Psyllid ID: psy1461

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
ccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccEEEcHHHHcccccEEEEEEEcHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccHHHHHHHHcccccccccEEccHHHHccccccccc
ccccccccEcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEHHHHHHcccHHEEEEEEEEccccccHHcccHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccEEEEEEEEcccccccHHHHHHHHHHHHHccccccccEEHHHHHHcccccEccc
mdldgdgylsmYELEYFYDEQLQRMDaigieclpfEDCLCQMLdmikpevpgkislqdlkrckmTRIFFDTFFNLEKyldheqrdpfasqrdddtlsSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEedkthpraIEYWFRsrkteaafpyiDFNFLLQMLdmikpevpgkislqdlkrckmtriffd
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLdheqrdpfasqrdddtlssRMIDRIfsgtvtrskhvMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEvpgkislqdlkrckMTRIFFD
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
******GYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDH******************MIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIF**
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFA*******LSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
**L*GDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEAAFPYIDFNFLLQMLDMIKPEVPGKISLQDLKRCKMTRIFFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q061901150 Serine/threonine-protein yes N/A 0.312 0.051 0.760 5e-38
Q9Y5P8575 Serine/threonine-protein no N/A 0.365 0.12 0.637 3e-35
Q9Z176491 Serine/threonine-protein no N/A 0.317 0.122 0.557 9e-26
Q803V3457 Serine/threonine-protein no N/A 0.206 0.085 0.278 5e-07
Q5E9G1453 Serine/threonine-protein no N/A 0.206 0.086 0.273 8e-07
Q9JK24453 Serine/threonine-protein no N/A 0.206 0.086 0.273 9e-07
Q6AXZ3453 Serine/threonine-protein no N/A 0.206 0.086 0.273 9e-07
Q969Q6453 Serine/threonine-protein no N/A 0.206 0.086 0.273 2e-06
Q6DJ05448 Serine/threonine-protein no N/A 0.169 0.071 0.255 3e-05
>sp|Q06190|P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens GN=PPP2R3A PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%)

Query: 1    MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLK 60
            MD+DGDG LSMYELEYFY+EQ +RM+A+GIE LPF D LCQMLD++KP V GKI+L+DLK
Sbjct: 984  MDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLK 1043

Query: 61   RCKMTRIFFDTFFNLEKYLDHEQRDPFASQRD 92
            RC+M  IF+DTFFNLEKYLDHEQRDPFA Q+D
Sbjct: 1044 RCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKD 1075
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Homo sapiens (taxid: 9606)
>sp|Q9Y5P8|P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens GN=PPP2R3B PE=1 SV=2 Back     alignment and function description
>sp|Q9Z176|P2R3A_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Mus musculus GN=Ppp2r3a PE=2 SV=1 Back     alignment and function description
>sp|Q803V3|P2R3C_DANRE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Danio rerio GN=ppp2r3c PE=2 SV=1 Back     alignment and function description
>sp|Q5E9G1|P2R3C_BOVIN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Bos taurus GN=PPP2R3C PE=2 SV=1 Back     alignment and function description
>sp|Q9JK24|P2R3C_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Mus musculus GN=Ppp2r3c PE=1 SV=2 Back     alignment and function description
>sp|Q6AXZ3|P2R3C_RAT Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Rattus norvegicus GN=Ppp2r3c PE=2 SV=1 Back     alignment and function description
>sp|Q969Q6|P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens GN=PPP2R3C PE=1 SV=1 Back     alignment and function description
>sp|Q6DJ05|P2R3C_XENTR Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Xenopus tropicalis GN=ppp2r3c PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
345484920 1170 PREDICTED: hypothetical protein LOC10012 0.201 0.032 0.823 4e-46
383863057 1216 PREDICTED: uncharacterized protein LOC10 0.153 0.023 0.882 1e-45
328700132 828 PREDICTED: hypothetical protein LOC10016 0.179 0.041 0.846 2e-45
328700134 881 PREDICTED: hypothetical protein LOC10016 0.179 0.038 0.846 4e-45
350400971 1215 PREDICTED: hypothetical protein LOC10074 0.291 0.045 0.861 1e-44
340719650 1215 PREDICTED: hypothetical protein LOC10064 0.291 0.045 0.861 2e-44
110760219 1240 PREDICTED: hypothetical protein LOC41291 0.291 0.044 0.861 3e-44
332018375 1231 Serine/threonine-protein phosphatase 2A 0.285 0.043 0.851 3e-44
307202126 1264 Serine/threonine-protein phosphatase 2A 0.328 0.049 0.803 3e-44
380029780 1232 PREDICTED: uncharacterized protein LOC10 0.291 0.044 0.861 3e-44
>gi|345484920|ref|XP_001604203.2| PREDICTED: hypothetical protein LOC100120575 isoform 1 [Nasonia vitripennis] gi|345484922|ref|XP_003425156.1| PREDICTED: hypothetical protein LOC100120575 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 89/102 (87%)

Query: 1    MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLK 60
            MDLDGDGYLSMYELEYFY+EQL RM+AIGIE LPFEDCLCQMLDMIKP +PGKISL DLK
Sbjct: 981  MDLDGDGYLSMYELEYFYEEQLHRMEAIGIETLPFEDCLCQMLDMIKPAIPGKISLSDLK 1040

Query: 61   RCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMID 102
            +CKMT IFFDTFFNLEKYLDHEQRDPFAS RD D     + D
Sbjct: 1041 KCKMTSIFFDTFFNLEKYLDHEQRDPFASARDHDADGHELSD 1082

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383863057|ref|XP_003706999.1| PREDICTED: uncharacterized protein LOC100876256 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328700132|ref|XP_003241158.1| PREDICTED: hypothetical protein LOC100162850 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328700134|ref|XP_001946435.2| PREDICTED: hypothetical protein LOC100162850 isoform 1 [Acyrthosiphon pisum] gi|328700136|ref|XP_003241159.1| PREDICTED: hypothetical protein LOC100162850 isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350400971|ref|XP_003486017.1| PREDICTED: hypothetical protein LOC100745203 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719650|ref|XP_003398261.1| PREDICTED: hypothetical protein LOC100645131 [Bombus terrestris] Back     alignment and taxonomy information
>gi|110760219|ref|XP_396366.3| PREDICTED: hypothetical protein LOC412914 [Apis mellifera] Back     alignment and taxonomy information
>gi|332018375|gb|EGI58972.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307202126|gb|EFN81626.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380029780|ref|XP_003698543.1| PREDICTED: uncharacterized protein LOC100864098 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn0038744888 CG4733 [Drosophila melanogaste 0.502 0.106 0.821 1.7e-38
ZFIN|ZDB-GENE-070912-268583 ppp2r3b "protein phosphatase 2 0.539 0.174 0.686 3.6e-37
UNIPROTKB|A6QNV9530 PPP2R3A "Uncharacterized prote 0.486 0.173 0.75 9.2e-36
UNIPROTKB|E1BWQ8584 PPP2R3B "Uncharacterized prote 0.539 0.174 0.676 1.3e-35
RGD|1306958530 Ppp2r3a "protein phosphatase 2 0.486 0.173 0.739 2.4e-35
UNIPROTKB|Q061901150 PPP2R3A "Serine/threonine-prot 0.486 0.08 0.760 3.9e-35
UNIPROTKB|E2RAA71152 PPP2R3A "Uncharacterized prote 0.486 0.079 0.75 1.1e-34
ZFIN|ZDB-GENE-070912-6461141 ppp2r3a "protein phosphatase 2 0.502 0.083 0.715 1.3e-34
UNIPROTKB|E1BIU61150 PPP2R3A "Uncharacterized prote 0.486 0.08 0.75 1.7e-34
UNIPROTKB|Q9Y5P8575 PPP2R3B "Serine/threonine-prot 0.539 0.177 0.637 2.1e-34
FB|FBgn0038744 CG4733 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 1.7e-38, P = 1.7e-38
 Identities = 78/95 (82%), Positives = 84/95 (88%)

Query:     1 MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLK 60
             MD+DGDG LSMYELEYFY+EQ QRM+ IGIECLPFEDCLCQMLDMIKP     I+L DLK
Sbjct:   774 MDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLPFEDCLCQMLDMIKPANRDCITLGDLK 833

Query:    61 RCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDT 95
             RCKMT +FFDTFFNLEKYLDHEQRDPFASQRD+ T
Sbjct:   834 RCKMTHVFFDTFFNLEKYLDHEQRDPFASQRDEYT 868
GO:0008601 "protein phosphatase type 2A regulator activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0046331 "lateral inhibition" evidence=IMP
ZFIN|ZDB-GENE-070912-268 ppp2r3b "protein phosphatase 2, regulatory subunit B'', beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6QNV9 PPP2R3A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWQ8 PPP2R3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1306958 Ppp2r3a "protein phosphatase 2, regulatory subunit B'', alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q06190 PPP2R3A "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAA7 PPP2R3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-646 ppp2r3a "protein phosphatase 2, regulatory subunit B'', alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIU6 PPP2R3A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5P8 PPP2R3B "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG2562|consensus493 100.0
KOG2562|consensus493 99.91
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 97.64
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 97.19
PTZ00183158 centrin; Provisional 97.09
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 96.89
PTZ00184149 calmodulin; Provisional 96.89
PTZ00183158 centrin; Provisional 96.89
PTZ00184149 calmodulin; Provisional 96.47
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 96.43
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 96.41
KOG0031|consensus171 96.35
KOG0044|consensus193 96.26
KOG0027|consensus151 96.25
KOG0034|consensus187 95.86
KOG0027|consensus151 95.77
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 94.42
KOG0044|consensus193 94.0
cd0005267 EH Eps15 homology domain; found in proteins implic 93.96
cd0005267 EH Eps15 homology domain; found in proteins implic 93.15
KOG0037|consensus221 92.62
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 92.37
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 92.33
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 92.02
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 91.98
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 91.96
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 91.81
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 91.69
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 91.43
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 91.32
cd0021388 S-100 S-100: S-100 domain, which represents the la 91.19
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 90.88
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 90.26
KOG0034|consensus187 90.07
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 89.95
KOG4223|consensus325 89.66
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 88.89
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 87.86
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 86.41
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 85.7
KOG0036|consensus 463 84.5
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 83.96
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 83.54
cd0021388 S-100 S-100: S-100 domain, which represents the la 81.94
PF1465866 EF-hand_9: EF-hand domain 80.09
>KOG2562|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.7e-47  Score=338.48  Aligned_cols=186  Identities=32%  Similarity=0.595  Sum_probs=154.6

Q ss_pred             CCCCCCCccCHHHHHHHHHHHHHHHH-hhCCCCCchHH-----HHHHHHHhhCCCCCCceehhHHhhcchhHHHHH----
Q psy1461           1 MDLDGDGYLSMYELEYFYDEQLQRMD-AIGIECLPFED-----CLCQMLDMIKPEVPGKISLQDLKRCKMTRIFFD----   70 (189)
Q Consensus         1 lD~dgdG~Ls~~dLe~F~~e~~~~l~-~~~~e~~~f~d-----~~cqi~d~l~p~~~grItl~DL~~S~~~~~f~~----   70 (189)
                      ++..|+|||+..+++.+..+.++..+ +.-.+++.|..     ++-+||++++|.|+|||||++|++|+++..+..    
T Consensus       183 l~~~~~~yl~q~df~~~Lqeli~Thpl~~l~~~pEf~~~Y~~tvi~rIFy~~nrs~tG~iti~el~~snll~~l~~l~eE  262 (493)
T KOG2562|consen  183 LIQAGCSYLRQDDFKPYLQELIATHPLEFLDEEPEFQERYAETVIQRIFYYLNRSRTGRITIQELLRSNLLDALLELDEE  262 (493)
T ss_pred             HhccCccceeccccHHHHHHHHhcCCchhhccChhHHHHHHHHHhhhhheeeCCccCCceeHHHHHHhHHHHHHHHHHHH
Confidence            46789999999999999999998877 33334556655     334899999999999999999999998776642    


Q ss_pred             -------HHhchhhhh-------cc-ccCCcccccCC-----cccchhHHHHHHhhccccc-----CCCcccHHHHHHHH
Q psy1461          71 -------TFFNLEKYL-------DH-EQRDPFASQRD-----DDTLSSRMIDRIFSGTVTR-----SKHVMTYTEFVWFL  125 (189)
Q Consensus        71 -------~l~~l~~f~-------~~-e~rd~f~~~rD-----~~~l~~~~idRiF~~~~~~-----~~~~mdy~~fv~f~  125 (189)
                             .||+++||+       +- .++|.+.++.+     ++++|.+||||||| +|+|     ..|+|||++|||||
T Consensus       263 ed~nq~~~~FS~e~f~viy~kFweLD~Dhd~lidk~~L~ry~d~tlt~~ivdRIFs-~v~r~~~~~~eGrmdykdFv~Fi  341 (493)
T KOG2562|consen  263 EDINQVTRYFSYEHFYVIYCKFWELDTDHDGLIDKEDLKRYGDHTLTERIVDRIFS-QVPRGFTVKVEGRMDYKDFVDFI  341 (493)
T ss_pred             hhhhhhhhheeHHHHHHHHHHHhhhccccccccCHHHHHHHhccchhhHHHHHHHh-hccccceeeecCcccHHHHHHHH
Confidence                   478887763       22 24566665433     68999999999999 5555     35899999999999


Q ss_pred             HHhcCCCCchhHHHHHHhhcCCCC--------------------------CCCCChhHHHHHHhhcCCCCCCCeechhhh
Q psy1461         126 LAEEDKTHPRAIEYWFRSRKTEAA--------------------------FPYIDFNFLLQMLDMIKPEVPGKISLQDLK  179 (189)
Q Consensus       126 la~e~k~~~~si~YwFr~lD~~~~--------------------------~~~~~~~~~~~~~Dmv~p~~~~~itl~Dl~  179 (189)
                      +|||||++|+||+|||||||+++.                          +||+  |++|||+|||||+++++|||+|||
T Consensus       342 lA~e~k~t~~SleYwFrclDld~~G~Lt~~el~~fyeeq~~rm~~~~~e~l~fe--d~l~qi~DMvkP~~~~kItLqDlk  419 (493)
T KOG2562|consen  342 LAEEDKDTPASLEYWFRCLDLDGDGILTLNELRYFYEEQLQRMECMGQEALPFE--DALCQIRDMVKPEDENKITLQDLK  419 (493)
T ss_pred             HHhccCCCccchhhheeeeeccCCCcccHHHHHHHHHHHHHHHHhcCCCcccHH--HHHHHHHHHhCccCCCceeHHHHh
Confidence            999999999999999999999762                          3443  799999999999999999999999


Q ss_pred             hCCCCCcccC
Q psy1461         180 RCKMTRIFFD  189 (189)
Q Consensus       180 ~~~~~~~ff~  189 (189)
                      +|+|||+|||
T Consensus       420 ~skl~~~v~n  429 (493)
T KOG2562|consen  420 GSKLAGTVFN  429 (493)
T ss_pred             hccccchhhh
Confidence            9999999986

>KOG2562|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.1 bits (90), Expect = 5e-04
 Identities = 29/200 (14%), Positives = 55/200 (27%), Gaps = 52/200 (26%)

Query: 14  LEYFYDEQLQRMDAIGIECLPFEDC--LCQMLDMIKPEVPGKISLQDLKR--CKMT---- 65
            ++   ++L  +    +  L   +   +   L +  P     I    L      +     
Sbjct: 347 WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSA--HIPTILLSLIWFDVIKSDV 404

Query: 66  RIFFDTFFN---LEK-------YLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHV 115
            +  +       +EK        +     +      ++  L   ++D             
Sbjct: 405 MVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDH------------ 452

Query: 116 MTYTEFVWFLLAEEDKTHPRAIEYWF--------RSRKTE--AAFP--YIDFNFLLQML- 162
             Y     F    +D   P   +Y++             E    F   ++DF FL Q + 
Sbjct: 453 --YNIPKTFDS--DDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIR 508

Query: 163 -DMIKPEVPGKIS--LQDLK 179
            D       G I   LQ LK
Sbjct: 509 HDSTAWNASGSILNTLQQLK 528

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.14
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.07
1y1x_A191 Leishmania major homolog of programmed cell death 98.06
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.05
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.95
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.92
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 97.86
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 97.85
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.84
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 97.82
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 97.8
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 97.8
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 97.8
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 97.79
3fwb_A161 Cell division control protein 31; gene gating, com 97.78
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 97.78
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 97.77
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.74
3fwb_A161 Cell division control protein 31; gene gating, com 97.72
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 97.71
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 97.69
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 97.68
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 97.67
2jnf_A158 Troponin C; stretch activated muscle contraction, 97.66
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 97.65
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 97.65
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 97.63
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 97.63
1exr_A148 Calmodulin; high resolution, disorder, metal trans 97.61
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 97.59
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 97.58
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.57
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 97.57
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 97.57
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 97.56
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 97.55
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 97.54
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 97.53
3akb_A166 Putative calcium binding protein; EF-hand, metal b 97.53
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 97.53
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 97.52
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 97.52
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 97.52
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 97.5
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 97.5
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 97.49
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 97.49
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.49
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 97.48
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 97.48
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.47
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 97.45
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 97.45
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 97.44
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 97.42
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 97.41
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 97.4
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 97.4
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 97.39
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 97.38
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 97.37
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 97.36
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 97.35
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.34
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 97.33
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.33
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 97.33
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 97.33
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 97.32
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 97.3
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.29
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 97.28
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 97.28
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 97.27
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 97.25
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.24
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.24
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 97.24
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 97.23
2jnf_A158 Troponin C; stretch activated muscle contraction, 97.23
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 97.22
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 97.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.22
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 97.21
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 97.21
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.18
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 97.17
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.16
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 97.15
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.14
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 97.14
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.14
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 97.11
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 97.09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 97.09
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.08
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 97.07
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 97.07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.07
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 97.02
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 97.01
1y1x_A191 Leishmania major homolog of programmed cell death 96.97
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 96.95
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.93
3akb_A166 Putative calcium binding protein; EF-hand, metal b 96.93
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 96.92
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 96.91
3a4u_B143 Multiple coagulation factor deficiency protein 2; 96.91
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 96.9
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 96.9
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 96.89
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 96.87
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 96.87
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 96.85
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.85
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 96.85
3lij_A494 Calcium/calmodulin dependent protein kinase with A 96.84
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 96.84
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 96.82
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 96.81
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.81
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 96.81
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 96.81
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 96.8
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 96.8
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 96.78
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 96.76
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 96.75
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 96.73
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 96.72
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 96.7
3li6_A66 Calcium-binding protein; calcium signaling protein 96.67
1exr_A148 Calmodulin; high resolution, disorder, metal trans 96.67
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 96.67
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 96.64
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 96.62
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 96.6
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 96.58
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 96.56
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 96.56
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 96.55
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 96.54
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 96.53
2hps_A186 Coelenterazine-binding protein with bound coelent; 96.52
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 96.52
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 96.51
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.51
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 96.5
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 96.46
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 96.43
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 96.43
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 96.43
3lij_A494 Calcium/calmodulin dependent protein kinase with A 96.42
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 96.37
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 96.35
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.35
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.22
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 96.2
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 96.19
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.17
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 96.14
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.14
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 96.09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 96.05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 96.01
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 95.97
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 95.92
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 95.92
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 95.9
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.9
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.86
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 95.82
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.82
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.78
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.74
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.71
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 95.7
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.69
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.68
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.68
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.56
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.55
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.51
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.5
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.49
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 95.49
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 95.48
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.47
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 95.39
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 95.37
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.33
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 95.33
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 95.3
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 95.3
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 95.29
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 95.25
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 95.2
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 95.06
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 95.06
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 95.03
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 95.02
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.0
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.91
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 94.84
1c07_A95 Protein (epidermal growth factor receptor pathway 94.78
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.74
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 94.7
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 94.66
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.57
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.56
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 94.56
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 94.55
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.5
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.42
1qjt_A99 EH1, epidermal growth factor receptor substrate su 94.37
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.35
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.31
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 94.24
3li6_A66 Calcium-binding protein; calcium signaling protein 94.16
3a4u_B143 Multiple coagulation factor deficiency protein 2; 94.12
1qjt_A99 EH1, epidermal growth factor receptor substrate su 94.07
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 94.06
2hps_A186 Coelenterazine-binding protein with bound coelent; 93.72
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.72
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 93.67
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 93.59
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 93.49
1avs_A90 Troponin C; muscle contraction, calcium-activated, 93.34
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.31
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 93.3
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 93.08
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 93.01
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 92.96
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 92.88
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 92.87
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 92.86
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 92.77
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 92.68
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 92.57
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 92.47
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 92.44
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 92.31
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 92.29
1c07_A95 Protein (epidermal growth factor receptor pathway 92.23
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 92.2
2jq6_A139 EH domain-containing protein 1; metal binding prot 91.95
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 91.8
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 91.64
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 91.38
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 91.36
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 91.28
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 91.03
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 91.0
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 90.89
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 90.83
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 90.48
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 90.22
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 90.15
1nub_A229 Basement membrane protein BM-40; extracellular mod 90.07
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 89.58
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 89.58
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 89.42
2jq6_A139 EH domain-containing protein 1; metal binding prot 89.37
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 89.25
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 89.24
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.15
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 89.14
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 89.13
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 88.98
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 88.74
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 88.53
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 88.39
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 88.17
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 87.2
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 87.19
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 87.05
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 87.03
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 87.03
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 86.64
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 86.29
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 86.03
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 85.78
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 84.83
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 84.82
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 84.66
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 84.14
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 83.94
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 82.9
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 82.56
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
Probab=98.14  E-value=1.8e-05  Score=60.28  Aligned_cols=103  Identities=23%  Similarity=0.370  Sum_probs=71.1

Q ss_pred             CCCCCCCccCHHHHHHHHHH--------HHHHHHhhCCCCCchHH----------------HHHHHHHhhCCCCCCceeh
Q psy1461           1 MDLDGDGYLSMYELEYFYDE--------QLQRMDAIGIECLPFED----------------CLCQMLDMIKPEVPGKISL   56 (189)
Q Consensus         1 lD~dgdG~Ls~~dLe~F~~e--------~~~~l~~~~~e~~~f~d----------------~~cqi~d~l~p~~~grItl   56 (189)
                      +|.||+|.||..||...++.        .+..+...+...+.|..                -+.++|..+|+.++|.|+.
T Consensus        25 ~D~d~dG~I~~~El~~~l~~lg~~~~~~~~~~~~~~~~~~i~f~ef~~~~~~~~~~~~~~~~l~~aF~~fD~d~~G~I~~  104 (153)
T 3i5g_B           25 IDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPE  104 (153)
T ss_dssp             HCCSTTSCCCHHHHHHHHHHTTSCCCHHHHHHHHHTSSSCCCSHHHHHTTTTTTTTCCCHHHHHHHHHTTCSSCSSCCCH
T ss_pred             HCCCCCCeEcHHHHHHHHHHcCCCccHHHHHHHHHhccCCccHHHHHHHHHhhhcccccHHHHHHHHhccccCCCCeEeH
Confidence            48999999999999998864        22333332323344333                3346777888888888888


Q ss_pred             hHHhhcchhHHHHHHHhchhhhhccccCCcccccCCcccchhHHHHHHhhcccccCCCcccHHHHHHHHHHhcC
Q psy1461          57 QDLKRCKMTRIFFDTFFNLEKYLDHEQRDPFASQRDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEED  130 (189)
Q Consensus        57 ~DL~~S~~~~~f~~~l~~l~~f~~~e~rd~f~~~rD~~~l~~~~idRiF~~~~~~~~~~mdy~~fv~f~la~e~  130 (189)
                      .+|++      ++.   ++                 +..+|..-++.++..+-+. +|+++|++||..+---++
T Consensus       105 ~el~~------~l~---~~-----------------g~~ls~~ei~~~~~~~D~~-dG~I~y~EF~~~m~~~~~  151 (153)
T 3i5g_B          105 DYLKD------LLE---NM-----------------GDNFSKEEIKNVWKDAPLK-NKQFNYNKMVDIKGKAED  151 (153)
T ss_dssp             HHHHH------HHH---SS-----------------SSCCCHHHHHHHHTTCCEE-TTEECHHHHHHHHHCSCC
T ss_pred             HHHHH------HHH---Hc-----------------CCcCCHHHHHHHHHHhCCC-cCEEcHHHHHHHhcCCCC
Confidence            88877      111   11                 2347778899999988665 699999999998754443
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 5e-06
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Phospholipase C-beta-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.3 bits (99), Expect = 5e-06
 Identities = 24/147 (16%), Positives = 45/147 (30%), Gaps = 22/147 (14%)

Query: 1   MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLK 60
           M L+ +G + +      +    +R++      L          D I PE   +   +   
Sbjct: 16  MQLNSEGKIPVKNFFQMFPADRKRVE----AALSACHLPKGKNDAINPEDFPEPVYKSFL 71

Query: 61  RCKMTRIFFDTFFN--------------LEKYLDHEQRDPFASQRDDDTLSSR----MID 102
                R   D  F               L K+++ +QRD   +              +ID
Sbjct: 72  MSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLID 131

Query: 103 RIFSGTVTRSKHVMTYTEFVWFLLAEE 129
           +     +   +  ++    VWFL   E
Sbjct: 132 KYEPSGINAQRGQLSPEGMVWFLCGPE 158

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.01
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 97.97
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 97.92
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 97.91
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.75
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.75
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 97.73
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.71
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.68
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 97.68
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.66
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 97.55
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 97.54
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 97.46
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.4
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.34
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.33
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.33
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.28
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 97.25
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.24
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.23
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.22
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.18
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.13
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.12
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.11
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.05
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.04
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.0
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 96.94
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 96.92
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 96.83
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 96.82
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.82
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.81
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.76
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 96.72
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 96.72
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 96.71
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 96.67
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 96.63
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 96.62
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.56
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 96.53
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 96.42
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.42
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.4
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 96.4
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.39
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 96.37
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 96.36
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.31
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 96.3
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 96.29
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.26
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 96.23
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 96.21
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.12
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.12
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 96.09
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 96.06
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.04
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.01
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.0
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.96
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.93
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.92
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.91
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.84
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.76
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.75
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 95.73
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 95.71
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.67
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.59
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.57
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.56
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 95.48
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.32
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.16
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 95.11
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 95.08
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.05
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.04
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 95.02
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 94.9
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 94.81
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 94.78
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 94.71
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.7
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 94.62
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.58
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 94.48
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 94.45
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.42
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 94.41
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 94.33
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.28
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 94.15
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 93.94
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 93.72
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.62
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 93.51
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 93.2
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 92.96
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.44
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.82
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 91.59
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 91.41
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 91.34
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 91.1
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 91.03
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 90.8
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 90.69
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 90.68
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.07
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 88.92
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 87.95
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 87.88
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 87.11
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 86.69
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 86.54
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 84.75
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 84.72
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 84.37
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 82.79
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 81.07
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Penta-EF-hand proteins
domain: Programmed cell death 6 protein-like protein
species: Leishmania major [TaxId: 5664]

Probab=98.01  E-value=1.3e-05  Score=60.86  Aligned_cols=127  Identities=15%  Similarity=0.242  Sum_probs=82.9

Q ss_pred             CCCCCCCccCHHHHHHHHHHHHHHHHhhCCCCCchHHHHHHHHHhhCCCCCCceehhHHhhc-chhHHHHHHHhchhhhh
Q psy1461           1 MDLDGDGYLSMYELEYFYDEQLQRMDAIGIECLPFEDCLCQMLDMIKPEVPGKISLQDLKRC-KMTRIFFDTFFNLEKYL   79 (189)
Q Consensus         1 lD~dgdG~Ls~~dLe~F~~e~~~~l~~~~~e~~~f~d~~cqi~d~l~p~~~grItl~DL~~S-~~~~~f~~~l~~l~~f~   79 (189)
                      +|.+|+|+||..|+....+.       ++.. ++-. -+.+++..++...+|+|+..++..- .......      +.|.
T Consensus        27 ~D~d~dG~Is~~El~~~l~~-------l~~~-~s~~-~~~~l~~~~d~d~~~~i~~~ef~~~~~~~~~~~------~~F~   91 (182)
T d1y1xa_          27 VDTDGSGAISVPELNAALSS-------AGVP-FSLA-TTEKLLHMYDKNHSGEITFDEFKDLHHFILSMR------EGFR   91 (182)
T ss_dssp             HCTTCSSSBCHHHHHHHHCB-------TTBC-CCHH-HHHHHHHHHCTTCSSSBCHHHHHHHHHHHHHHH------HHHH
T ss_pred             HcCCCcCCCCHHHHHHHHHH-------hccc-Cchh-hhhhhhccccccccccccccccccccccccccc------cchh
Confidence            48999999999998875432       3322 2222 3456677788888899999888762 1111111      1222


Q ss_pred             ccc-cCCccccc--------CCcccchhHHHHHHhhcccccCCCcccHHHHHHHHHHhcCCCCchhHHHHHHhhcCCC
Q psy1461          80 DHE-QRDPFASQ--------RDDDTLSSRMIDRIFSGTVTRSKHVMTYTEFVWFLLAEEDKTHPRAIEYWFRSRKTEA  148 (189)
Q Consensus        80 ~~e-~rd~f~~~--------rD~~~l~~~~idRiF~~~~~~~~~~mdy~~fv~f~la~e~k~~~~si~YwFr~lD~~~  148 (189)
                      .++ +++.....        +-+..+++..++.+|...-+...|.++|.+|+.+++..+      .++..|+..|.++
T Consensus        92 ~~D~~~~g~I~~~el~~~l~~~g~~ls~~e~~~i~~~~d~~~dg~I~~~eF~~~~~~l~------~~~~~F~~~D~~~  163 (182)
T d1y1xa_          92 KRDSSGDGRLDSNEVRAALLSSGYQVSEQTFQALMRKFDRQRRGSLGFDDYVELSIFVC------RVRNVFAFYDRER  163 (182)
T ss_dssp             HHCTTSSSCBCHHHHHHHHHTTSCCCCHHHHHHHHHHHCTTCSSSBCHHHHHHHHHHHH------HHHHHHHHHCTTC
T ss_pred             ccccccchhhhhHHHHHHHHHhCCchhHHHHHHHHhhcccCCCCCcCHHHHHHHHHHHH------HHHHHHHHhCCCC
Confidence            221 23333322        124467888899998877555578999999999998765      4777899998765
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure