment and domain information
>gnl|CDD|193550 cd05675, M20_yscS_like, M20 Peptidase, carboxypeptidase yscS-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG2275|consensus 420 99.93
TIGR01880 400 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase 99.75
PRK08737 364 acetylornithine deacetylase; Provisional 99.55
PRK13013 427 succinyl-diaminopimelate desuccinylase; Reviewed 99.54
PRK09133 472 hypothetical protein; Provisional 99.51
PRK06915 422 acetylornithine deacetylase; Validated 99.51
PRK05111 383 acetylornithine deacetylase; Provisional 99.5
TIGR01910 375 DapE-ArgE acetylornithine deacetylase or succinyl- 99.49
PRK04443 348 acetyl-lysine deacetylase; Provisional 99.49
PRK08588 377 succinyl-diaminopimelate desuccinylase; Reviewed 99.48
PRK07522 385 acetylornithine deacetylase; Provisional 99.47
TIGR01892 364 AcOrn-deacetyl acetylornithine deacetylase (ArgE). 99.44
PRK00466 346 acetyl-lysine deacetylase; Validated 99.44
PRK13009 375 succinyl-diaminopimelate desuccinylase; Reviewed 99.42
PRK07906 426 hypothetical protein; Provisional 99.42
TIGR03320 395 ygeY M20/DapE family protein YgeY. Members of this 99.41
PRK08652 347 acetylornithine deacetylase; Provisional 99.41
PRK06446 436 hypothetical protein; Provisional 99.4
TIGR01900 373 dapE-gram_pos succinyl-diaminopimelate desuccinyla 99.39
TIGR03526 395 selenium_YgeY putative selenium metabolism hydrola 99.38
TIGR01246 370 dapE_proteo succinyl-diaminopimelate desuccinylase 99.38
PRK13983 400 diaminopimelate aminotransferase; Provisional 99.38
PRK08651 394 succinyl-diaminopimelate desuccinylase; Reviewed 99.36
PRK13007 352 succinyl-diaminopimelate desuccinylase; Reviewed 99.36
PRK06837 427 acetylornithine deacetylase; Provisional 99.35
PRK08262 486 hypothetical protein; Provisional 99.35
PRK09290 413 allantoate amidohydrolase; Reviewed 99.33
TIGR01891 363 amidohydrolases amidohydrolase. This model represe 99.33
PRK13004 399 peptidase; Reviewed 99.33
PRK07473 376 carboxypeptidase; Provisional 99.32
PRK08201 456 hypothetical protein; Provisional 99.27
TIGR01902 336 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine d 99.25
PRK12892 412 allantoate amidohydrolase; Reviewed 99.24
PLN02280 478 IAA-amino acid hydrolase 99.22
PRK12893 412 allantoate amidohydrolase; Reviewed 99.22
PRK12890 414 allantoate amidohydrolase; Reviewed 99.2
PRK07338 402 hypothetical protein; Provisional 99.19
PRK07907 449 hypothetical protein; Provisional 99.17
PRK06133 410 glutamate carboxypeptidase; Reviewed 99.13
PLN02693 437 IAA-amino acid hydrolase 99.13
PRK09104 464 hypothetical protein; Validated 99.13
TIGR01879 401 hydantase amidase, hydantoinase/carbamoylase famil 99.11
PRK13381 404 peptidase T; Provisional 99.1
PRK07318 466 dipeptidase PepV; Reviewed 99.07
TIGR01887 447 dipeptidaselike dipeptidase, putative. This model 99.05
PRK07079 469 hypothetical protein; Provisional 99.05
TIGR01886 466 dipeptidase dipeptidase PepV. This model represent 99.03
COG0624 409 ArgE Acetylornithine deacetylase/Succinyl-diaminop 98.99
PRK12891 414 allantoate amidohydrolase; Reviewed 98.99
TIGR01883 361 PepT-like peptidase T-like protein. This model rep 98.97
PRK08596 421 acetylornithine deacetylase; Validated 98.96
PRK07205 444 hypothetical protein; Provisional 98.95
PRK06156 520 hypothetical protein; Provisional 98.89
PF07687111 M20_dimer: Peptidase dimerisation domain This fami 98.82
PRK05469 408 peptidase T; Provisional 98.82
TIGR01882 410 peptidase-T peptidase T. This model represents a t 98.76
TIGR01893 477 aa-his-dipept aminoacyl-histidine dipeptidase. 98.63
PRK15026 485 aminoacyl-histidine dipeptidase; Provisional 98.59
COG1473 392 AbgB Metal-dependent amidase/aminoacylase/carboxyp 98.34
TIGR03176 406 AllC allantoate amidohydrolase. This enzyme cataly 98.29
PRK13799 591 unknown domain/N-carbamoyl-L-amino acid hydrolase 98.1
PRK08554 438 peptidase; Reviewed 97.93
PRK13590 591 putative bifunctional OHCU decarboxylase/allantoat 97.88
COG2195 414 PepD Di- and tripeptidases [Amino acid transport a 92.93
COG4187 553 RocB Arginine degradation protein (predicted deacy 89.87
PF01546189 Peptidase_M20: Peptidase family M20/M25/M40 This f 88.53
KOG2276|consensus 473 83.25
>KOG2275|consensus Back     alignment and domain information
Probab=99.93  E-value=6.3e-26  Score=180.57  Aligned_cols=114  Identities=40%  Similarity=0.677  Sum_probs=108.6

Q ss_pred             CCccCcCcccchHHhhcccccccCCeeEEEecCcccCCCcceeeecccceEEEEEEEeccCCCcCCCCCCCHHHHHHHHH
Q psy14393          1 MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIM   80 (114)
Q Consensus         1 ~~DEE~Gg~~G~~~l~~~~~~~~~~~~~~idEG~~~~~~~~~i~~aeKG~~~~~v~v~G~~gHsS~P~~~nAi~~~~~~i   80 (114)
                      ++|||+||..|++-+++..+|++++.++++|||+..+...+.++++|||.||++|+++|++||||.|++++|++++.++|
T Consensus       160 vpDEEi~G~~Gm~~fa~~~~~~~l~~~filDEG~~se~d~~~vfyaEkg~w~~~v~~~G~~GHss~~~~nTa~~~l~klv  239 (420)
T KOG2275|consen  160 VPDEEIGGHIGMKEFAKTEEFKKLNLGFILDEGGATENDFATVFYAEKGPWWLKVTANGTPGHSSYPPPNTAIEKLEKLV  239 (420)
T ss_pred             cCchhccCcchHHHHhhhhhhcccceeEEecCCCCCcccceeEEEEeeceeEEEEEecCCCCCCCCCCCccHHHHHHHHH
Confidence            58999999999999999778999999999999988888888899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhhCCCCCccceeeeeeeccC
Q psy14393         81 NKFLALREEEKNKLKANKNLTIGDVTTINITMLS  114 (114)
Q Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~  114 (114)
                      +.+.++|++|.+.+.+++.++.+++|++|++.+|
T Consensus       240 ~~~~~fr~~q~~~l~~~p~~~~~~vtT~Nv~~i~  273 (420)
T KOG2275|consen  240 ESLEEFREKQVDLLASGPKLALGDVTTINVGIIN  273 (420)
T ss_pred             HHHHHhHHHHHHHhhcCCceeccceeEEeeeeee
Confidence            9999999999999999999999999999999875



>TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information
>PRK08737 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK09133 hypothetical protein; Provisional Back     alignment and domain information
>PRK06915 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK05111 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>PRK04443 acetyl-lysine deacetylase; Provisional Back     alignment and domain information
>PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK07522 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE) Back     alignment and domain information
>PRK00466 acetyl-lysine deacetylase; Validated Back     alignment and domain information
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK07906 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03320 ygeY M20/DapE family protein YgeY Back     alignment and domain information
>PRK08652 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK06446 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>TIGR03526 selenium_YgeY putative selenium metabolism hydrolase Back     alignment and domain information
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade Back     alignment and domain information
>PRK13983 diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK06837 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK08262 hypothetical protein; Provisional Back     alignment and domain information
>PRK09290 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR01891 amidohydrolases amidohydrolase Back     alignment and domain information
>PRK13004 peptidase; Reviewed Back     alignment and domain information
>PRK07473 carboxypeptidase; Provisional Back     alignment and domain information
>PRK08201 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase Back     alignment and domain information
>PRK12892 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PLN02280 IAA-amino acid hydrolase Back     alignment and domain information
>PRK12893 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12890 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK07338 hypothetical protein; Provisional Back     alignment and domain information
>PRK07907 hypothetical protein; Provisional Back     alignment and domain information
>PRK06133 glutamate carboxypeptidase; Reviewed Back     alignment and domain information
>PLN02693 IAA-amino acid hydrolase Back     alignment and domain information
>PRK09104 hypothetical protein; Validated Back     alignment and domain information
>TIGR01879 hydantase amidase, hydantoinase/carbamoylase family Back     alignment and domain information
>PRK13381 peptidase T; Provisional Back     alignment and domain information
>PRK07318 dipeptidase PepV; Reviewed Back     alignment and domain information
>TIGR01887 dipeptidaselike dipeptidase, putative Back     alignment and domain information
>PRK07079 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01886 dipeptidase dipeptidase PepV Back     alignment and domain information
>COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12891 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR01883 PepT-like peptidase T-like protein Back     alignment and domain information
>PRK08596 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK07205 hypothetical protein; Provisional Back     alignment and domain information
>PRK06156 hypothetical protein; Provisional Back     alignment and domain information
>PF07687 M20_dimer: Peptidase dimerisation domain This family only corresponds to M20 family; InterPro: IPR011650 This domain consists of 4 beta strands and two alpha helices which make up the dimerisation surface of members of the MEROPS peptidase family M20 [] Back     alignment and domain information
>PRK05469 peptidase T; Provisional Back     alignment and domain information
>TIGR01882 peptidase-T peptidase T Back     alignment and domain information
>TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase Back     alignment and domain information
>PRK15026 aminoacyl-histidine dipeptidase; Provisional Back     alignment and domain information
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] Back     alignment and domain information
>TIGR03176 AllC allantoate amidohydrolase Back     alignment and domain information
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional Back     alignment and domain information
>PRK08554 peptidase; Reviewed Back     alignment and domain information
>PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional Back     alignment and domain information
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01546 Peptidase_M20: Peptidase family M20/M25/M40 This family only corresponds to M20 family; InterPro: IPR002933 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2276|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1q7l_A198 Zn-binding Domain Of The T347g Mutant Of Human Amin 7e-12
>pdb|1Q7L|A Chain A, Zn-binding Domain Of The T347g Mutant Of Human Aminoacylase- I Length = 198 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 27/53 (50%), Positives = 36/53 (67%) Query: 3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKI 55 DEE+GG QGM LFV F + G ALDEGIA+PT+ F +F ER+ W +++ Sbjct: 146 DEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV 198

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, si 5e-14
1lfw_A 470 PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac 3e-05
2rb7_A 364 Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat 3e-04
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Length = 198 Back     alignment and structure
 Score = 63.6 bits (155), Expect = 5e-14
 Identities = 27/53 (50%), Positives = 36/53 (67%)

Query: 3   DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKI 55
           DEE+GG QGM LFV    F  +  G ALDEGIA+PT+ F +F  ER+ W +++
Sbjct: 146 DEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV 198


>1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 Length = 470 Back     alignment and structure
>2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} Length = 364 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
2f7v_A 369 Aectylcitrulline deacetylase; alpha/beta, hydrolas 99.41
2rb7_A 364 Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat 99.34
3pfo_A 433 Putative acetylornithine deacetylase; metal bindin 99.34
3ct9_A 356 Acetylornithine deacetylase; NP_812461.1, A putati 99.34
1vgy_A 393 Succinyl-diaminopimelate desuccinylase; structural 99.32
3ram_A 394 HMRA protein; two-domain, catalytic (alpha-beta-al 99.3
3isz_A 377 Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b 99.26
3tx8_A 369 Succinyl-diaminopimelate desuccinylase; peptidase, 99.25
1xmb_A 418 IAA-amino acid hydrolase homolog 2; structural gen 99.2
1ysj_A 404 Protein YXEP; M20 family peptidase, dinuclear meta 99.11
1cg2_A 393 Carboxypeptidase G2; metallocarboxypeptidase, hydr 99.1
3pfe_A 472 Succinyl-diaminopimelate desuccinylase; metal bind 99.03
3ife_A 434 Peptidase T; metallopeptidase, aminopeptidase, hyd 99.03
3io1_A 445 Aminobenzoyl-glutamate utilization protein; peptid 99.03
2pok_A 481 Peptidase, M20/M25/M40 family; M20 family peptidas 98.99
3khx_A 492 Putative dipeptidase sacol1801; DAPE, metallopepti 98.98
1fno_A 417 Peptidase T; metallo peptidase, protease, hydrolas 98.96
3rza_A 396 Tripeptidase; phosphorylase/hydrolase-like, struct 98.9
2zog_A 479 Cytosolic non-specific dipeptidase; metallopeptida 98.89
1z2l_A 423 Allantoate amidohydrolase; ALLC, purine cataboli a 98.89
2qyv_A 487 XAA-His dipeptidase; YP_718209.1, structural genom 98.87
3n5f_A 408 L-carbamoylase, N-carbamoyl-L-amino acid hydrolase 98.84
2v8h_A 474 Beta-alanine synthase; amidohydrolase, alpha and b 98.82
3gb0_A 373 Peptidase T; NP_980509.1, aminopeptidase PEPT, pep 98.81
3dlj_A 485 Beta-Ala-His dipeptidase; CNDP1, carnosine dipepti 98.76
3mru_A 490 Aminoacyl-histidine dipeptidase; metalloprotease, 98.75
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, si 98.74
1lfw_A 470 PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac 98.44
4h2k_A269 Succinyl-diaminopimelate desuccinylase; DAPE, MCSG 95.04
3t68_A268 Succinyl-diaminopimelate desuccinylase; DAPE, csgi 93.26
2fvg_A340 Endoglucanase; TM1049, structural genomics, joint 92.13
>2f7v_A Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1.75A {Xanthomonas campestris} PDB: 2f8h_A Back     alignment and structure
Probab=99.41  E-value=4.7e-13  Score=103.46  Aligned_cols=80  Identities=23%  Similarity=0.209  Sum_probs=60.4

Q ss_pred             CCccCcCcccchHHhhcccccccCCeeEEEecCcccCCCcceeeecccceEEEEEEEeccCCCcCCCC--CCCHHHHHHH
Q psy14393          1 MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLH--ENTAAEKVNY   78 (114)
Q Consensus         1 ~~DEE~Gg~~G~~~l~~~~~~~~~~~~~~idEG~~~~~~~~~i~~aeKG~~~~~v~v~G~~gHsS~P~--~~nAi~~~~~   78 (114)
                      ++|||.||..|+++++++..    ++++++.   .+|+ ...+.+++||..+++|+++|+++|||.|+  +.|||..+++
T Consensus       130 ~~~EE~~g~~G~~~~~~~~~----~~d~~i~---~e~~-~~~i~~~~~g~~~~~i~v~G~~~Ha~~p~~~g~nAi~~~~~  201 (369)
T 2f7v_A          130 SSDEEANDPRCIAAFLARGL----PYDAVLV---AEPT-MSEAVLAHRGISSVLMRFAGRAGHASGKQDPAASALHQAMR  201 (369)
T ss_dssp             ESCTTSSSCCHHHHHHTTCC----CCSEEEE---CCCS-TTCBBCCBCCEEEEEEEEECCCC------CTTSCHHHHHHH
T ss_pred             EeCcccCCCcCHHHHHhcCC----CCCEEEE---CCCC-CCcceeecCceEEEEEEEeeeCcccCCCCcCCCCHHHHHHH
Confidence            47999955689999998632    2677774   4554 35678999999999999999999999997  4999999999


Q ss_pred             HHHHHHHHHH
Q psy14393         79 IMNKFLALRE   88 (114)
Q Consensus        79 ~i~~l~~~~~   88 (114)
                      ++.+|+++..
T Consensus       202 ~i~~l~~~~~  211 (369)
T 2f7v_A          202 WGGKALDHVE  211 (369)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHhhhh
Confidence            9999977654



>2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} Back     alignment and structure
>3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20 structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>3ram_A HMRA protein; two-domain, catalytic (alpha-beta-alpha) motif, tetramerisat (alpha,beta,BETA,alpha), endoprotease, hydrolase; 2.70A {Staphylococcus aureus} Back     alignment and structure
>3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2, protein struc initiative; 2.00A {Haemophilus influenzae} PDB: 3ic1_A Back     alignment and structure
>3tx8_A Succinyl-diaminopimelate desuccinylase; peptidase, structural genomics, joint center for structural JCSG; 2.97A {Corynebacterium glutamicum} Back     alignment and structure
>1xmb_A IAA-amino acid hydrolase homolog 2; structural genomics, protein structure initiative, CESG AT5G56660, ILL2, indole-3-acetic acid, auxin; 2.00A {Arabidopsis thaliana} SCOP: c.56.5.4 d.58.19.1 PDB: 2q43_A Back     alignment and structure
>1ysj_A Protein YXEP; M20 family peptidase, dinuclear metal binding, structural GE PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>1cg2_A Carboxypeptidase G2; metallocarboxypeptidase, hydrolase; 2.50A {Pseudomonas SP} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>3pfe_A Succinyl-diaminopimelate desuccinylase; metal binding, merops M20 familiy, phosphorylase/hydrolase-L structural genomics; HET: MSE; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3ife_A Peptidase T; metallopeptidase, aminopeptidase, hydro metal-binding, metalloprotease, protease; HET: SUC; 1.55A {Bacillus anthracis} Back     alignment and structure
>3io1_A Aminobenzoyl-glutamate utilization protein; peptidase_M20D superfamily, protein structure initiative II, NYSGXRC, structural genomics; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural GENO PSI-2, protein structure initiative; HET: BGC; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>3khx_A Putative dipeptidase sacol1801; DAPE, metallopeptidase, hydrolase, metal-bindin metalloprotease, protease; 2.30A {Staphylococcus aureus} PDB: 3ki9_A 3khz_A Back     alignment and structure
>1fno_A Peptidase T; metallo peptidase, protease, hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.56.5.4 d.58.19.1 PDB: 1vix_A Back     alignment and structure
>3rza_A Tripeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: CIT PG4 PGE; 2.10A {Staphylococcus aureus subsp} Back     alignment and structure
>2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP DIP 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* Back     alignment and structure
>1z2l_A Allantoate amidohydrolase; ALLC, purine cataboli allantoin utilization, structural genomics, PSI, Pro structure initiative; HET: 1AL; 2.25A {Escherichia coli} SCOP: c.56.5.4 d.58.19.1 PDB: 2imo_A Back     alignment and structure
>2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; 2.11A {Haemophilus somnus 129PT} Back     alignment and structure
>3n5f_A L-carbamoylase, N-carbamoyl-L-amino acid hydrolase; hinge domain, M20 peptidase family, evolution, residue, dimerization domain; 2.75A {Bacillus stearothermophilus} Back     alignment and structure
>2v8h_A Beta-alanine synthase; amidohydrolase, alpha and beta protein, DI-zinc center, COMP N-carbamyl-beta-alanine, hydrolase; HET: BCN; 2.0A {Saccharomyces kluyveri} PDB: 2v8d_A* 2vl1_A 2v8g_A 2v8v_A 1r43_A 1r3n_A Back     alignment and structure
>3gb0_A Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M structural genomics, joint center for structural genomics; 2.04A {Bacillus cereus atcc 10987} Back     alignment and structure
>3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structu genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} Back     alignment and structure
>3mru_A Aminoacyl-histidine dipeptidase; metalloprotease, homodimer, hydrolase; 3.00A {Vibrio alginolyticus} Back     alignment and structure
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Back     alignment and structure
>1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>4h2k_A Succinyl-diaminopimelate desuccinylase; DAPE, MCSG, PSI-biology, structural genomics, midwest center structural genomics, hydrolase; 1.84A {Haemophilus influenzae} Back     alignment and structure
>3t68_A Succinyl-diaminopimelate desuccinylase; DAPE, csgid, metalloenzyme, structural genomics; 1.65A {Vibrio cholerae o1 biovar el tor} PDB: 3t6m_A Back     alignment and structure
>2fvg_A Endoglucanase; TM1049, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.01A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
g1q7l.1280 c.56.5.4 (A:,B:) Aminoacylase-1, catalytic domain 2e-14

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
g1q7l.1280 Aminoacylase-1, catalytic domain {Human (Homo sapi 98.96
d1vgya2113 Succinyl-diaminopimelate desuccinylase {Neisseria 98.7
d1ysja2115 Protein YxeP {Bacillus subtilis [TaxId: 1423]} 98.47
d1xmba2119 IAA-amino acid hydrolase {Mouse-ear cress (Arabido 98.37
d1lfwa2196 Aminopeptidase PepV {Lactobacillus delbrueckii [Ta 98.35
d1cg2a2113 Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 98.32
d1z2la2117 Allantoate amidohydrolase AllC {Escherichia coli [ 98.16
d1r3na2116 Peptidase-like beta-alanine synthase {Yeast (Sacch 98.11
d1vgya1262 Succinyl-diaminopimelate desuccinylase, catalytic 96.51
d1lfwa1272 Aminopeptidase PepV {Lactobacillus delbrueckii [Ta 90.36
d1fnoa3113 Peptidase T (tripeptidase) {Salmonella typhimurium 85.39
>d1vgya2 d.58.19.1 (A:181-293) Succinyl-diaminopimelate desuccinylase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lfwa2 d.58.19.1 (A:187-382) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} Back     information, alignment and structure
>d1cg2a2 d.58.19.1 (A:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]} Back     information, alignment and structure
>d1z2la2 d.58.19.1 (A:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r3na2 d.58.19.1 (A:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1vgya1 c.56.5.4 (A:2-180,A:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} Back     information, alignment and structure
>d1fnoa3 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure