Psyllid ID: psy14621


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MVAGASGGIGQPLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAKS
cEEEccccccHHHHccccccccccHHHHccccccEEEEcccccccccccEEEEEcccccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEEcccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccEEEEEEEEccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cEEccccccHHHHHHHHHHcccccEEEEEEccccEEEEEccccccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHcccccccEEEEEEcHHHHccccHHHcEccEEEcccHHHEEEcHHHcEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccEEEEEEEEEccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mvagasggigqplslllkqsplvdhlslydinNAKVMVAgasggigqplslllkqsplvdhlslydivhtpgvaadlshIESKAHVqafngadqlkglnptdvnvpvigghagitiiplisqatpsvsfpddQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIqglkgesnvIECAYvksdvteasyfstpvhlgkngieknlglgklsDFEKELVKAAVPELKKNIAKGEEFVAKS
mvagasggigqpLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASyfstpvhlgkngiEKNLGLGKLSDFEKELVKAAVPELkkniakgeefvaks
MVAGASGGIGqplslllkqsplVDHLSLYDINNAKVMVAGASGGIGqplslllkqsplVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAKS
************LSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAV*****************
MVAGASGGIGQPLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVA**
********IGQPLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAKS
MVAGASGGIGQPLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAKS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAGASGGIGQPLSLLLKQSPLVDHLSLYDINNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q5NVR2338 Malate dehydrogenase, mit yes N/A 0.625 0.458 0.693 4e-60
P40926338 Malate dehydrogenase, mit yes N/A 0.625 0.458 0.693 5e-60
Q4R568338 Malate dehydrogenase, mit N/A N/A 0.625 0.458 0.681 4e-59
P04636338 Malate dehydrogenase, mit yes N/A 0.625 0.458 0.675 1e-58
P08249338 Malate dehydrogenase, mit yes N/A 0.645 0.473 0.668 2e-58
P00346338 Malate dehydrogenase, mit yes N/A 0.612 0.449 0.703 2e-58
Q32LG3338 Malate dehydrogenase, mit yes N/A 0.612 0.449 0.703 3e-58
O02640341 Probable malate dehydroge yes N/A 0.629 0.457 0.631 1e-48
B2VGW7311 Malate dehydrogenase OS=E yes N/A 0.979 0.781 0.410 9e-46
A4WF48312 Malate dehydrogenase OS=E yes N/A 0.987 0.785 0.394 4e-45
>sp|Q5NVR2|MDHM_PONAB Malate dehydrogenase, mitochondrial OS=Pongo abelii GN=MDH2 PE=2 SV=1 Back     alignment and function desciption
 Score =  231 bits (588), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 131/160 (81%)

Query: 86  VQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAG 145
           V+A     +LKGL+P  VNVPVIGGHAG TIIPLISQ TP V FP DQL ALTGRIQEAG
Sbjct: 175 VRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAG 234

Query: 146 TEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHL 205
           TEVVKAKAGAGSATLSMAYAGARF FSL+  + G+  V+EC++VKS  TE +YFSTP+ L
Sbjct: 235 TEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLL 294

Query: 206 GKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245
           GK GIEKNLG+GK+S FE++++  A+PELK +I KGE+FV
Sbjct: 295 GKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFV 334





Pongo abelii (taxid: 9601)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7
>sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens GN=MDH2 PE=1 SV=3 Back     alignment and function description
>sp|Q4R568|MDHM_MACFA Malate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=MDH2 PE=2 SV=1 Back     alignment and function description
>sp|P04636|MDHM_RAT Malate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Mdh2 PE=1 SV=2 Back     alignment and function description
>sp|P08249|MDHM_MOUSE Malate dehydrogenase, mitochondrial OS=Mus musculus GN=Mdh2 PE=1 SV=3 Back     alignment and function description
>sp|P00346|MDHM_PIG Malate dehydrogenase, mitochondrial OS=Sus scrofa GN=MDH2 PE=1 SV=2 Back     alignment and function description
>sp|Q32LG3|MDHM_BOVIN Malate dehydrogenase, mitochondrial OS=Bos taurus GN=MDH2 PE=1 SV=1 Back     alignment and function description
>sp|O02640|MDHM_CAEEL Probable malate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=mdh-1 PE=3 SV=1 Back     alignment and function description
>sp|B2VGW7|MDH_ERWT9 Malate dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mdh PE=3 SV=1 Back     alignment and function description
>sp|A4WF48|MDH_ENT38 Malate dehydrogenase OS=Enterobacter sp. (strain 638) GN=mdh PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
345308595255 PREDICTED: malate dehydrogenase, mitocho 0.862 0.839 0.613 3e-78
344245731271 Malate dehydrogenase, mitochondrial [Cri 0.862 0.789 0.573 2e-77
91085015336 PREDICTED: similar to malate dehydrogena 0.653 0.482 0.783 3e-67
156553655341 PREDICTED: malate dehydrogenase, mitocho 0.745 0.542 0.687 3e-66
332865953296 PREDICTED: malate dehydrogenase, mitocho 0.935 0.783 0.498 7e-66
194373719296 unnamed protein product [Homo sapiens] 0.935 0.783 0.494 1e-65
426356630296 PREDICTED: malate dehydrogenase, mitocho 0.862 0.722 0.522 1e-65
395842984310 PREDICTED: malate dehydrogenase, mitocho 0.971 0.777 0.508 1e-65
321457956340 mitochondrial malate dehydrogenase [Daph 0.657 0.479 0.760 7e-65
332375761335 unknown [Dendroctonus ponderosae] 0.612 0.453 0.815 1e-64
>gi|345308595|ref|XP_003428716.1| PREDICTED: malate dehydrogenase, mitochondrial-like, partial [Ornithorhynchus anatinus] Back     alignment and taxonomy information
 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 180/251 (71%), Gaps = 37/251 (14%)

Query: 32  NNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAH------ 85
           N+AKV V GA+GGIGQPLSLLLK SPLV  L+LYDI HTPGVAADLSHIE++A+      
Sbjct: 1   NHAKVAVLGAAGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETRANAKGKWP 60

Query: 86  -------------------------------VQAFNGADQLKGLNPTDVNVPVIGGHAGI 114
                                          V+A     +LKGL+P  VNVPVIGGHAG 
Sbjct: 61  VNSTIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK 120

Query: 115 TIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLI 174
           TIIPLISQ TP V FP DQL ALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARF FS++
Sbjct: 121 TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSVV 180

Query: 175 QGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPEL 234
             + G+  V+EC++V+S+ TE SYFSTP+ LGK GIEKNLG+GKLS FE+++V  A+PEL
Sbjct: 181 DAMNGKEGVVECSFVRSEETECSYFSTPLLLGKKGIEKNLGMGKLSPFEEKMVAEAIPEL 240

Query: 235 KKNIAKGEEFV 245
           K +I KGE+FV
Sbjct: 241 KASIRKGEDFV 251




Source: Ornithorhynchus anatinus

Species: Ornithorhynchus anatinus

Genus: Ornithorhynchus

Family: Ornithorhynchidae

Order: Monotremata

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|344245731|gb|EGW01835.1| Malate dehydrogenase, mitochondrial [Cricetulus griseus] Back     alignment and taxonomy information
>gi|91085015|ref|XP_973533.1| PREDICTED: similar to malate dehydrogenase [Tribolium castaneum] gi|270008524|gb|EFA04972.1| hypothetical protein TcasGA2_TC015050 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156553655|ref|XP_001600547.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332865953|ref|XP_003318574.1| PREDICTED: malate dehydrogenase, mitochondrial [Pan troglodytes] gi|397475059|ref|XP_003808969.1| PREDICTED: malate dehydrogenase, mitochondrial isoform 2 [Pan paniscus] Back     alignment and taxonomy information
>gi|194373719|dbj|BAG56955.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|426356630|ref|XP_004045662.1| PREDICTED: malate dehydrogenase, mitochondrial isoform 3 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|395842984|ref|XP_003794286.1| PREDICTED: malate dehydrogenase, mitochondrial [Otolemur garnettii] Back     alignment and taxonomy information
>gi|321457956|gb|EFX69032.1| mitochondrial malate dehydrogenase [Daphnia pulex] Back     alignment and taxonomy information
>gi|332375761|gb|AEE63021.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
ZFIN|ZDB-GENE-040426-2143337 mdh2 "malate dehydrogenase 2, 0.649 0.477 0.714 8.5e-75
UNIPROTKB|P40926338 MDH2 "Malate dehydrogenase, mi 0.645 0.473 0.693 2.3e-72
UNIPROTKB|Q5NVR2338 MDH2 "Malate dehydrogenase, mi 0.645 0.473 0.693 2.3e-72
UNIPROTKB|Q4R568338 MDH2 "Malate dehydrogenase, mi 0.645 0.473 0.681 2e-71
UNIPROTKB|E9PDB2296 MDH2 "Malate dehydrogenase, mi 0.600 0.503 0.718 4.2e-71
RGD|619719338 Mdh2 "malate dehydrogenase 2, 0.645 0.473 0.675 5.3e-71
UNIPROTKB|I3LP41338 MDH2 "Malate dehydrogenase" [S 0.612 0.449 0.703 6.8e-71
UNIPROTKB|P00346338 MDH2 "Malate dehydrogenase, mi 0.612 0.449 0.703 6.8e-71
MGI|MGI:97050338 Mdh2 "malate dehydrogenase 2, 0.645 0.473 0.668 6.8e-71
UNIPROTKB|E1BVT3337 MDH2 "Malate dehydrogenase" [G 0.653 0.480 0.674 8.6e-71
ZFIN|ZDB-GENE-040426-2143 mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 576 (207.8 bits), Expect = 8.5e-75, Sum P(2) = 8.5e-75
 Identities = 115/161 (71%), Positives = 133/161 (82%)

Query:    86 VQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAG 145
             V+A     +LKGL+P  VNVPV+GGHAGITIIPLISQ TP V FP DQL ALTGRIQEAG
Sbjct:   174 VRANTFVAELKGLDPARVNVPVVGGHAGITIIPLISQCTPKVEFPADQLSALTGRIQEAG 233

Query:   146 TEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHL 205
             TEVVKAKAGAGSATLSMAYAGARF FSL+  + G+  V+EC++V+S+ TE  YFSTP+ L
Sbjct:   234 TEVVKAKAGAGSATLSMAYAGARFTFSLLDAMNGKEGVVECSFVRSEETECKYFSTPLLL 293

Query:   206 GKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVA 246
             GKNGIEKNLGLGKLS FE++LV  A+ ELK +I KGE+FVA
Sbjct:   294 GKNGIEKNLGLGKLSAFEEKLVADAMTELKGSIKKGEDFVA 334


GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0016615 "malate dehydrogenase activity" evidence=IEA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IEA
GO:0006108 "malate metabolic process" evidence=IEA
GO:0030060 "L-malate dehydrogenase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA
UNIPROTKB|P40926 MDH2 "Malate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5NVR2 MDH2 "Malate dehydrogenase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R568 MDH2 "Malate dehydrogenase, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDB2 MDH2 "Malate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619719 Mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LP41 MDH2 "Malate dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P00346 MDH2 "Malate dehydrogenase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97050 Mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVT3 MDH2 "Malate dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5NVR2MDHM_PONAB1, ., 1, ., 1, ., 3, 70.69370.6250.4585yesN/A
B1LGK2MDH_ECOSM1, ., 1, ., 1, ., 3, 70.57140.61690.4903yesN/A
P08249MDHM_MOUSE1, ., 1, ., 1, ., 3, 70.66870.64510.4733yesN/A
B5XSQ7MDH_KLEP31, ., 1, ., 1, ., 3, 70.39540.97980.7788yesN/A
Q31WA4MDH_SHIBS1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
Q9ZP06MDHM1_ARATH1, ., 1, ., 1, ., 3, 70.62230.57660.4193yesN/A
A7MNR3MDH_CROS81, ., 1, ., 1, ., 3, 70.38830.98790.7852yesN/A
B7N0M1MDH_ECO811, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
Q0TCN0MDH_ECOL51, ., 1, ., 1, ., 3, 70.57140.61690.4903yesN/A
B4F2A1MDH_PROMH1, ., 1, ., 1, ., 3, 70.57790.61690.4903yesN/A
B7UJW8MDH_ECO271, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
Q1R6A3MDH_ECOUT1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
Q32LG3MDHM_BOVIN1, ., 1, ., 1, ., 3, 70.70390.61290.4497yesN/A
A1AGC9MDH_ECOK11, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
C4ZSX4MDH_ECOBW1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
B2U1U9MDH_SHIB31, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
A6TEQ3MDH_KLEP71, ., 1, ., 1, ., 3, 70.39540.97980.7788yesN/A
B7MBZ7MDH_ECO451, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
O02640MDHM_CAEEL1, ., 1, ., 1, ., 3, 70.63120.62900.4574yesN/A
B7LHU4MDH_ECO551, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
A8A545MDH_ECOHS1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
P40926MDHM_HUMAN1, ., 1, ., 1, ., 3, 70.69370.6250.4585yesN/A
A7ZSD0MDH_ECO241, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
P04636MDHM_RAT1, ., 1, ., 1, ., 3, 70.6750.6250.4585yesN/A
B6I1V4MDH_ECOSE1, ., 1, ., 1, ., 3, 70.39540.97980.7788yesN/A
B1XHK9MDH_ECODH1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
B2VGW7MDH_ERWT91, ., 1, ., 1, ., 3, 70.41040.97980.7813yesN/A
P00346MDHM_PIG1, ., 1, ., 1, ., 3, 70.70390.61290.4497yesN/A
B7NKU9MDH_ECO7I1, ., 1, ., 1, ., 3, 70.57140.61690.4903yesN/A
B7NDL4MDH_ECOLU1, ., 1, ., 1, ., 3, 70.57140.61690.4903yesN/A
Q3YX11MDH_SHISS1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
P61890MDH_ECOL61, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
A4WF48MDH_ENT381, ., 1, ., 1, ., 3, 70.39480.98790.7852yesN/A
Q7MYW9MDH_PHOLL1, ., 1, ., 1, ., 3, 70.56570.60880.4839yesN/A
B5YSW2MDH_ECO5E1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
B1IQP3MDH_ECOLC1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A
A8AQC8MDH_CITK81, ., 1, ., 1, ., 3, 70.58440.61690.4903yesN/A
B7M0U8MDH_ECO8A1, ., 1, ., 1, ., 3, 70.56490.61690.4903yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.921
3rd Layer1.1.1.370.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma 1e-93
PLN00106323 PLN00106, PLN00106, malate dehydrogenase 3e-76
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, 1e-75
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisio 6e-69
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisio 2e-62
pfam02866173 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, 4e-51
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma 3e-31
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energ 3e-26
PLN00106323 PLN00106, PLN00106, malate dehydrogenase 4e-25
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, 4e-22
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisio 3e-20
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisio 2e-15
pfam00056142 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, 1e-13
cd01339300 cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik 3e-12
PRK06223307 PRK06223, PRK06223, malate dehydrogenase; Reviewed 1e-11
PTZ00082321 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi 6e-10
cd00300300 cd00300, LDH_like, L-lactate dehydrogenase-like en 1e-07
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energ 4e-07
TIGR01771299 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase 1e-06
PTZ00117319 PTZ00117, PTZ00117, malate dehydrogenase; Provisio 1e-06
TIGR01763305 TIGR01763, MalateDH_bact, malate dehydrogenase, NA 3e-06
cd05291306 cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd 3e-05
cd00650263 cd00650, LDH_MDH_like, NAD-dependent, lactate dehy 1e-04
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
 Score =  277 bits (710), Expect = 1e-93
 Identities = 108/152 (71%), Positives = 132/152 (86%)

Query: 94  QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
           +L GL+P  VNVPVIGGH+G+TI+PL+SQ  P  +F  ++++ALT RIQ  G EVVKAKA
Sbjct: 159 ELLGLDPAKVNVPVIGGHSGVTILPLLSQCQPPFTFDQEEIEALTHRIQFGGDEVVKAKA 218

Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
           GAGSATLSMAYAGARFA SL++GLKGE  VIECAYV+SDVTEA +F+TPV LGKNG+EKN
Sbjct: 219 GAGSATLSMAYAGARFANSLLRGLKGEKGVIECAYVESDVTEAPFFATPVELGKNGVEKN 278

Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245
           LGLGKL+D+EK+L++AA+PELKKNI KG +FV
Sbjct: 279 LGLGKLNDYEKKLLEAALPELKKNIEKGVDFV 310


MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 310

>gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 100.0
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 100.0
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 100.0
PTZ00325321 malate dehydrogenase; Provisional 100.0
PLN00106323 malate dehydrogenase 100.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 100.0
PLN02602350 lactate dehydrogenase 100.0
KOG1495|consensus332 100.0
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 100.0
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 100.0
PRK05086312 malate dehydrogenase; Provisional 100.0
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 100.0
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 100.0
PTZ00117319 malate dehydrogenase; Provisional 100.0
PLN00112444 malate dehydrogenase (NADP); Provisional 100.0
PRK05442326 malate dehydrogenase; Provisional 100.0
PTZ00082321 L-lactate dehydrogenase; Provisional 100.0
KOG1494|consensus345 100.0
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 100.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 100.0
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 100.0
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 100.0
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 100.0
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 100.0
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 100.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 100.0
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 100.0
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 100.0
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 100.0
PRK06223307 malate dehydrogenase; Reviewed 100.0
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 100.0
PLN00135309 malate dehydrogenase 100.0
PF02866174 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta 100.0
TIGR01756313 LDH_protist lactate dehydrogenase. This model repr 100.0
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 99.97
KOG1496|consensus332 99.95
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 99.36
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 98.87
PRK15076431 alpha-galactosidase; Provisional 98.57
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.51
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 98.48
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 97.96
KOG1494|consensus345 97.22
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.2
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.14
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.91
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.78
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.63
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.53
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.47
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.34
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.31
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.29
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.24
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 95.16
KOG1429|consensus 350 95.1
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.03
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 95.0
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.0
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 94.98
PLN02572 442 UDP-sulfoquinovose synthase 94.96
PLN02166 436 dTDP-glucose 4,6-dehydratase 94.92
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 94.9
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.83
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 94.83
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.8
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.79
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.75
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 94.71
PRK07236 386 hypothetical protein; Provisional 94.71
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 94.67
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.64
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 94.63
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.62
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.61
PRK06153393 hypothetical protein; Provisional 94.6
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.56
PLN02353 473 probable UDP-glucose 6-dehydrogenase 94.55
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.48
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.48
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.43
PLN02427 386 UDP-apiose/xylose synthase 94.39
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 94.33
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.31
PLN02206 442 UDP-glucuronate decarboxylase 94.3
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.23
PRK08507275 prephenate dehydrogenase; Validated 94.23
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 94.12
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 94.11
PLN02778298 3,5-epimerase/4-reductase 94.08
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.04
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.02
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.99
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.99
CHL00194 317 ycf39 Ycf39; Provisional 93.98
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 93.98
PRK07417279 arogenate dehydrogenase; Reviewed 93.95
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.88
PRK08328231 hypothetical protein; Provisional 93.83
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.82
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.78
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.75
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.75
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 93.74
TIGR00036266 dapB dihydrodipicolinate reductase. 93.72
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.72
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 93.7
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.69
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.68
COG2910211 Putative NADH-flavin reductase [General function p 93.66
PRK05868 372 hypothetical protein; Validated 93.65
PLN02653 340 GDP-mannose 4,6-dehydratase 93.64
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.64
COG0300265 DltE Short-chain dehydrogenases of various substra 93.58
PRK06753 373 hypothetical protein; Provisional 93.57
PTZ00431260 pyrroline carboxylate reductase; Provisional 93.55
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.55
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 93.53
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 93.51
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.5
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 93.49
PLN02695 370 GDP-D-mannose-3',5'-epimerase 93.44
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.41
PRK07023243 short chain dehydrogenase; Provisional 93.37
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.36
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 93.36
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 93.35
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 93.33
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 93.33
PRK10675 338 UDP-galactose-4-epimerase; Provisional 93.28
PLN00198 338 anthocyanidin reductase; Provisional 93.27
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.27
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 93.23
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 93.17
PRK07877 722 hypothetical protein; Provisional 93.17
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 93.16
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 93.16
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.14
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 93.1
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 93.05
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 93.03
PRK08013 400 oxidoreductase; Provisional 93.0
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 92.96
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.94
PRK06847 375 hypothetical protein; Provisional 92.94
PLN02896 353 cinnamyl-alcohol dehydrogenase 92.93
PLN02240 352 UDP-glucose 4-epimerase 92.92
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.92
PRK08223287 hypothetical protein; Validated 92.89
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.87
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 92.84
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.8
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 92.78
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 92.7
PRK05866293 short chain dehydrogenase; Provisional 92.69
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 92.68
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 92.68
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 92.66
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 92.58
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.54
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.53
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.52
PLN02650 351 dihydroflavonol-4-reductase 92.48
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 92.48
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 92.44
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.4
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 92.39
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 92.35
PRK06194287 hypothetical protein; Provisional 92.34
PRK08163 396 salicylate hydroxylase; Provisional 92.34
PRK13512 438 coenzyme A disulfide reductase; Provisional 92.33
PRK07326237 short chain dehydrogenase; Provisional 92.3
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 92.27
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 92.26
PLN02697 529 lycopene epsilon cyclase 92.26
PLN02688266 pyrroline-5-carboxylate reductase 92.16
PRK14982340 acyl-ACP reductase; Provisional 92.15
PRK06184 502 hypothetical protein; Provisional 92.1
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 92.09
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 92.08
PRK07680273 late competence protein ComER; Validated 92.08
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 92.07
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.04
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 92.03
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 92.03
PRK07588 391 hypothetical protein; Provisional 92.03
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.02
PRK11728 393 hydroxyglutarate oxidase; Provisional 92.01
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 91.99
PRK11730 715 fadB multifunctional fatty acid oxidation complex 91.98
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 91.97
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 91.97
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 91.95
PRK10538248 malonic semialdehyde reductase; Provisional 91.93
PRK07045 388 putative monooxygenase; Reviewed 91.92
PRK07102243 short chain dehydrogenase; Provisional 91.89
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 91.87
PRK07538 413 hypothetical protein; Provisional 91.85
PRK08085254 gluconate 5-dehydrogenase; Provisional 91.84
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 91.84
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 91.8
KOG1430|consensus 361 91.79
PRK09564 444 coenzyme A disulfide reductase; Reviewed 91.77
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 91.77
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 91.76
PRK09242257 tropinone reductase; Provisional 91.75
PRK05717255 oxidoreductase; Validated 91.7
PRK06185 407 hypothetical protein; Provisional 91.64
PRK06057255 short chain dehydrogenase; Provisional 91.6
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 91.6
PRK12828239 short chain dehydrogenase; Provisional 91.53
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 91.52
PLN02253280 xanthoxin dehydrogenase 91.5
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 91.49
PRK12480330 D-lactate dehydrogenase; Provisional 91.46
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 91.45
PRK08251248 short chain dehydrogenase; Provisional 91.45
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 91.42
KOG1371|consensus 343 91.4
PRK07411 390 hypothetical protein; Validated 91.39
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 91.35
PRK14851 679 hypothetical protein; Provisional 91.34
PRK05875276 short chain dehydrogenase; Provisional 91.33
PRK06914280 short chain dehydrogenase; Provisional 91.3
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 91.29
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 91.24
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 91.23
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 91.23
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 91.23
PRK06126 545 hypothetical protein; Provisional 91.19
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 91.16
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 91.15
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 91.15
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 91.13
PRK08177225 short chain dehydrogenase; Provisional 91.13
PRK06124256 gluconate 5-dehydrogenase; Provisional 91.11
PRK12827249 short chain dehydrogenase; Provisional 91.1
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 91.09
PRK12829264 short chain dehydrogenase; Provisional 91.08
PLN02214 342 cinnamoyl-CoA reductase 91.07
PRK06924251 short chain dehydrogenase; Provisional 91.06
PRK06996 398 hypothetical protein; Provisional 91.05
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 91.04
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 91.03
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 91.02
PLN02256304 arogenate dehydrogenase 91.02
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 91.0
PRK08267260 short chain dehydrogenase; Provisional 91.0
PRK12320 699 hypothetical protein; Provisional 90.98
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 90.97
KOG2304|consensus298 90.93
COG2085211 Predicted dinucleotide-binding enzymes [General fu 90.92
PRK07523255 gluconate 5-dehydrogenase; Provisional 90.91
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 90.89
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 90.89
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.89
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 90.88
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 90.88
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 90.87
PRK07190 487 hypothetical protein; Provisional 90.87
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 90.86
PRK07890258 short chain dehydrogenase; Provisional 90.84
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 90.84
PRK09135249 pteridine reductase; Provisional 90.82
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 90.79
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 90.77
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.76
PRK07774250 short chain dehydrogenase; Provisional 90.74
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 90.74
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 90.74
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 90.69
PRK07063260 short chain dehydrogenase; Provisional 90.68
PRK07060245 short chain dehydrogenase; Provisional 90.67
PRK05854313 short chain dehydrogenase; Provisional 90.65
PRK07814263 short chain dehydrogenase; Provisional 90.65
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 90.64
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 90.63
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 90.62
PRK07856252 short chain dehydrogenase; Provisional 90.59
PLN00016 378 RNA-binding protein; Provisional 90.57
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 90.57
PRK08264238 short chain dehydrogenase; Validated 90.56
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 90.55
PRK06138252 short chain dehydrogenase; Provisional 90.54
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 90.51
PRK05884223 short chain dehydrogenase; Provisional 90.5
PLN02260 668 probable rhamnose biosynthetic enzyme 90.49
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 90.44
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 90.42
PRK06197306 short chain dehydrogenase; Provisional 90.39
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 90.39
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 90.38
PRK06500249 short chain dehydrogenase; Provisional 90.35
PRK09009235 C factor cell-cell signaling protein; Provisional 90.35
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 90.33
PLN02583297 cinnamoyl-CoA reductase 90.32
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 90.32
PRK08340259 glucose-1-dehydrogenase; Provisional 90.31
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 90.3
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 90.27
PRK12939250 short chain dehydrogenase; Provisional 90.27
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 90.25
PRK06180277 short chain dehydrogenase; Provisional 90.25
PRK15059292 tartronate semialdehyde reductase; Provisional 90.24
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 90.24
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 90.24
PRK09186256 flagellin modification protein A; Provisional 90.24
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 90.23
PRK10157 428 putative oxidoreductase FixC; Provisional 90.22
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.19
PRK11445 351 putative oxidoreductase; Provisional 90.11
PRK06475 400 salicylate hydroxylase; Provisional 90.09
PLN02780320 ketoreductase/ oxidoreductase 90.05
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 90.03
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.01
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 90.01
PRK07024257 short chain dehydrogenase; Provisional 90.01
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 89.99
PRK00048257 dihydrodipicolinate reductase; Provisional 89.96
PRK07577234 short chain dehydrogenase; Provisional 89.95
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 89.94
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 89.93
PRK06523260 short chain dehydrogenase; Provisional 89.91
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 89.88
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 89.84
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 89.79
PRK06172253 short chain dehydrogenase; Provisional 89.79
PRK06841255 short chain dehydrogenase; Provisional 89.79
PRK07806248 short chain dehydrogenase; Provisional 89.74
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.72
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 89.69
PRK08278273 short chain dehydrogenase; Provisional 89.67
PRK07478254 short chain dehydrogenase; Provisional 89.66
PRK14852 989 hypothetical protein; Provisional 89.66
PRK07825273 short chain dehydrogenase; Provisional 89.65
PRK07035252 short chain dehydrogenase; Provisional 89.65
PRK08017256 oxidoreductase; Provisional 89.59
PRK07208 479 hypothetical protein; Provisional 89.54
PRK08703239 short chain dehydrogenase; Provisional 89.54
PRK08132 547 FAD-dependent oxidoreductase; Provisional 89.53
PRK06834 488 hypothetical protein; Provisional 89.52
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 89.5
PRK04148134 hypothetical protein; Provisional 89.5
PRK06953222 short chain dehydrogenase; Provisional 89.47
PRK08643256 acetoin reductase; Validated 89.44
PLN02464 627 glycerol-3-phosphate dehydrogenase 89.44
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 89.44
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 89.42
PRK10015 429 oxidoreductase; Provisional 89.41
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 89.38
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 89.38
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.31
PRK08277278 D-mannonate oxidoreductase; Provisional 89.24
PRK09126 392 hypothetical protein; Provisional 89.21
PLN02985 514 squalene monooxygenase 89.21
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.2
PRK08244 493 hypothetical protein; Provisional 89.19
PRK06198260 short chain dehydrogenase; Provisional 89.17
PLN02686 367 cinnamoyl-CoA reductase 89.13
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 89.12
PRK06182273 short chain dehydrogenase; Validated 89.07
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 89.07
PRK05257 494 malate:quinone oxidoreductase; Validated 89.03
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 89.0
PRK08655 437 prephenate dehydrogenase; Provisional 88.98
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 88.95
PRK06545 359 prephenate dehydrogenase; Validated 88.94
PRK09072263 short chain dehydrogenase; Provisional 88.92
PRK08226263 short chain dehydrogenase; Provisional 88.92
PRK07454241 short chain dehydrogenase; Provisional 88.92
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.88
PRK07067257 sorbitol dehydrogenase; Provisional 88.83
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 88.81
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 88.81
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 88.81
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 88.8
PRK05867253 short chain dehydrogenase; Provisional 88.8
PRK05993277 short chain dehydrogenase; Provisional 88.77
PRK08219227 short chain dehydrogenase; Provisional 88.77
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 88.77
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 88.74
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 88.74
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 88.73
PRK08213259 gluconate 5-dehydrogenase; Provisional 88.71
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 88.71
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.69
PRK05693274 short chain dehydrogenase; Provisional 88.69
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 88.69
PRK12770 352 putative glutamate synthase subunit beta; Provisio 88.69
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 88.69
KOG1502|consensus 327 88.67
PRK08300302 acetaldehyde dehydrogenase; Validated 88.67
PRK06179270 short chain dehydrogenase; Provisional 88.67
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 88.66
PRK06398258 aldose dehydrogenase; Validated 88.64
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 88.61
PRK06181263 short chain dehydrogenase; Provisional 88.6
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 88.59
PRK07453 322 protochlorophyllide oxidoreductase; Validated 88.54
PRK06101240 short chain dehydrogenase; Provisional 88.53
PRK12831 464 putative oxidoreductase; Provisional 88.52
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 88.51
PLN02712 667 arogenate dehydrogenase 88.49
PRK12937245 short chain dehydrogenase; Provisional 88.42
PLN02463 447 lycopene beta cyclase 88.41
PTZ00367 567 squalene epoxidase; Provisional 88.39
PRK06949258 short chain dehydrogenase; Provisional 88.39
PRK14027283 quinate/shikimate dehydrogenase; Provisional 88.37
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 88.34
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 88.27
PTZ00383 497 malate:quinone oxidoreductase; Provisional 88.25
PRK07578199 short chain dehydrogenase; Provisional 88.25
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 88.23
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 88.2
PRK07062265 short chain dehydrogenase; Provisional 88.19
PRK06701290 short chain dehydrogenase; Provisional 88.18
PRK07201 657 short chain dehydrogenase; Provisional 88.18
PRK05876275 short chain dehydrogenase; Provisional 88.17
PRK07576264 short chain dehydrogenase; Provisional 88.16
PRK08265261 short chain dehydrogenase; Provisional 88.16
PRK05650270 short chain dehydrogenase; Provisional 88.14
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 88.13
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 88.12
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 88.08
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 88.07
PLN02712667 arogenate dehydrogenase 88.02
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 88.01
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.95
PRK08628258 short chain dehydrogenase; Provisional 87.94
PRK06196315 oxidoreductase; Provisional 87.92
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.89
PRK07074257 short chain dehydrogenase; Provisional 87.88
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 87.85
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 87.84
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 87.77
PRK13403 335 ketol-acid reductoisomerase; Provisional 87.76
PRK12367245 short chain dehydrogenase; Provisional 87.73
KOG2336|consensus 422 87.69
PRK06567 1028 putative bifunctional glutamate synthase subunit b 87.61
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 87.58
PRK08263275 short chain dehydrogenase; Provisional 87.58
KOG2018|consensus 430 87.57
PRK07233 434 hypothetical protein; Provisional 87.52
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 87.51
PRK09897 534 hypothetical protein; Provisional 87.48
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 87.46
PRK12814 652 putative NADPH-dependent glutamate synthase small 87.44
PRK09496 453 trkA potassium transporter peripheral membrane com 87.4
PRK12824245 acetoacetyl-CoA reductase; Provisional 87.39
PRK07831262 short chain dehydrogenase; Provisional 87.36
PRK07069251 short chain dehydrogenase; Validated 87.35
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 87.34
PRK07109 334 short chain dehydrogenase; Provisional 87.31
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 87.26
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 87.16
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 87.15
PRK08589272 short chain dehydrogenase; Validated 87.12
PRK06483236 dihydromonapterin reductase; Provisional 87.12
PRK07832272 short chain dehydrogenase; Provisional 87.08
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 87.08
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 87.05
TIGR01746 367 Thioester-redct thioester reductase domain. It has 87.02
PRK08294 634 phenol 2-monooxygenase; Provisional 87.0
PRK12742237 oxidoreductase; Provisional 87.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 86.99
PRK05872296 short chain dehydrogenase; Provisional 86.95
PRK08339263 short chain dehydrogenase; Provisional 86.95
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 86.94
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 86.94
PRK13304265 L-aspartate dehydrogenase; Reviewed 86.82
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 86.76
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 86.76
COG3349 485 Uncharacterized conserved protein [Function unknow 86.7
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 86.68
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 86.62
PRK06482276 short chain dehydrogenase; Provisional 86.54
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 86.44
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.42
PRK06114254 short chain dehydrogenase; Provisional 86.31
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 86.29
PRK09291257 short chain dehydrogenase; Provisional 86.26
PRK11883 451 protoporphyrinogen oxidase; Reviewed 86.23
PRK06947248 glucose-1-dehydrogenase; Provisional 86.18
PRK05479 330 ketol-acid reductoisomerase; Provisional 86.12
PRK07424406 bifunctional sterol desaturase/short chain dehydro 86.11
PRK05865 854 hypothetical protein; Provisional 86.09
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.99
PRK08605332 D-lactate dehydrogenase; Validated 85.91
PRK07904253 short chain dehydrogenase; Provisional 85.91
PRK06139 330 short chain dehydrogenase; Provisional 85.9
PTZ00188 506 adrenodoxin reductase; Provisional 85.88
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.84
PRK12744257 short chain dehydrogenase; Provisional 85.82
PLN02268 435 probable polyamine oxidase 85.79
PRK12746254 short chain dehydrogenase; Provisional 85.79
PRK09134258 short chain dehydrogenase; Provisional 85.78
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 85.77
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 85.74
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 85.72
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 85.72
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
Probab=100.00  E-value=1.1e-50  Score=368.78  Aligned_cols=211  Identities=70%  Similarity=1.090  Sum_probs=190.2

Q ss_pred             cEEEEEcCCCccHHHHHHHHHhCCCcceEEEEecCCchhhHhhhcCccCCCeEEEE-cC---------ch----------
Q psy14621         34 AKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAF-NG---------AD----------   93 (248)
Q Consensus        34 ~KV~IiGaaG~VG~~~a~~l~~~~l~~elvLiDi~~a~g~a~DL~~~~~~~~v~~~-~~---------~d----------   93 (248)
                      |||+||||+|+||+++||+|+.+++++||+|+|++.++|++|||+|+.++++++.+ .+         +|          
T Consensus         1 ~KI~IIGaaG~VG~~~a~~l~~~~~~~elvLiDi~~a~g~alDL~~~~~~~~i~~~~~~~~~y~~~~daDivvitaG~~~   80 (310)
T cd01337           1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGADVVVIPAGVPR   80 (310)
T ss_pred             CEEEEECCCCHHHHHHHHHHHhCCCCcEEEEEecCccceeehHhHhCCCcceEEEecCCCchHHhcCCCCEEEEeCCCCC
Confidence            69999999899999999999999999999999999889999999999866666653 21         11          


Q ss_pred             ------------------------------------------------------------------------------hh
Q psy14621         94 ------------------------------------------------------------------------------QL   95 (248)
Q Consensus        94 ------------------------------------------------------------------------------~~   95 (248)
                                                                                                    ++
T Consensus        81 k~g~tR~dll~~N~~i~~~i~~~i~~~~p~a~vivvtNPvDv~~~i~t~~~~~~s~~p~~rviG~~~LDs~R~~~~la~~  160 (310)
T cd01337          81 KPGMTRDDLFNINAGIVRDLATAVAKACPKALILIISNPVNSTVPIAAEVLKKAGVYDPKRLFGVTTLDVVRANTFVAEL  160 (310)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHhCCCeEEEEccCchhhHHHHHHHHHHHhcCCCHHHEEeeechHHHHHHHHHHHH
Confidence                                                                                          88


Q ss_pred             cCCCCCCeeEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHhc
Q psy14621         96 KGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQ  175 (248)
Q Consensus        96 l~v~p~~V~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl~  175 (248)
                      ++++|++|++|||||||||||||+||+++|..+++++++++|.++|+++||+|+++|.|||+|+||+|.++++|+++|++
T Consensus       161 l~v~~~~V~~~v~GeHsGds~vp~~S~~~~~~~~~~~~~~~i~~~v~~~g~~Ii~~k~gkg~t~~~~a~a~~~iv~aIl~  240 (310)
T cd01337         161 LGLDPAKVNVPVIGGHSGVTILPLLSQCQPPFTFDQEEIEALTHRIQFGGDEVVKAKAGAGSATLSMAYAGARFANSLLR  240 (310)
T ss_pred             hCcCHHHEEEEEEecCCCCceecccccccccccCCHHHHHHHHHHHHHHHHHHHhCccCCCCcchhHHHHHHHHHHHHHH
Confidence            89999999999999998899999999999876777767999999999999999997546899999999999999999997


Q ss_pred             ccCCCCeEEEeeEecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy14621        176 GLKGESNVIECAYVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFV  245 (248)
Q Consensus       176 ~l~~~~~il~~s~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~~l~~~  245 (248)
                      ++++++.++|+++++++ | +++|||+||++|++||++++++++|+++|+++|++|++.|++.++.+++|+
T Consensus       241 ~~~~~~~~~~~s~~~~~-g~~~v~~s~P~~ig~~Gv~~i~~l~~L~~~E~~~l~~S~~~i~~~~~~g~~~~  310 (310)
T cd01337         241 GLKGEKGVIECAYVESD-VTEAPFFATPVELGKNGVEKNLGLGKLNDYEKKLLEAALPELKKNIEKGVDFV  310 (310)
T ss_pred             hcCCCcceEEEEEEecc-CCCceEEEEEEEEeCCeEEEEeCCCCCCHHHHHHHHHHHHHHHHHHhhhcccC
Confidence            54467788888888877 7 899999999999999999999923999999999999999999999999884



MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>KOG1495|consensus Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG1494|consensus Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PLN00135 malate dehydrogenase Back     alignment and domain information
>PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01756 LDH_protist lactate dehydrogenase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>KOG1496|consensus Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>KOG1494|consensus Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2dfd_A342 Crystal Structure Of Human Malate Dehydrogenase Typ 5e-61
1mld_A314 Refined Structure Of Mitochondrial Malate Dehydroge 2e-59
2pwz_A312 Crystal Structure Of The Apo Form Of E.Coli Malate 2e-43
1ib6_A312 Crystal Structure Of R153c E. Coli Malate Dehydroge 5e-43
1emd_A312 Crystal Structure Of A Ternary Complex Of Escherich 5e-43
1smk_A326 Mature And Translocatable Forms Of Glyoxysomal Mala 2e-42
1sev_A362 Mature And Translocatable Forms Of Glyoxysomal Mala 2e-42
4e0b_A313 2.17 Angstrom Resolution Crystal Structure Of Malat 1e-36
2hjr_A328 Crystal Structure Of Cryptosporidium Parvum Malate 2e-04
3tl2_A315 Crystal Structure Of Bacillus Anthracis Str. Ames M 2e-04
>pdb|2DFD|A Chain A, Crystal Structure Of Human Malate Dehydrogenase Type 2 Length = 342 Back     alignment and structure

Iteration: 1

Score = 230 bits (587), Expect = 5e-61, Method: Compositional matrix adjust. Identities = 111/160 (69%), Positives = 131/160 (81%) Query: 86 VQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAG 145 V+A +LKGL+P VNVPVIGGHAG TIIPLISQ TP V FP DQL ALTGRIQEAG Sbjct: 179 VRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAG 238 Query: 146 TEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHL 205 TEVVKAKAGAGSATLSMAYAGARF FSL+ + G+ V+EC++VKS TE +YFSTP+ L Sbjct: 239 TEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLL 298 Query: 206 GKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245 GK GIEKNLG+GK+S FE++++ A+PELK +I KGE+FV Sbjct: 299 GKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFV 338
>pdb|1MLD|A Chain A, Refined Structure Of Mitochondrial Malate Dehydrogenase From Porcine Heart And The Consensus Structure For Dicarboxylic Acid Oxidoreductases Length = 314 Back     alignment and structure
>pdb|2PWZ|A Chain A, Crystal Structure Of The Apo Form Of E.Coli Malate Dehydrogenase Length = 312 Back     alignment and structure
>pdb|1IB6|A Chain A, Crystal Structure Of R153c E. Coli Malate Dehydrogenase Length = 312 Back     alignment and structure
>pdb|1EMD|A Chain A, Crystal Structure Of A Ternary Complex Of Escherichia Coli Malate Dehydrogenase, Citrate And Nad At 1.9 Angstroms Resolution Length = 312 Back     alignment and structure
>pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 326 Back     alignment and structure
>pdb|1SEV|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 362 Back     alignment and structure
>pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 Back     alignment and structure
>pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 Back     alignment and structure
>pdb|3TL2|A Chain A, Crystal Structure Of Bacillus Anthracis Str. Ames Malate Dehydrogenase In Closed Conformation Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 4e-79
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 1e-25
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 1e-77
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 9e-26
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 1e-74
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 2e-21
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 3e-13
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 3e-13
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 1e-12
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 2e-12
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 5e-12
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 6e-12
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 6e-12
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 1e-11
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 2e-11
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 3e-11
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 3e-11
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 3e-11
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 4e-11
3tl2_A315 Malate dehydrogenase; center for structural genomi 4e-11
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 9e-11
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 2e-10
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 2e-10
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 3e-10
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 3e-10
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 3e-10
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 3e-10
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 5e-10
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 5e-10
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 8e-10
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 1e-09
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 1e-09
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 4e-09
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 6e-09
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 3e-08
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 5e-08
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 7e-08
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 6e-07
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 Back     alignment and structure
 Score =  240 bits (614), Expect = 4e-79
 Identities = 81/154 (52%), Positives = 114/154 (74%)

Query: 94  QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
           ++ GL+P DV+VPV+GGHAG+TI+PL+SQ  P  SF  +++  LT RIQ  GTEVV+AKA
Sbjct: 167 EVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKA 226

Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
           GAGSATLSMAYA  +FA + ++GL+G++ VIECA+V S VTE  +F++ V LG+NGIE+ 
Sbjct: 227 GAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEV 286

Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAK 247
             LG L+++E+  ++ A  EL  +I KG  F+  
Sbjct: 287 YSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS 320


>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 100.0
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 100.0
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 100.0
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 100.0
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 100.0
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 100.0
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 100.0
3tl2_A315 Malate dehydrogenase; center for structural genomi 100.0
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 100.0
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 100.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 100.0
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 100.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 100.0
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 100.0
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 100.0
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 100.0
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 100.0
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 100.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 100.0
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 100.0
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 100.0
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 100.0
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 100.0
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 100.0
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 100.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 100.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 100.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 100.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 100.0
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 100.0
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 100.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 100.0
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 100.0
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 100.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 100.0
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 100.0
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 99.96
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 99.93
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 99.91
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 99.88
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 99.36
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.91
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 98.81
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.19
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.09
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.02
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.01
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.89
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.83
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.74
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.72
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.71
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.69
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 95.67
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.67
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.6
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.56
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 95.54
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.54
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.52
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.51
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.47
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.46
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.43
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.42
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.36
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 95.34
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.31
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.28
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.27
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.23
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 95.22
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.21
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.21
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 95.14
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.05
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.04
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 95.04
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 95.03
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.02
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.02
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.01
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.96
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.94
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 94.89
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 94.89
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.88
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 94.88
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 94.86
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.83
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 94.82
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.81
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.79
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 94.77
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 94.77
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.77
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 94.77
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.76
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 94.76
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.76
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.75
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.73
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 94.72
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.71
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 94.7
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 94.7
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 94.68
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 94.68
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.67
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 94.63
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.62
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 94.62
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 94.62
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.61
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.59
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 94.58
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 94.57
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 94.54
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.53
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 94.53
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.52
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.5
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.48
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.47
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 94.46
1yb4_A295 Tartronic semialdehyde reductase; structural genom 94.45
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 94.44
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 94.39
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 94.39
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 94.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.38
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.38
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 94.37
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 94.35
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 94.35
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.35
1xq6_A253 Unknown protein; structural genomics, protein stru 94.34
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.31
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.3
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.28
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 94.28
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 94.27
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 94.26
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 94.26
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.26
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.24
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.24
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 94.22
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 94.22
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.21
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 94.2
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.19
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 94.19
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.16
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.14
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 94.1
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 94.08
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.08
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 94.07
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.05
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 94.04
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 94.04
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 94.02
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 94.0
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 93.99
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 93.97
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.96
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 93.92
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 93.91
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 93.9
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.88
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 93.85
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.82
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 93.81
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 93.79
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 93.79
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 93.78
1vpd_A299 Tartronate semialdehyde reductase; structural geno 93.74
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 93.72
4ezb_A317 Uncharacterized conserved protein; structural geno 93.71
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 93.7
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 93.69
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 93.67
2ywl_A180 Thioredoxin reductase related protein; uncharacter 93.64
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 93.63
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 93.58
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 93.57
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 93.57
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.55
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 93.53
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 93.53
3dme_A 369 Conserved exported protein; structural genomics, P 93.52
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.5
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 93.48
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.46
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 93.46
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 93.45
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 93.44
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 93.43
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 93.42
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 93.42
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.41
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 93.4
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 93.39
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 93.38
3l6d_A306 Putative oxidoreductase; structural genomics, prot 93.36
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 93.36
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.35
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 93.34
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 93.33
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.31
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 93.31
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 93.3
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.29
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 93.26
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 93.25
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 93.25
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 93.24
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 93.24
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 93.19
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 93.14
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 93.14
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.08
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 93.08
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 93.06
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 93.05
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.05
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 93.03
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 93.03
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 93.02
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 92.99
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.98
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 92.97
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.94
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 92.94
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.93
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 92.91
3gem_A260 Short chain dehydrogenase; structural genomics, AP 92.91
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 92.9
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 92.88
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 92.86
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 92.84
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 92.82
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 92.82
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 92.81
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 92.8
2wm3_A299 NMRA-like family domain containing protein 1; unkn 92.79
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 92.79
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 92.78
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 92.76
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 92.74
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 92.74
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 92.73
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 92.72
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 92.72
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 92.7
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 92.67
4dqx_A277 Probable oxidoreductase protein; structural genomi 92.65
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.6
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 92.58
1ooe_A236 Dihydropteridine reductase; structural genomics, P 92.57
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 92.56
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 92.56
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.55
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 92.55
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 92.55
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 92.54
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 92.52
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 92.51
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 92.51
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 92.51
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 92.5
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.49
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 92.48
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 92.48
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 92.48
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 92.47
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 92.44
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.42
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 92.42
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 92.38
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.37
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 92.36
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 92.34
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 92.33
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 92.33
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 92.33
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 92.31
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 92.27
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 92.27
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 92.25
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 92.25
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.25
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 92.22
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 92.21
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 92.19
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.18
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 92.16
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 92.15
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 92.15
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 92.14
3cxt_A291 Dehydrogenase with different specificities; rossma 92.13
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 92.11
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.1
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 92.1
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 92.07
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 92.06
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 92.04
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 91.98
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 91.96
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 91.96
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 91.95
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 91.95
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 91.94
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 91.94
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 91.91
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 91.9
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.87
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 91.85
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 91.85
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 91.85
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 91.84
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 91.83
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 91.82
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 91.81
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 91.8
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 91.79
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 91.75
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 91.75
1xq1_A266 Putative tropinone reducatse; structural genomics, 91.74
2cul_A232 Glucose-inhibited division protein A-related PROT 91.73
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.73
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 91.72
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 91.71
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 91.68
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 91.67
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 91.66
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 91.65
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 91.62
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 91.62
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 91.6
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 91.59
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 91.58
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.58
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 91.57
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 91.57
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 91.56
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 91.55
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.55
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 91.54
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.51
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 91.51
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 91.5
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.49
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 91.44
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 91.43
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 91.42
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 91.41
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.37
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 91.36
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 91.34
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 91.33
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 91.33
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 91.32
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 91.28
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 91.27
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 91.26
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 91.25
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 91.25
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 91.22
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 91.22
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.22
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 91.2
3rih_A293 Short chain dehydrogenase or reductase; structural 91.19
2bry_A 497 NEDD9 interacting protein with calponin homology a 91.17
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 91.16
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 90.51
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.15
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 91.14
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 91.14
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 91.12
4f6c_A 427 AUSA reductase domain protein; thioester reductase 91.11
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 91.11
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 91.11
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 91.06
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 91.04
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 91.03
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 91.02
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 91.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 90.98
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 90.94
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 90.92
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 90.91
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 90.9
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 90.89
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 90.88
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.84
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 90.82
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 90.8
1nff_A260 Putative oxidoreductase RV2002; directed evolution 90.8
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 90.79
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 90.79
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 90.79
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 90.78
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 90.78
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 90.77
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 90.74
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 90.72
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 90.65
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 90.65
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 90.64
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 90.64
3tjr_A301 Short chain dehydrogenase; structural genomics, se 90.62
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 90.62
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 90.61
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 90.59
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 90.58
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 90.57
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 90.56
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 90.55
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 90.55
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 90.5
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 90.49
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 90.48
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 90.46
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 90.46
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 90.46
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 90.45
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 90.42
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 90.39
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 90.39
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 90.39
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 90.38
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 90.35
3e03_A274 Short chain dehydrogenase; structural genomics, PS 90.34
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 90.32
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 90.29
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 90.28
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 90.28
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 90.26
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 90.26
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 90.25
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.25
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 90.24
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 90.23
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 90.22
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 90.22
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 90.22
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 90.2
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 90.19
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 90.17
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 90.14
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 90.14
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 90.07
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 90.03
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 90.02
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 90.01
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 89.98
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 89.98
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 89.97
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 89.97
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 89.96
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 89.96
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 89.94
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 89.91
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 89.87
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 89.87
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 89.86
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 89.84
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 89.84
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 89.8
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 89.8
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 89.79
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 89.79
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 89.78
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 89.75
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 89.73
1spx_A278 Short-chain reductase family member (5L265); paral 89.72
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 89.71
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 89.66
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 89.65
4eso_A255 Putative oxidoreductase; NADP, structural genomics 89.62
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 89.61
1xhl_A297 Short-chain dehydrogenase/reductase family member 89.55
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 89.54
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 89.49
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 89.48
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 89.47
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 89.47
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 89.46
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 89.43
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 89.42
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 89.42
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.42
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 89.41
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 89.4
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 89.36
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 89.35
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-49  Score=358.84  Aligned_cols=212  Identities=57%  Similarity=0.906  Sum_probs=189.6

Q ss_pred             cEEEEEcCCCccHHHHHHHHHhC-CCcceEEEEecCC-chhhHhhhcCccCCCeEEEEc--Cc-------h---------
Q psy14621         34 AKVMVAGASGGIGQPLSLLLKQS-PLVDHLSLYDIVH-TPGVAADLSHIESKAHVQAFN--GA-------D---------   93 (248)
Q Consensus        34 ~KV~IiGaaG~VG~~~a~~l~~~-~l~~elvLiDi~~-a~g~a~DL~~~~~~~~v~~~~--~~-------d---------   93 (248)
                      |||+||||+|+||+++|++|+++ ++++||+|+|+++ ++|++|||+|+.++++++.+.  ++       |         
T Consensus         1 mKV~IiGAaG~VG~~~a~~L~~~~~~~~el~L~Di~~~~~G~a~Dl~~~~~~~~v~~~~~~~~~~~~~~aDivii~ag~~   80 (312)
T 3hhp_A            1 MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVA   80 (312)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHHSCTTEEEEEECSSTTHHHHHHHHHTSCSSEEEEEECSSCCHHHHTTCSEEEECCSCS
T ss_pred             CEEEEECCCCHHHHHHHHHHHhCCCCCceEEEEecCCCchhHHHHhhCCCCCceEEEecCCCcHHHhCCCCEEEEeCCCC
Confidence            69999997799999999999987 8999999999998 889999999987666776542  11       1         


Q ss_pred             -------------------------------------------------------------------------------h
Q psy14621         94 -------------------------------------------------------------------------------Q   94 (248)
Q Consensus        94 -------------------------------------------------------------------------------~   94 (248)
                                                                                                     +
T Consensus        81 rkpG~~R~dll~~N~~I~~~i~~~i~~~~p~a~vlvvtNPvd~~t~~a~~~~k~sg~~p~~rv~G~~~LD~~R~~~~la~  160 (312)
T 3hhp_A           81 RKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAE  160 (312)
T ss_dssp             CCTTCCHHHHHHHHHHHHHHHHHHHHHHCTTSEEEECSSCHHHHHHHHHHHHHHTTCCCTTSEEECCHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCcEEEEecCcchhHHHHHHHHHHHcCCCCcceEEEEechhHHHHHHHHHH
Confidence                                                                                           7


Q ss_pred             hcCCCCCCeeEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHh
Q psy14621         95 LKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLI  174 (248)
Q Consensus        95 ~l~v~p~~V~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl  174 (248)
                      ++|++|++|++||||||||+||||+||++. -..++++++++|.++|+++|++|+++|.|+|+|+||+|.|+++++++|+
T Consensus       161 ~lgv~~~~v~~~V~G~Hsg~t~vp~~S~~~-g~~~~~~~~~~i~~~v~~~g~eIi~~k~g~gst~~s~a~a~~~~~~ai~  239 (312)
T 3hhp_A          161 LKGKQPGEVEVPVIGGHSGVTILPLLSQVP-GVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV  239 (312)
T ss_dssp             HHTCCGGGCCCCEEECSSGGGEEECGGGCT-TCCCCHHHHHHHHHHHHTHHHHHHHHTTTSCCCCHHHHHHHHHHHHHHH
T ss_pred             HhCcChhHcceeEEeccCCCceeeecccCC-CCCCCHHHHHHHHHHHHhhhHHHHhhccCCCCchhHHHHHHHHHHHHHH
Confidence            789999999999999999999999999983 2347788899999999999999999765679999999999999999996


Q ss_pred             cccCCCCeEEEeeEecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhc
Q psy14621        175 QGLKGESNVIECAYVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAK  247 (248)
Q Consensus       175 ~~l~~~~~il~~s~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~~l~~~~~  247 (248)
                      .+|+|+++++||+|++++ | +++|||+||++|++|+++++++++||++|+++|++|+++|++.++++++|.++
T Consensus       240 ~~l~~~~~v~~~s~~~g~-g~~~v~~s~P~~~g~~Gv~~v~~~~~L~~~E~~~l~~s~~~l~~~i~~g~~~~~~  312 (312)
T 3hhp_A          240 RALQGEQGVVECAYVEGD-GQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK  312 (312)
T ss_dssp             HHHTTCSSCEEEEEEECC-CSSCSEEEEEEEEETTEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHcCCCCceEEEEEecCC-CCcceEEEeEEEEeCCEEEEEcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            666699999999999977 4 68999999999999999999984599999999999999999999999999763



>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1mlda2169 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S 1e-43
d2cmda2167 d.162.1.1 (A:146-312) Malate dehydrogenase {Escher 2e-42
d1guza2163 d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro 3e-27
d5mdha2179 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S 3e-24
d1uxja2164 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro 3e-23
d1llda2170 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid 1e-21
d1hyha2163 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy 2e-21
d1hyea2168 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd 1e-19
d1o6za2161 d.162.1.1 (A:163-330) Malate dehydrogenase {Archae 1e-19
d1ez4a2171 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto 3e-19
d1llca2172 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto 3e-19
d1ldma2169 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi 1e-18
d1t2da2165 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar 1e-18
d1ldna2168 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil 1e-18
d1b8pa2171 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp 2e-18
d1a5za2172 d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm 5e-18
d1i0za2172 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human 1e-17
d2ldxa2172 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse 2e-17
d1y6ja2169 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost 3e-17
d1y7ta2173 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu 5e-17
d7mdha2188 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu 7e-17
d1pzga2174 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop 4e-16
d1mlda1144 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s 2e-13
d1mlda1144 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s 1e-06
d1ojua2152 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archa 5e-12
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 7e-11
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 5e-06
d2cmda1145 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi 1e-10
d1o6za1142 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon 4e-08
d1o6za1142 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon 5e-07
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 5e-08
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 1e-04
d1llda1143 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac 7e-08
d1llda1143 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac 0.001
d1y6ja1142 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi 2e-07
d1y6ja1142 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi 3e-06
d1y7ta1154 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th 4e-06
d1ez4a1146 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac 5e-06
d1ez4a1146 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac 0.002
d1guza1142 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium 9e-06
d1guza1142 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium 8e-04
d1uxja1142 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex 1e-05
d2ldxa1159 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu 2e-05
d2ldxa1159 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu 0.002
d1hyea1145 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge 2e-05
d1hyea1145 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge 1e-04
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 3e-05
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 2e-04
d1i0za1160 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho 4e-05
d1i0za1160 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho 0.002
d1ojua1142 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon 5e-05
d1ojua1142 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon 0.003
d1t2da1150 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p 1e-04
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 1e-04
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 0.001
d1pzga1154 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas 5e-04
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LDH C-terminal domain-like
superfamily: LDH C-terminal domain-like
family: Lactate & malate dehydrogenases, C-terminal domain
domain: Malate dehydrogenase
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  143 bits (361), Expect = 1e-43
 Identities = 107/152 (70%), Positives = 126/152 (82%)

