Psyllid ID: psy14393
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| 91090496 | 411 | PREDICTED: similar to aminoacylase, puta | 0.982 | 0.272 | 0.642 | 1e-37 | |
| 357630813 | 399 | hypothetical protein KGM_00092 [Danaus p | 0.973 | 0.278 | 0.630 | 2e-35 | |
| 114052174 | 411 | aminoacylase [Bombyx mori] gi|87248447|g | 0.982 | 0.272 | 0.598 | 6e-33 | |
| 432857165 | 419 | PREDICTED: aminoacylase-1A-like [Oryzias | 0.973 | 0.264 | 0.558 | 6e-33 | |
| 410919749 | 419 | PREDICTED: aminoacylase-1A-like [Takifug | 0.973 | 0.264 | 0.585 | 1e-32 | |
| 348534238 | 419 | PREDICTED: aminoacylase-1A-like [Oreochr | 0.973 | 0.264 | 0.549 | 2e-32 | |
| 340726792 | 401 | PREDICTED: aminoacylase-1-like [Bombus t | 0.964 | 0.274 | 0.576 | 1e-31 | |
| 350421698 | 401 | PREDICTED: aminoacylase-1-like [Bombus i | 0.964 | 0.274 | 0.567 | 2e-31 | |
| 326927775 | 392 | PREDICTED: aminoacylase-1-like, partial | 0.973 | 0.283 | 0.531 | 2e-31 | |
| 363738588 | 413 | PREDICTED: aminoacylase-1-like isoform 1 | 0.973 | 0.268 | 0.522 | 7e-31 |
| >gi|91090496|ref|XP_969212.1| PREDICTED: similar to aminoacylase, putative [Tribolium castaneum] gi|270013867|gb|EFA10315.1| hypothetical protein TcasGA2_TC012531 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 160 bits (404), Expect = 1e-37, Method: Composition-based stats.
Identities = 72/112 (64%), Positives = 85/112 (75%)
Query: 3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
DEEIGG GM FV T FK +NVG ALDEG+ASP E FA+FNGER IW + IHCPG PG
Sbjct: 150 DEEIGGEDGMRKFVHTKEFKDLNVGFALDEGMASPNEEFAVFNGERCIWHLHIHCPGQPG 209
Query: 63 HGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS 114
HGSLL +NTA EKV Y++NKF R +EK KLK N + TIGDVTT+N+T ++
Sbjct: 210 HGSLLLDNTAGEKVTYLLNKFFEFRRQEKKKLKDNPSRTIGDVTTVNLTQMT 261
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357630813|gb|EHJ78690.1| hypothetical protein KGM_00092 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|114052174|ref|NP_001040228.1| aminoacylase [Bombyx mori] gi|87248447|gb|ABD36276.1| aminoacylase [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|432857165|ref|XP_004068561.1| PREDICTED: aminoacylase-1A-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|410919749|ref|XP_003973346.1| PREDICTED: aminoacylase-1A-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|348534238|ref|XP_003454610.1| PREDICTED: aminoacylase-1A-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|340726792|ref|XP_003401737.1| PREDICTED: aminoacylase-1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350421698|ref|XP_003492928.1| PREDICTED: aminoacylase-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|326927775|ref|XP_003210064.1| PREDICTED: aminoacylase-1-like, partial [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|363738588|ref|XP_003642033.1| PREDICTED: aminoacylase-1-like isoform 1 [Gallus gallus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| ZFIN|ZDB-GENE-040426-755 | 420 | acy1 "aminoacylase 1" [Danio r | 0.973 | 0.264 | 0.477 | 4.6e-25 | |
| FB|FBgn0039049 | 413 | CG6726 [Drosophila melanogaste | 0.973 | 0.268 | 0.468 | 4.3e-23 | |
| FB|FBgn0039050 | 402 | CG17110 [Drosophila melanogast | 0.982 | 0.278 | 0.464 | 4.5e-23 | |
| FB|FBgn0037818 | 401 | CG6465 [Drosophila melanogaste | 0.973 | 0.276 | 0.486 | 1.3e-22 | |
| FB|FBgn0039053 | 401 | CG6738 [Drosophila melanogaste | 0.982 | 0.279 | 0.482 | 1.7e-22 | |
| FB|FBgn0039052 | 401 | CG6733 [Drosophila melanogaste | 0.982 | 0.279 | 0.473 | 6.7e-22 | |
| FB|FBgn0039051 | 400 | CG17109 [Drosophila melanogast | 0.982 | 0.28 | 0.455 | 5.6e-21 | |
| UNIPROTKB|P37111 | 407 | ACY1 "Aminoacylase-1" [Sus scr | 0.964 | 0.270 | 0.423 | 5.3e-19 | |
| WB|WBGene00007507 | 399 | C10C5.3 [Caenorhabditis elegan | 0.982 | 0.280 | 0.419 | 8.2e-19 | |
| WB|WBGene00007509 | 397 | C10C5.5 [Caenorhabditis elegan | 0.982 | 0.282 | 0.410 | 1.3e-18 |
| ZFIN|ZDB-GENE-040426-755 acy1 "aminoacylase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 285 (105.4 bits), Expect = 4.6e-25, P = 4.6e-25
Identities = 53/111 (47%), Positives = 71/111 (63%)
Query: 3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
DEE+GG +GM FV F+K+N+G ALDEG+A+PT + +F GER W + + CPG+PG
Sbjct: 158 DEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPG 217
Query: 63 HGSLLHENTAAEKVNYIMNKFXXXXXXXXXXXXXXXXXTIGDVTTINITML 113
HGS ENTAAEK+ ++N F T+GDVTTIN+TM+
Sbjct: 218 HGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMV 268
|
|
| FB|FBgn0039049 CG6726 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039050 CG17110 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037818 CG6465 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039053 CG6738 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039052 CG6733 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039051 CG17109 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P37111 ACY1 "Aminoacylase-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007507 C10C5.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007509 C10C5.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 114 | |||
| cd05646 | 391 | cd05646, M20_AcylaseI_like, M20 Aminoacylase-I lik | 1e-58 | |
| TIGR01880 | 400 | TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid am | 6e-46 | |
| pfam01546 | 310 | pfam01546, Peptidase_M20, Peptidase family M20/M25 | 6e-04 | |
| cd08659 | 365 | cd08659, M20_ArgE_DapE_like, Peptidase M20 acetylo | 0.002 | |
| cd05675 | 426 | cd05675, M20_yscS_like, M20 Peptidase, carboxypept | 0.002 |
| >gnl|CDD|193524 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I like subfamily | Back alignment and domain information |
|---|
Score = 184 bits (470), Expect = 1e-58
Identities = 65/112 (58%), Positives = 83/112 (74%)
Query: 3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPG 62
DEEIGG GM FV T+ FKK+NVG ALDEG+ASPTE + +F GER+ W + I GTPG
Sbjct: 138 DEEIGGHDGMEKFVKTEEFKKLNVGFALDEGLASPTEEYRVFYGERSPWWVVITASGTPG 197
Query: 63 HGSLLHENTAAEKVNYIMNKFLALREEEKNKLKANKNLTIGDVTTINITMLS 114
HGS L +NTA EK+ ++ KF+ REE+ +LK+N LTIGDVT++N+TML
Sbjct: 198 HGSKLLDNTAGEKLMKVIEKFMEFREEQFQRLKSNGKLTIGDVTSVNLTMLK 249
|
Peptidase M20 family, Aminoacylase-I like (AcyI-like; Acylase I; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14) subfamily. Acylase I is involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) and is considered as a potential target of antimicrobial agents. Porcine AcyI is also shown to deacetylate certain quorum-sensing N-acylhomoserine lactones, while the rat enzyme has been implicated in degradation of chemotactic peptides of commensal bacteria. Prokaryotic arginine synthesis usually involves the transfer of an acetyl group to glutamate by ornithine acetyltransferase in order to form ornithine. However, Escherichia coli acetylornithine deacetylase (acetylornithinase, ArgE) (EC 3.5.1.16) catalyzes the deacylation of N2-acetyl-L-ornithine to yield ornithine and acetate. Phylogenetic evidence suggests that the clustering of the arg genes in one continuous sequence pattern arose in an ancestor common to Enterobacteriaceae and Vibrionaceae, where ornithine acetyltransferase was lost and replaced by a deacylase. Length = 391 |
| >gnl|CDD|233615 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|216562 pfam01546, Peptidase_M20, Peptidase family M20/M25/M40 | Back alignment and domain information |
|---|
| >gnl|CDD|193570 cd08659, M20_ArgE_DapE_like, Peptidase M20 acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (ArgE/DapE)-like | Back alignment and domain information |
|---|
| >gnl|CDD|193550 cd05675, M20_yscS_like, M20 Peptidase, carboxypeptidase yscS-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| KOG2275|consensus | 420 | 99.93 | ||
| TIGR01880 | 400 | Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase | 99.75 | |
| PRK08737 | 364 | acetylornithine deacetylase; Provisional | 99.55 | |
| PRK13013 | 427 | succinyl-diaminopimelate desuccinylase; Reviewed | 99.54 | |
| PRK09133 | 472 | hypothetical protein; Provisional | 99.51 | |
| PRK06915 | 422 | acetylornithine deacetylase; Validated | 99.51 | |
| PRK05111 | 383 | acetylornithine deacetylase; Provisional | 99.5 | |
| TIGR01910 | 375 | DapE-ArgE acetylornithine deacetylase or succinyl- | 99.49 | |
| PRK04443 | 348 | acetyl-lysine deacetylase; Provisional | 99.49 | |
| PRK08588 | 377 | succinyl-diaminopimelate desuccinylase; Reviewed | 99.48 | |
| PRK07522 | 385 | acetylornithine deacetylase; Provisional | 99.47 | |
| TIGR01892 | 364 | AcOrn-deacetyl acetylornithine deacetylase (ArgE). | 99.44 | |
| PRK00466 | 346 | acetyl-lysine deacetylase; Validated | 99.44 | |
| PRK13009 | 375 | succinyl-diaminopimelate desuccinylase; Reviewed | 99.42 | |
| PRK07906 | 426 | hypothetical protein; Provisional | 99.42 | |
| TIGR03320 | 395 | ygeY M20/DapE family protein YgeY. Members of this | 99.41 | |
| PRK08652 | 347 | acetylornithine deacetylase; Provisional | 99.41 | |
| PRK06446 | 436 | hypothetical protein; Provisional | 99.4 | |
| TIGR01900 | 373 | dapE-gram_pos succinyl-diaminopimelate desuccinyla | 99.39 | |
| TIGR03526 | 395 | selenium_YgeY putative selenium metabolism hydrola | 99.38 | |
| TIGR01246 | 370 | dapE_proteo succinyl-diaminopimelate desuccinylase | 99.38 | |
| PRK13983 | 400 | diaminopimelate aminotransferase; Provisional | 99.38 | |
| PRK08651 | 394 | succinyl-diaminopimelate desuccinylase; Reviewed | 99.36 | |
| PRK13007 | 352 | succinyl-diaminopimelate desuccinylase; Reviewed | 99.36 | |
| PRK06837 | 427 | acetylornithine deacetylase; Provisional | 99.35 | |
| PRK08262 | 486 | hypothetical protein; Provisional | 99.35 | |
| PRK09290 | 413 | allantoate amidohydrolase; Reviewed | 99.33 | |
| TIGR01891 | 363 | amidohydrolases amidohydrolase. This model represe | 99.33 | |
| PRK13004 | 399 | peptidase; Reviewed | 99.33 | |
| PRK07473 | 376 | carboxypeptidase; Provisional | 99.32 | |
| PRK08201 | 456 | hypothetical protein; Provisional | 99.27 | |
| TIGR01902 | 336 | dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine d | 99.25 | |
| PRK12892 | 412 | allantoate amidohydrolase; Reviewed | 99.24 | |
| PLN02280 | 478 | IAA-amino acid hydrolase | 99.22 | |
| PRK12893 | 412 | allantoate amidohydrolase; Reviewed | 99.22 | |
| PRK12890 | 414 | allantoate amidohydrolase; Reviewed | 99.2 | |
| PRK07338 | 402 | hypothetical protein; Provisional | 99.19 | |
| PRK07907 | 449 | hypothetical protein; Provisional | 99.17 | |
| PRK06133 | 410 | glutamate carboxypeptidase; Reviewed | 99.13 | |
| PLN02693 | 437 | IAA-amino acid hydrolase | 99.13 | |
| PRK09104 | 464 | hypothetical protein; Validated | 99.13 | |
| TIGR01879 | 401 | hydantase amidase, hydantoinase/carbamoylase famil | 99.11 | |
| PRK13381 | 404 | peptidase T; Provisional | 99.1 | |
| PRK07318 | 466 | dipeptidase PepV; Reviewed | 99.07 | |
| TIGR01887 | 447 | dipeptidaselike dipeptidase, putative. This model | 99.05 | |
| PRK07079 | 469 | hypothetical protein; Provisional | 99.05 | |
| TIGR01886 | 466 | dipeptidase dipeptidase PepV. This model represent | 99.03 | |
| COG0624 | 409 | ArgE Acetylornithine deacetylase/Succinyl-diaminop | 98.99 | |
| PRK12891 | 414 | allantoate amidohydrolase; Reviewed | 98.99 | |
| TIGR01883 | 361 | PepT-like peptidase T-like protein. This model rep | 98.97 | |
| PRK08596 | 421 | acetylornithine deacetylase; Validated | 98.96 | |
| PRK07205 | 444 | hypothetical protein; Provisional | 98.95 | |
| PRK06156 | 520 | hypothetical protein; Provisional | 98.89 | |
| PF07687 | 111 | M20_dimer: Peptidase dimerisation domain This fami | 98.82 | |
| PRK05469 | 408 | peptidase T; Provisional | 98.82 | |
| TIGR01882 | 410 | peptidase-T peptidase T. This model represents a t | 98.76 | |
| TIGR01893 | 477 | aa-his-dipept aminoacyl-histidine dipeptidase. | 98.63 | |
| PRK15026 | 485 | aminoacyl-histidine dipeptidase; Provisional | 98.59 | |
| COG1473 | 392 | AbgB Metal-dependent amidase/aminoacylase/carboxyp | 98.34 | |
| TIGR03176 | 406 | AllC allantoate amidohydrolase. This enzyme cataly | 98.29 | |
| PRK13799 | 591 | unknown domain/N-carbamoyl-L-amino acid hydrolase | 98.1 | |
| PRK08554 | 438 | peptidase; Reviewed | 97.93 | |
| PRK13590 | 591 | putative bifunctional OHCU decarboxylase/allantoat | 97.88 | |
| COG2195 | 414 | PepD Di- and tripeptidases [Amino acid transport a | 92.93 | |
| COG4187 | 553 | RocB Arginine degradation protein (predicted deacy | 89.87 | |
| PF01546 | 189 | Peptidase_M20: Peptidase family M20/M25/M40 This f | 88.53 | |
| KOG2276|consensus | 473 | 83.25 |
| >KOG2275|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=6.3e-26 Score=180.57 Aligned_cols=114 Identities=40% Similarity=0.677 Sum_probs=108.6
Q ss_pred CCccCcCcccchHHhhcccccccCCeeEEEecCcccCCCcceeeecccceEEEEEEEeccCCCcCCCCCCCHHHHHHHHH
Q psy14393 1 MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLHENTAAEKVNYIM 80 (114)
Q Consensus 1 ~~DEE~Gg~~G~~~l~~~~~~~~~~~~~~idEG~~~~~~~~~i~~aeKG~~~~~v~v~G~~gHsS~P~~~nAi~~~~~~i 80 (114)
++|||+||..|++-+++..+|++++.++++|||+..+...+.++++|||.||++|+++|++||||.|++++|++++.++|
T Consensus 160 vpDEEi~G~~Gm~~fa~~~~~~~l~~~filDEG~~se~d~~~vfyaEkg~w~~~v~~~G~~GHss~~~~nTa~~~l~klv 239 (420)
T KOG2275|consen 160 VPDEEIGGHIGMKEFAKTEEFKKLNLGFILDEGGATENDFATVFYAEKGPWWLKVTANGTPGHSSYPPPNTAIEKLEKLV 239 (420)
T ss_pred cCchhccCcchHHHHhhhhhhcccceeEEecCCCCCcccceeEEEEeeceeEEEEEecCCCCCCCCCCCccHHHHHHHHH
Confidence 58999999999999999778999999999999988888888899999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhhhCCCCCccceeeeeeeccC
Q psy14393 81 NKFLALREEEKNKLKANKNLTIGDVTTINITMLS 114 (114)
Q Consensus 81 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~ 114 (114)
+.+.++|++|.+.+.+++.++.+++|++|++.+|
T Consensus 240 ~~~~~fr~~q~~~l~~~p~~~~~~vtT~Nv~~i~ 273 (420)
T KOG2275|consen 240 ESLEEFREKQVDLLASGPKLALGDVTTINVGIIN 273 (420)
T ss_pred HHHHHhHHHHHHHhhcCCceeccceeEEeeeeee
Confidence 9999999999999999999999999999999875
|
|
| >TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase | Back alignment and domain information |
|---|
| >PRK08737 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09133 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06915 acetylornithine deacetylase; Validated | Back alignment and domain information |
|---|
| >PRK05111 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase | Back alignment and domain information |
|---|
| >PRK04443 acetyl-lysine deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07522 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE) | Back alignment and domain information |
|---|
| >PRK00466 acetyl-lysine deacetylase; Validated | Back alignment and domain information |
|---|
| >PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07906 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03320 ygeY M20/DapE family protein YgeY | Back alignment and domain information |
|---|
| >PRK08652 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK06446 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase | Back alignment and domain information |
|---|
| >TIGR03526 selenium_YgeY putative selenium metabolism hydrolase | Back alignment and domain information |
|---|
| >TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade | Back alignment and domain information |
|---|
| >PRK13983 diaminopimelate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06837 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK08262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09290 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01891 amidohydrolases amidohydrolase | Back alignment and domain information |
|---|
| >PRK13004 peptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK07473 carboxypeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK08201 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase | Back alignment and domain information |
|---|
| >PRK12892 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PLN02280 IAA-amino acid hydrolase | Back alignment and domain information |
|---|
| >PRK12893 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12890 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK07338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07907 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06133 glutamate carboxypeptidase; Reviewed | Back alignment and domain information |
|---|
| >PLN02693 IAA-amino acid hydrolase | Back alignment and domain information |
|---|
| >PRK09104 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01879 hydantase amidase, hydantoinase/carbamoylase family | Back alignment and domain information |
|---|
| >PRK13381 peptidase T; Provisional | Back alignment and domain information |
|---|
| >PRK07318 dipeptidase PepV; Reviewed | Back alignment and domain information |
|---|
| >TIGR01887 dipeptidaselike dipeptidase, putative | Back alignment and domain information |
|---|
| >PRK07079 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01886 dipeptidase dipeptidase PepV | Back alignment and domain information |
|---|
| >COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12891 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01883 PepT-like peptidase T-like protein | Back alignment and domain information |
|---|
| >PRK08596 acetylornithine deacetylase; Validated | Back alignment and domain information |
|---|
| >PRK07205 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06156 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07687 M20_dimer: Peptidase dimerisation domain This family only corresponds to M20 family; InterPro: IPR011650 This domain consists of 4 beta strands and two alpha helices which make up the dimerisation surface of members of the MEROPS peptidase family M20 [] | Back alignment and domain information |
|---|
| >PRK05469 peptidase T; Provisional | Back alignment and domain information |
|---|
| >TIGR01882 peptidase-T peptidase T | Back alignment and domain information |
|---|
| >TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase | Back alignment and domain information |
|---|
| >PRK15026 aminoacyl-histidine dipeptidase; Provisional | Back alignment and domain information |
|---|
| >COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03176 AllC allantoate amidohydrolase | Back alignment and domain information |
|---|
| >PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK08554 peptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01546 Peptidase_M20: Peptidase family M20/M25/M40 This family only corresponds to M20 family; InterPro: IPR002933 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2276|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 114 | ||||
| 1q7l_A | 198 | Zn-binding Domain Of The T347g Mutant Of Human Amin | 7e-12 |
| >pdb|1Q7L|A Chain A, Zn-binding Domain Of The T347g Mutant Of Human Aminoacylase- I Length = 198 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 114 | |||
| 1q7l_A | 198 | Aminoacylase-1; catalysis, enzyme dimerization, si | 5e-14 | |
| 1lfw_A | 470 | PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac | 3e-05 | |
| 2rb7_A | 364 | Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat | 3e-04 |
| >1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Length = 198 | Back alignment and structure |
|---|
Score = 63.6 bits (155), Expect = 5e-14
Identities = 27/53 (50%), Positives = 36/53 (67%)
Query: 3 DEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKI 55
DEE+GG QGM LFV F + G ALDEGIA+PT+ F +F ER+ W +++
Sbjct: 146 DEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV 198
|
| >1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 Length = 470 | Back alignment and structure |
|---|
| >2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} Length = 364 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| 2f7v_A | 369 | Aectylcitrulline deacetylase; alpha/beta, hydrolas | 99.41 | |
| 2rb7_A | 364 | Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat | 99.34 | |
| 3pfo_A | 433 | Putative acetylornithine deacetylase; metal bindin | 99.34 | |
| 3ct9_A | 356 | Acetylornithine deacetylase; NP_812461.1, A putati | 99.34 | |
| 1vgy_A | 393 | Succinyl-diaminopimelate desuccinylase; structural | 99.32 | |
| 3ram_A | 394 | HMRA protein; two-domain, catalytic (alpha-beta-al | 99.3 | |
| 3isz_A | 377 | Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b | 99.26 | |
| 3tx8_A | 369 | Succinyl-diaminopimelate desuccinylase; peptidase, | 99.25 | |
| 1xmb_A | 418 | IAA-amino acid hydrolase homolog 2; structural gen | 99.2 | |
| 1ysj_A | 404 | Protein YXEP; M20 family peptidase, dinuclear meta | 99.11 | |
| 1cg2_A | 393 | Carboxypeptidase G2; metallocarboxypeptidase, hydr | 99.1 | |
| 3pfe_A | 472 | Succinyl-diaminopimelate desuccinylase; metal bind | 99.03 | |
| 3ife_A | 434 | Peptidase T; metallopeptidase, aminopeptidase, hyd | 99.03 | |
| 3io1_A | 445 | Aminobenzoyl-glutamate utilization protein; peptid | 99.03 | |
| 2pok_A | 481 | Peptidase, M20/M25/M40 family; M20 family peptidas | 98.99 | |
| 3khx_A | 492 | Putative dipeptidase sacol1801; DAPE, metallopepti | 98.98 | |
| 1fno_A | 417 | Peptidase T; metallo peptidase, protease, hydrolas | 98.96 | |
| 3rza_A | 396 | Tripeptidase; phosphorylase/hydrolase-like, struct | 98.9 | |
| 2zog_A | 479 | Cytosolic non-specific dipeptidase; metallopeptida | 98.89 | |
| 1z2l_A | 423 | Allantoate amidohydrolase; ALLC, purine cataboli a | 98.89 | |
| 2qyv_A | 487 | XAA-His dipeptidase; YP_718209.1, structural genom | 98.87 | |
| 3n5f_A | 408 | L-carbamoylase, N-carbamoyl-L-amino acid hydrolase | 98.84 | |
| 2v8h_A | 474 | Beta-alanine synthase; amidohydrolase, alpha and b | 98.82 | |
| 3gb0_A | 373 | Peptidase T; NP_980509.1, aminopeptidase PEPT, pep | 98.81 | |
| 3dlj_A | 485 | Beta-Ala-His dipeptidase; CNDP1, carnosine dipepti | 98.76 | |
| 3mru_A | 490 | Aminoacyl-histidine dipeptidase; metalloprotease, | 98.75 | |
| 1q7l_A | 198 | Aminoacylase-1; catalysis, enzyme dimerization, si | 98.74 | |
| 1lfw_A | 470 | PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac | 98.44 | |
| 4h2k_A | 269 | Succinyl-diaminopimelate desuccinylase; DAPE, MCSG | 95.04 | |
| 3t68_A | 268 | Succinyl-diaminopimelate desuccinylase; DAPE, csgi | 93.26 | |
| 2fvg_A | 340 | Endoglucanase; TM1049, structural genomics, joint | 92.13 |
| >2f7v_A Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1.75A {Xanthomonas campestris} PDB: 2f8h_A | Back alignment and structure |
|---|
Probab=99.41 E-value=4.7e-13 Score=103.46 Aligned_cols=80 Identities=23% Similarity=0.209 Sum_probs=60.4
Q ss_pred CCccCcCcccchHHhhcccccccCCeeEEEecCcccCCCcceeeecccceEEEEEEEeccCCCcCCCC--CCCHHHHHHH
Q psy14393 1 MLDEEIGGSQGMSLFVTTDAFKKMNVGCALDEGIASPTEVFALFNGERTIWQMKIHCPGTPGHGSLLH--ENTAAEKVNY 78 (114)
Q Consensus 1 ~~DEE~Gg~~G~~~l~~~~~~~~~~~~~~idEG~~~~~~~~~i~~aeKG~~~~~v~v~G~~gHsS~P~--~~nAi~~~~~ 78 (114)
++|||.||..|+++++++.. ++++++. .+|+ ...+.+++||..+++|+++|+++|||.|+ +.|||..+++
T Consensus 130 ~~~EE~~g~~G~~~~~~~~~----~~d~~i~---~e~~-~~~i~~~~~g~~~~~i~v~G~~~Ha~~p~~~g~nAi~~~~~ 201 (369)
T 2f7v_A 130 SSDEEANDPRCIAAFLARGL----PYDAVLV---AEPT-MSEAVLAHRGISSVLMRFAGRAGHASGKQDPAASALHQAMR 201 (369)
T ss_dssp ESCTTSSSCCHHHHHHTTCC----CCSEEEE---CCCS-TTCBBCCBCCEEEEEEEEECCCC------CTTSCHHHHHHH
T ss_pred EeCcccCCCcCHHHHHhcCC----CCCEEEE---CCCC-CCcceeecCceEEEEEEEeeeCcccCCCCcCCCCHHHHHHH
Confidence 47999955689999998632 2677774 4554 35678999999999999999999999997 4999999999
Q ss_pred HHHHHHHHHH
Q psy14393 79 IMNKFLALRE 88 (114)
Q Consensus 79 ~i~~l~~~~~ 88 (114)
++.+|+++..
T Consensus 202 ~i~~l~~~~~ 211 (369)
T 2f7v_A 202 WGGKALDHVE 211 (369)
T ss_dssp HHHHHHHHHH
T ss_pred HHHHHHhhhh
Confidence 9999977654
|
| >2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20 structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >3ram_A HMRA protein; two-domain, catalytic (alpha-beta-alpha) motif, tetramerisat (alpha,beta,BETA,alpha), endoprotease, hydrolase; 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2, protein struc initiative; 2.00A {Haemophilus influenzae} PDB: 3ic1_A | Back alignment and structure |
|---|
| >3tx8_A Succinyl-diaminopimelate desuccinylase; peptidase, structural genomics, joint center for structural JCSG; 2.97A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1xmb_A IAA-amino acid hydrolase homolog 2; structural genomics, protein structure initiative, CESG AT5G56660, ILL2, indole-3-acetic acid, auxin; 2.00A {Arabidopsis thaliana} SCOP: c.56.5.4 d.58.19.1 PDB: 2q43_A | Back alignment and structure |
|---|
| >1ysj_A Protein YXEP; M20 family peptidase, dinuclear metal binding, structural GE PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >1cg2_A Carboxypeptidase G2; metallocarboxypeptidase, hydrolase; 2.50A {Pseudomonas SP} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >3pfe_A Succinyl-diaminopimelate desuccinylase; metal binding, merops M20 familiy, phosphorylase/hydrolase-L structural genomics; HET: MSE; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ife_A Peptidase T; metallopeptidase, aminopeptidase, hydro metal-binding, metalloprotease, protease; HET: SUC; 1.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3io1_A Aminobenzoyl-glutamate utilization protein; peptidase_M20D superfamily, protein structure initiative II, NYSGXRC, structural genomics; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural GENO PSI-2, protein structure initiative; HET: BGC; 1.90A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3khx_A Putative dipeptidase sacol1801; DAPE, metallopeptidase, hydrolase, metal-bindin metalloprotease, protease; 2.30A {Staphylococcus aureus} PDB: 3ki9_A 3khz_A | Back alignment and structure |
|---|
| >1fno_A Peptidase T; metallo peptidase, protease, hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.56.5.4 d.58.19.1 PDB: 1vix_A | Back alignment and structure |
|---|
| >3rza_A Tripeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: CIT PG4 PGE; 2.10A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP DIP 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* | Back alignment and structure |
|---|
| >1z2l_A Allantoate amidohydrolase; ALLC, purine cataboli allantoin utilization, structural genomics, PSI, Pro structure initiative; HET: 1AL; 2.25A {Escherichia coli} SCOP: c.56.5.4 d.58.19.1 PDB: 2imo_A | Back alignment and structure |
|---|
| >2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; 2.11A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >3n5f_A L-carbamoylase, N-carbamoyl-L-amino acid hydrolase; hinge domain, M20 peptidase family, evolution, residue, dimerization domain; 2.75A {Bacillus stearothermophilus} | Back alignment and structure |
|---|
| >2v8h_A Beta-alanine synthase; amidohydrolase, alpha and beta protein, DI-zinc center, COMP N-carbamyl-beta-alanine, hydrolase; HET: BCN; 2.0A {Saccharomyces kluyveri} PDB: 2v8d_A* 2vl1_A 2v8g_A 2v8v_A 1r43_A 1r3n_A | Back alignment and structure |
|---|
| >3gb0_A Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M structural genomics, joint center for structural genomics; 2.04A {Bacillus cereus atcc 10987} | Back alignment and structure |
|---|
| >3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structu genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3mru_A Aminoacyl-histidine dipeptidase; metalloprotease, homodimer, hydrolase; 3.00A {Vibrio alginolyticus} | Back alignment and structure |
|---|
| >1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 | Back alignment and structure |
|---|
| >1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >4h2k_A Succinyl-diaminopimelate desuccinylase; DAPE, MCSG, PSI-biology, structural genomics, midwest center structural genomics, hydrolase; 1.84A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3t68_A Succinyl-diaminopimelate desuccinylase; DAPE, csgid, metalloenzyme, structural genomics; 1.65A {Vibrio cholerae o1 biovar el tor} PDB: 3t6m_A | Back alignment and structure |
|---|
| >2fvg_A Endoglucanase; TM1049, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.01A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 114 | ||||
| g1q7l.1 | 280 | c.56.5.4 (A:,B:) Aminoacylase-1, catalytic domain | 2e-14 |
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| g1q7l.1 | 280 | Aminoacylase-1, catalytic domain {Human (Homo sapi | 98.96 | |
| d1vgya2 | 113 | Succinyl-diaminopimelate desuccinylase {Neisseria | 98.7 | |
| d1ysja2 | 115 | Protein YxeP {Bacillus subtilis [TaxId: 1423]} | 98.47 | |
| d1xmba2 | 119 | IAA-amino acid hydrolase {Mouse-ear cress (Arabido | 98.37 | |
| d1lfwa2 | 196 | Aminopeptidase PepV {Lactobacillus delbrueckii [Ta | 98.35 | |
| d1cg2a2 | 113 | Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 | 98.32 | |
| d1z2la2 | 117 | Allantoate amidohydrolase AllC {Escherichia coli [ | 98.16 | |
| d1r3na2 | 116 | Peptidase-like beta-alanine synthase {Yeast (Sacch | 98.11 | |
| d1vgya1 | 262 | Succinyl-diaminopimelate desuccinylase, catalytic | 96.51 | |
| d1lfwa1 | 272 | Aminopeptidase PepV {Lactobacillus delbrueckii [Ta | 90.36 | |
| d1fnoa3 | 113 | Peptidase T (tripeptidase) {Salmonella typhimurium | 85.39 |
| >d1vgya2 d.58.19.1 (A:181-293) Succinyl-diaminopimelate desuccinylase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lfwa2 d.58.19.1 (A:187-382) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} | Back information, alignment and structure |
|---|
| >d1cg2a2 d.58.19.1 (A:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1z2la2 d.58.19.1 (A:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r3na2 d.58.19.1 (A:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} | Back information, alignment and structure |
|---|
| >d1vgya1 c.56.5.4 (A:2-180,A:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} | Back information, alignment and structure |
|---|
| >d1fnoa3 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|