Query: 94  QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
           +LKGL+P  V+VPVIGGHAG TIIPLISQ TP V FP DQL  LTGRIQEAGTEVVKAKA
Sbjct: 15  ELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAKA 74

Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
           GAGSATLSMAYAGARF FSL+  + G+  V+EC++VKS  T+  YFSTP+ LGK GIEKN
Sbjct: 75  GAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEKN 134

Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245
           LG+GK+S FE++++  A+PELK +I KGEEFV
Sbjct: 135 LGIGKISPFEEKMIAEAIPELKASIKKGEEFV 166


>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 Back     information, alignment and structure
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Back     information, alignment and structure
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 152 Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1ojua2152 Lactate dehydrogenase {Archaeon Archaeoglobus fulg 100.0
d1uxja2164 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 100.0
d1guza2163 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 100.0
d1ez4a2171 Lactate dehydrogenase {Lactobacillus pentosus [Tax 100.0
d1llda2170 Lactate dehydrogenase {Bifidobacterium longum, str 100.0
d1y6ja2169 Lactate dehydrogenase {Clostridium thermocellum [T 100.0
d5mdha2179 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d1pzga2174 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.98
d1t2da2165 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.98
d1a5za2172 Lactate dehydrogenase {Thermotoga maritima [TaxId: 99.97
d1mlda2169 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.97
d7mdha2188 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 99.97
d1hyea2168 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.97
d2cmda2167 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.97
d1hyha2163 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.97
d1ldna2168 Lactate dehydrogenase {Bacillus stearothermophilus 99.97
d1i0za2172 Lactate dehydrogenase {Human (Homo sapiens), heart 99.97
d1llca2172 Lactate dehydrogenase {Lactobacillus casei [TaxId: 99.97
d1ldma2169 Lactate dehydrogenase {Dogfish (Squalus acanthias) 99.97
d1o6za2161 Malate dehydrogenase {Archaeon Haloarcula marismor 99.96
d2ldxa2172 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.96
d1y7ta2173 Malate dehydrogenase {Thermus thermophilus [TaxId: 99.96
d1b8pa2171 Malate dehydrogenase {Aquaspirillum arcticum [TaxI 99.95
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 99.44
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.43
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 99.43
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 99.42
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.41
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 99.4
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 99.39
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.39
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 99.37
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 99.32
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 99.32
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.31
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.28
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 99.22
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.16
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 99.15
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.14
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 99.08
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.95
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 98.87
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.44
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 98.24
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 98.16
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.16
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.03
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.99
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.97
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.92
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.89
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.86
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.71
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 96.66
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.62
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.61
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.56
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.55
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.5
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.44
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.43
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.43
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.39
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.39
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.38
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.38
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.33
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.29
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.27
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.13
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.12
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.11
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.04
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 96.02
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.0
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.96
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.95
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.89
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.84
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.81
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.8
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.76
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.72
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.71
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.71
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.65
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.65
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.6
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.59
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 95.58
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 95.49
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.47
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 95.47
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.44
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 95.43
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.43
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.4
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.3
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.3
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.22
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.2
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.15
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.15
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.14
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.05
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.0
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.83
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.79
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.77
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 94.75
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.72
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.7
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 94.65
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.64
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 94.54
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.54
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 94.52
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.5
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.48
d1up7a2253 6-phospho-beta-glucosidase {Thermotoga maritima [T 94.41
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.4
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.38
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.33
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.33
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 94.22
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.19
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.12
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.11
d1s6ya2270 6-phospho-beta-glucosidase {Bacillus stearothermop 94.04
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.0
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.98
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 93.94
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.88
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.85
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 93.79
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 93.79
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.75
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.65
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 93.57
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.57
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.56
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.56
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.5
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.32
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.28
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 93.28
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 93.15
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.12
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 93.06
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 93.06
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.03
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 93.02
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.99
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.78
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 92.69
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.65
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 92.57
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 92.52
d1u8xx2276 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 92.49
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 92.44
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 92.29
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 92.26
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.24
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.22
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 92.18
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.01
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.96
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.83
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 91.83
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 91.45
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 91.31
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.95
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 90.92
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.89
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.77
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 90.61
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.59
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.55
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.52
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.52
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 90.39
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.34
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 90.31
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 90.23
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 90.21
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.19
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.18
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 90.06
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 90.02
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 89.91
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 89.91
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.86
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 89.85
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 89.82
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.72
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 89.71
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 89.67
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.57
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 89.56
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 89.55
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 89.4
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.39
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 89.37
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 89.33
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.23
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 89.22
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.16
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 89.06
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.04
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 88.99
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 88.97
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.82
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.81
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 88.72
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 88.69
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 88.61
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 88.57
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 88.57
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 88.55
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 88.5
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 88.43
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 88.4
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 88.04
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 88.04
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 88.04
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 87.8
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.74
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.73
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.68
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 87.67
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 87.61
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 87.53
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 87.46
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 87.45
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.45
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.43
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.33
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 87.33
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.29
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 87.21
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.14
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 87.13
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 87.11
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.07
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 86.97
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.91
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 86.86
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 86.66
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.52
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.48
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 86.46
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.45
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.35
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.35
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 86.15
d1vjta2278 Putative alpha-glucosidase TM0752 {Thermotoga mari 85.73
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 85.65
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 85.62
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 85.48
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.2
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 85.09
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.06
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 84.94
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 84.9
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.87
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.61
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.59
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.55
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 84.55
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 84.54
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 84.2
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 84.11
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 84.02
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 83.72
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 83.57
d1obba2308 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 83.26
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 83.17
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 82.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 82.93
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 82.88
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 82.74
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.03
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 82.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 81.99
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 81.91
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.68
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 81.6
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 81.42
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 81.23
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 80.99
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 80.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.61
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 80.39
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 80.01
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LDH C-terminal domain-like
superfamily: LDH C-terminal domain-like
family: Lactate & malate dehydrogenases, C-terminal domain
domain: Lactate dehydrogenase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00  E-value=2.7e-36  Score=245.46  Aligned_cols=132  Identities=23%  Similarity=0.325  Sum_probs=119.4

Q ss_pred             CCCCCCe-eEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHhc
Q psy14621         97 GLNPTDV-NVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQ  175 (248)
Q Consensus        97 ~v~p~~V-~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl~  175 (248)
                      ++.+.++ ++|||||| ||||||+||.++.-.   +.++++|.+++|++|++|++   +||+|+||||+++++|+++|+.
T Consensus        15 ~~~~~~v~~a~ViGeH-Gds~vp~~S~~~i~g---~~~~~~i~~~v~~~g~eIi~---~kG~t~~gia~a~~~iv~aIl~   87 (152)
T d1ojua2          15 NAGARNIRRAWIIGEH-GDSMFVAKSLADFDG---EVDWEAVENDVRFVAAEVIK---RKGATIFGPAVAIYRMVKAVVE   87 (152)
T ss_dssp             HTTCBSCCCCCEEBCS-STTCEECGGGCCCBS---CCCHHHHHHHHHTTHHHHHH---HHSSCCHHHHHHHHHHHHHHHT
T ss_pred             ccCCCCcceeEEEecC-CCccccccccccccC---ccchhHhHHHHHHHHHHhhh---hccceeccHHHHHHHHHHHHHh
Confidence            4567777 99999999 999999999987321   22467899999999999999   4899999999999999999999


Q ss_pred             ccCCCCeEEEee-EecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHH
Q psy14621        176 GLKGESNVIECA-YVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAK  240 (248)
Q Consensus       176 ~l~~~~~il~~s-~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~  240 (248)
                         |+++++|+| |++++|| +++|+|+||++|++|++ ++++ +||++|+++|++|++.||+.++.
T Consensus        88 ---d~~~v~pvs~~l~geyG~~dv~lsvP~vig~~Gve-i~~l-~L~~~E~~~l~~Sa~~ik~~i~~  149 (152)
T d1ojua2          88 ---DTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAE-VADI-KLSDEEIEKLRNSAKILRERLEE  149 (152)
T ss_dssp             ---TCCCEEEEEEEEESGGGCEEEEEEEEEEEETTEEE-ECCC-CCCHHHHHHHHHHHHHHHHHHHT
T ss_pred             ---cCCCceeeeEEeccccCCCCEEEEeEEEECCCceE-EEcC-CCCHHHHHHHHHHHHHHHHHHHH
Confidence               999999998 9999999 89999999999999995 8899 69999999999999999998875



>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure