Psyllid ID: psy14621
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| 345308595 | 255 | PREDICTED: malate dehydrogenase, mitocho | 0.862 | 0.839 | 0.613 | 3e-78 | |
| 344245731 | 271 | Malate dehydrogenase, mitochondrial [Cri | 0.862 | 0.789 | 0.573 | 2e-77 | |
| 91085015 | 336 | PREDICTED: similar to malate dehydrogena | 0.653 | 0.482 | 0.783 | 3e-67 | |
| 156553655 | 341 | PREDICTED: malate dehydrogenase, mitocho | 0.745 | 0.542 | 0.687 | 3e-66 | |
| 332865953 | 296 | PREDICTED: malate dehydrogenase, mitocho | 0.935 | 0.783 | 0.498 | 7e-66 | |
| 194373719 | 296 | unnamed protein product [Homo sapiens] | 0.935 | 0.783 | 0.494 | 1e-65 | |
| 426356630 | 296 | PREDICTED: malate dehydrogenase, mitocho | 0.862 | 0.722 | 0.522 | 1e-65 | |
| 395842984 | 310 | PREDICTED: malate dehydrogenase, mitocho | 0.971 | 0.777 | 0.508 | 1e-65 | |
| 321457956 | 340 | mitochondrial malate dehydrogenase [Daph | 0.657 | 0.479 | 0.760 | 7e-65 | |
| 332375761 | 335 | unknown [Dendroctonus ponderosae] | 0.612 | 0.453 | 0.815 | 1e-64 |
| >gi|345308595|ref|XP_003428716.1| PREDICTED: malate dehydrogenase, mitochondrial-like, partial [Ornithorhynchus anatinus] | Back alignment and taxonomy information |
|---|
Score = 297 bits (760), Expect = 3e-78, Method: Compositional matrix adjust.
Identities = 154/251 (61%), Positives = 180/251 (71%), Gaps = 37/251 (14%)
Query: 32 NNAKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAH------ 85
N+AKV V GA+GGIGQPLSLLLK SPLV L+LYDI HTPGVAADLSHIE++A+
Sbjct: 1 NHAKVAVLGAAGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETRANAKGKWP 60
Query: 86 -------------------------------VQAFNGADQLKGLNPTDVNVPVIGGHAGI 114
V+A +LKGL+P VNVPVIGGHAG
Sbjct: 61 VNSTIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK 120
Query: 115 TIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLI 174
TIIPLISQ TP V FP DQL ALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARF FS++
Sbjct: 121 TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSVV 180
Query: 175 QGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPEL 234
+ G+ V+EC++V+S+ TE SYFSTP+ LGK GIEKNLG+GKLS FE+++V A+PEL
Sbjct: 181 DAMNGKEGVVECSFVRSEETECSYFSTPLLLGKKGIEKNLGMGKLSPFEEKMVAEAIPEL 240
Query: 235 KKNIAKGEEFV 245
K +I KGE+FV
Sbjct: 241 KASIRKGEDFV 251
|
Source: Ornithorhynchus anatinus Species: Ornithorhynchus anatinus Genus: Ornithorhynchus Family: Ornithorhynchidae Order: Monotremata Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|344245731|gb|EGW01835.1| Malate dehydrogenase, mitochondrial [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|91085015|ref|XP_973533.1| PREDICTED: similar to malate dehydrogenase [Tribolium castaneum] gi|270008524|gb|EFA04972.1| hypothetical protein TcasGA2_TC015050 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|156553655|ref|XP_001600547.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332865953|ref|XP_003318574.1| PREDICTED: malate dehydrogenase, mitochondrial [Pan troglodytes] gi|397475059|ref|XP_003808969.1| PREDICTED: malate dehydrogenase, mitochondrial isoform 2 [Pan paniscus] | Back alignment and taxonomy information |
|---|
| >gi|194373719|dbj|BAG56955.1| unnamed protein product [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|426356630|ref|XP_004045662.1| PREDICTED: malate dehydrogenase, mitochondrial isoform 3 [Gorilla gorilla gorilla] | Back alignment and taxonomy information |
|---|
| >gi|395842984|ref|XP_003794286.1| PREDICTED: malate dehydrogenase, mitochondrial [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|321457956|gb|EFX69032.1| mitochondrial malate dehydrogenase [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|332375761|gb|AEE63021.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| ZFIN|ZDB-GENE-040426-2143 | 337 | mdh2 "malate dehydrogenase 2, | 0.649 | 0.477 | 0.714 | 8.5e-75 | |
| UNIPROTKB|P40926 | 338 | MDH2 "Malate dehydrogenase, mi | 0.645 | 0.473 | 0.693 | 2.3e-72 | |
| UNIPROTKB|Q5NVR2 | 338 | MDH2 "Malate dehydrogenase, mi | 0.645 | 0.473 | 0.693 | 2.3e-72 | |
| UNIPROTKB|Q4R568 | 338 | MDH2 "Malate dehydrogenase, mi | 0.645 | 0.473 | 0.681 | 2e-71 | |
| UNIPROTKB|E9PDB2 | 296 | MDH2 "Malate dehydrogenase, mi | 0.600 | 0.503 | 0.718 | 4.2e-71 | |
| RGD|619719 | 338 | Mdh2 "malate dehydrogenase 2, | 0.645 | 0.473 | 0.675 | 5.3e-71 | |
| UNIPROTKB|I3LP41 | 338 | MDH2 "Malate dehydrogenase" [S | 0.612 | 0.449 | 0.703 | 6.8e-71 | |
| UNIPROTKB|P00346 | 338 | MDH2 "Malate dehydrogenase, mi | 0.612 | 0.449 | 0.703 | 6.8e-71 | |
| MGI|MGI:97050 | 338 | Mdh2 "malate dehydrogenase 2, | 0.645 | 0.473 | 0.668 | 6.8e-71 | |
| UNIPROTKB|E1BVT3 | 337 | MDH2 "Malate dehydrogenase" [G | 0.653 | 0.480 | 0.674 | 8.6e-71 |
| ZFIN|ZDB-GENE-040426-2143 mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 576 (207.8 bits), Expect = 8.5e-75, Sum P(2) = 8.5e-75
Identities = 115/161 (71%), Positives = 133/161 (82%)
Query: 86 VQAFNGADQLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAG 145
V+A +LKGL+P VNVPV+GGHAGITIIPLISQ TP V FP DQL ALTGRIQEAG
Sbjct: 174 VRANTFVAELKGLDPARVNVPVVGGHAGITIIPLISQCTPKVEFPADQLSALTGRIQEAG 233
Query: 146 TEVVKAKAGAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHL 205
TEVVKAKAGAGSATLSMAYAGARF FSL+ + G+ V+EC++V+S+ TE YFSTP+ L
Sbjct: 234 TEVVKAKAGAGSATLSMAYAGARFTFSLLDAMNGKEGVVECSFVRSEETECKYFSTPLLL 293
Query: 206 GKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVA 246
GKNGIEKNLGLGKLS FE++LV A+ ELK +I KGE+FVA
Sbjct: 294 GKNGIEKNLGLGKLSAFEEKLVADAMTELKGSIKKGEDFVA 334
|
|
| UNIPROTKB|P40926 MDH2 "Malate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5NVR2 MDH2 "Malate dehydrogenase, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R568 MDH2 "Malate dehydrogenase, mitochondrial" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PDB2 MDH2 "Malate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|619719 Mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LP41 MDH2 "Malate dehydrogenase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00346 MDH2 "Malate dehydrogenase, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97050 Mdh2 "malate dehydrogenase 2, NAD (mitochondrial)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVT3 MDH2 "Malate dehydrogenase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| cd01337 | 310 | cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma | 1e-93 | |
| PLN00106 | 323 | PLN00106, PLN00106, malate dehydrogenase | 3e-76 | |
| TIGR01772 | 312 | TIGR01772, MDH_euk_gproteo, malate dehydrogenase, | 1e-75 | |
| PRK05086 | 312 | PRK05086, PRK05086, malate dehydrogenase; Provisio | 6e-69 | |
| PTZ00325 | 321 | PTZ00325, PTZ00325, malate dehydrogenase; Provisio | 2e-62 | |
| pfam02866 | 173 | pfam02866, Ldh_1_C, lactate/malate dehydrogenase, | 4e-51 | |
| cd01337 | 310 | cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma | 3e-31 | |
| COG0039 | 313 | COG0039, Mdh, Malate/lactate dehydrogenases [Energ | 3e-26 | |
| PLN00106 | 323 | PLN00106, PLN00106, malate dehydrogenase | 4e-25 | |
| TIGR01772 | 312 | TIGR01772, MDH_euk_gproteo, malate dehydrogenase, | 4e-22 | |
| PTZ00325 | 321 | PTZ00325, PTZ00325, malate dehydrogenase; Provisio | 3e-20 | |
| PRK05086 | 312 | PRK05086, PRK05086, malate dehydrogenase; Provisio | 2e-15 | |
| pfam00056 | 142 | pfam00056, Ldh_1_N, lactate/malate dehydrogenase, | 1e-13 | |
| cd01339 | 300 | cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik | 3e-12 | |
| PRK06223 | 307 | PRK06223, PRK06223, malate dehydrogenase; Reviewed | 1e-11 | |
| PTZ00082 | 321 | PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi | 6e-10 | |
| cd00300 | 300 | cd00300, LDH_like, L-lactate dehydrogenase-like en | 1e-07 | |
| COG0039 | 313 | COG0039, Mdh, Malate/lactate dehydrogenases [Energ | 4e-07 | |
| TIGR01771 | 299 | TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | 1e-06 | |
| PTZ00117 | 319 | PTZ00117, PTZ00117, malate dehydrogenase; Provisio | 1e-06 | |
| TIGR01763 | 305 | TIGR01763, MalateDH_bact, malate dehydrogenase, NA | 3e-06 | |
| cd05291 | 306 | cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd | 3e-05 | |
| cd00650 | 263 | cd00650, LDH_MDH_like, NAD-dependent, lactate dehy | 1e-04 |
| >gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
Score = 277 bits (710), Expect = 1e-93
Identities = 108/152 (71%), Positives = 132/152 (86%)
Query: 94 QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
+L GL+P VNVPVIGGH+G+TI+PL+SQ P +F ++++ALT RIQ G EVVKAKA
Sbjct: 159 ELLGLDPAKVNVPVIGGHSGVTILPLLSQCQPPFTFDQEEIEALTHRIQFGGDEVVKAKA 218
Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
GAGSATLSMAYAGARFA SL++GLKGE VIECAYV+SDVTEA +F+TPV LGKNG+EKN
Sbjct: 219 GAGSATLSMAYAGARFANSLLRGLKGEKGVIECAYVESDVTEAPFFATPVELGKNGVEKN 278
Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245
LGLGKL+D+EK+L++AA+PELKKNI KG +FV
Sbjct: 279 LGLGKLNDYEKKLLEAALPELKKNIEKGVDFV 310
|
MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 310 |
| >gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 100.0 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 100.0 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 100.0 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 100.0 | |
| PLN00106 | 323 | malate dehydrogenase | 100.0 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| PLN02602 | 350 | lactate dehydrogenase | 100.0 | |
| KOG1495|consensus | 332 | 100.0 | ||
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 100.0 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 100.0 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 100.0 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 100.0 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 100.0 | |
| PLN00112 | 444 | malate dehydrogenase (NADP); Provisional | 100.0 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 100.0 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 100.0 | |
| KOG1494|consensus | 345 | 100.0 | ||
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 100.0 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 100.0 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 100.0 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 100.0 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 100.0 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 100.0 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 100.0 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 100.0 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 100.0 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 100.0 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 100.0 | |
| cd05295 | 452 | MDH_like Malate dehydrogenase-like. These MDH-like | 100.0 | |
| PLN00135 | 309 | malate dehydrogenase | 100.0 | |
| PF02866 | 174 | Ldh_1_C: lactate/malate dehydrogenase, alpha/beta | 100.0 | |
| TIGR01756 | 313 | LDH_protist lactate dehydrogenase. This model repr | 100.0 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 99.97 | |
| KOG1496|consensus | 332 | 99.95 | ||
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 99.36 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 98.87 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 98.57 | |
| cd05297 | 423 | GH4_alpha_glucosidase_galactosidase Glycoside Hydr | 98.51 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 98.48 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 97.96 | |
| KOG1494|consensus | 345 | 97.22 | ||
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 96.2 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 96.14 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 95.91 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 95.78 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.63 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.53 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.47 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.34 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 95.31 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.29 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 95.24 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 95.16 | |
| KOG1429|consensus | 350 | 95.1 | ||
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.03 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 95.0 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 95.0 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 94.98 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 94.96 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 94.92 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 94.9 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 94.83 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 94.83 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 94.8 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 94.79 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 94.75 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 94.71 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 94.71 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 94.67 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 94.64 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 94.63 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.62 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 94.61 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 94.6 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.56 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 94.55 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 94.48 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 94.48 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.43 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 94.39 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 94.33 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 94.31 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 94.3 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 94.23 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 94.23 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 94.12 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 94.11 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 94.08 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.04 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.02 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 93.99 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 93.99 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 93.98 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 93.98 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 93.95 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 93.88 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 93.83 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 93.82 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 93.78 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 93.75 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 93.75 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 93.74 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 93.72 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 93.72 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 93.7 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 93.69 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 93.68 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 93.66 | |
| PRK05868 | 372 | hypothetical protein; Validated | 93.65 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 93.64 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 93.64 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 93.58 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 93.57 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 93.55 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 93.55 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 93.53 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 93.51 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 93.5 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 93.49 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 93.44 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.41 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 93.37 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 93.36 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 93.36 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 93.35 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 93.33 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 93.33 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 93.28 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 93.27 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 93.27 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 93.23 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 93.17 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 93.17 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 93.16 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 93.16 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.14 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 93.1 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 93.05 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 93.03 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 93.0 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 92.96 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 92.94 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 92.94 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 92.93 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 92.92 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 92.92 | |
| PRK08223 | 287 | hypothetical protein; Validated | 92.89 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.87 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 92.84 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 92.8 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 92.78 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 92.7 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 92.69 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 92.68 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 92.68 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 92.66 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 92.58 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 92.54 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 92.53 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 92.52 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 92.48 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 92.48 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 92.44 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.4 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 92.39 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 92.35 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 92.34 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 92.34 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 92.33 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 92.3 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 92.27 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 92.26 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 92.26 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 92.16 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 92.15 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 92.1 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 92.09 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 92.08 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 92.08 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 92.07 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 92.04 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 92.03 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 92.03 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 92.03 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 92.02 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 92.01 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 91.99 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 91.98 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 91.97 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 91.97 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 91.95 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 91.93 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 91.92 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 91.89 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 91.87 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 91.85 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 91.84 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 91.84 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 91.8 | |
| KOG1430|consensus | 361 | 91.79 | ||
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 91.77 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 91.77 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 91.76 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 91.75 | |
| PRK05717 | 255 | oxidoreductase; Validated | 91.7 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 91.64 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 91.6 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 91.6 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 91.53 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 91.52 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 91.5 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 91.49 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 91.46 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 91.45 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 91.45 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 91.42 | |
| KOG1371|consensus | 343 | 91.4 | ||
| PRK07411 | 390 | hypothetical protein; Validated | 91.39 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 91.35 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 91.34 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 91.33 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 91.3 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 91.29 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 91.24 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 91.23 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 91.23 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 91.23 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 91.19 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 91.16 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 91.15 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 91.15 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 91.13 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 91.13 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 91.11 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 91.1 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 91.09 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 91.08 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 91.07 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 91.06 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 91.05 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 91.04 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 91.03 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 91.02 | |
| PLN02256 | 304 | arogenate dehydrogenase | 91.02 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 91.0 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 91.0 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 90.98 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 90.97 | |
| KOG2304|consensus | 298 | 90.93 | ||
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 90.92 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 90.91 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 90.89 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 90.89 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 90.89 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 90.88 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 90.88 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 90.87 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 90.87 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 90.86 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 90.84 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 90.84 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 90.82 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 90.79 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 90.77 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 90.76 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 90.74 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 90.74 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 90.74 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 90.69 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 90.68 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 90.67 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 90.65 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 90.65 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 90.64 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 90.63 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 90.62 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 90.59 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 90.57 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 90.57 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 90.56 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 90.55 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 90.54 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 90.51 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 90.5 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 90.49 | |
| PF02629 | 96 | CoA_binding: CoA binding domain; InterPro: IPR0037 | 90.44 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 90.42 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 90.39 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 90.39 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 90.38 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 90.35 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 90.35 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 90.33 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 90.32 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 90.32 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 90.31 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 90.3 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 90.27 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 90.27 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 90.25 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 90.25 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 90.24 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 90.24 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 90.24 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 90.24 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 90.23 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 90.22 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.19 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 90.11 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 90.09 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 90.05 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 90.03 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 90.01 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 90.01 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 90.01 | |
| COG1486 | 442 | CelF Alpha-galactosidases/6-phospho-beta-glucosida | 89.99 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 89.96 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 89.95 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 89.94 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 89.93 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 89.91 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 89.88 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 89.84 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 89.79 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 89.79 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 89.79 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 89.74 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.72 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 89.69 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 89.67 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 89.66 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 89.66 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 89.65 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 89.65 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 89.59 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 89.54 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 89.54 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 89.53 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 89.52 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 89.5 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 89.5 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 89.47 | |
| PRK08643 | 256 | acetoin reductase; Validated | 89.44 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 89.44 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 89.44 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 89.42 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 89.41 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 89.38 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 89.38 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.31 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 89.24 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 89.21 | |
| PLN02985 | 514 | squalene monooxygenase | 89.21 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 89.2 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 89.19 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 89.17 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 89.13 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 89.12 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 89.07 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 89.07 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 89.03 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 89.0 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 88.98 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 88.95 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 88.94 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 88.92 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 88.92 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 88.92 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.88 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 88.83 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 88.81 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 88.81 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 88.81 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 88.8 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 88.8 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 88.77 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 88.77 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 88.77 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 88.74 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 88.74 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 88.73 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 88.71 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 88.71 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.69 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 88.69 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 88.69 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 88.69 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 88.69 | |
| KOG1502|consensus | 327 | 88.67 | ||
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 88.67 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 88.67 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 88.66 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 88.64 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 88.61 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 88.6 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 88.59 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 88.54 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 88.53 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 88.52 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 88.51 | |
| PLN02712 | 667 | arogenate dehydrogenase | 88.49 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 88.42 | |
| PLN02463 | 447 | lycopene beta cyclase | 88.41 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 88.39 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 88.39 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 88.37 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 88.34 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 88.27 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 88.25 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 88.25 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 88.23 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 88.2 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 88.19 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 88.18 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 88.18 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 88.17 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 88.16 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 88.16 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 88.14 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 88.13 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 88.12 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 88.08 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 88.07 | |
| PLN02712 | 667 | arogenate dehydrogenase | 88.02 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 88.01 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 87.95 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 87.94 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 87.92 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 87.89 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 87.88 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 87.85 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 87.84 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 87.77 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 87.76 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 87.73 | |
| KOG2336|consensus | 422 | 87.69 | ||
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 87.61 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 87.58 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 87.58 | |
| KOG2018|consensus | 430 | 87.57 | ||
| PRK07233 | 434 | hypothetical protein; Provisional | 87.52 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 87.51 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 87.48 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 87.46 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 87.44 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 87.4 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 87.39 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 87.36 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 87.35 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 87.34 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 87.31 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 87.26 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 87.16 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 87.15 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 87.12 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 87.12 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 87.08 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 87.08 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 87.05 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 87.02 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 87.0 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 87.0 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 86.99 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 86.95 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 86.95 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 86.94 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 86.94 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 86.82 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 86.76 | |
| PRK02318 | 381 | mannitol-1-phosphate 5-dehydrogenase; Provisional | 86.76 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 86.7 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 86.68 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 86.62 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 86.54 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 86.44 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 86.42 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 86.31 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 86.29 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 86.26 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 86.23 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 86.18 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 86.12 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 86.11 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 86.09 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.99 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 85.91 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 85.91 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 85.9 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 85.88 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.84 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 85.82 | |
| PLN02268 | 435 | probable polyamine oxidase | 85.79 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 85.79 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 85.78 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 85.77 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 85.74 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 85.72 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 85.72 |
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-50 Score=368.78 Aligned_cols=211 Identities=70% Similarity=1.090 Sum_probs=190.2
Q ss_pred cEEEEEcCCCccHHHHHHHHHhCCCcceEEEEecCCchhhHhhhcCccCCCeEEEE-cC---------ch----------
Q psy14621 34 AKVMVAGASGGIGQPLSLLLKQSPLVDHLSLYDIVHTPGVAADLSHIESKAHVQAF-NG---------AD---------- 93 (248)
Q Consensus 34 ~KV~IiGaaG~VG~~~a~~l~~~~l~~elvLiDi~~a~g~a~DL~~~~~~~~v~~~-~~---------~d---------- 93 (248)
|||+||||+|+||+++||+|+.+++++||+|+|++.++|++|||+|+.++++++.+ .+ +|
T Consensus 1 ~KI~IIGaaG~VG~~~a~~l~~~~~~~elvLiDi~~a~g~alDL~~~~~~~~i~~~~~~~~~y~~~~daDivvitaG~~~ 80 (310)
T cd01337 1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGADVVVIPAGVPR 80 (310)
T ss_pred CEEEEECCCCHHHHHHHHHHHhCCCCcEEEEEecCccceeehHhHhCCCcceEEEecCCCchHHhcCCCCEEEEeCCCCC
Confidence 69999999899999999999999999999999999889999999999866666653 21 11
Q ss_pred ------------------------------------------------------------------------------hh
Q psy14621 94 ------------------------------------------------------------------------------QL 95 (248)
Q Consensus 94 ------------------------------------------------------------------------------~~ 95 (248)
++
T Consensus 81 k~g~tR~dll~~N~~i~~~i~~~i~~~~p~a~vivvtNPvDv~~~i~t~~~~~~s~~p~~rviG~~~LDs~R~~~~la~~ 160 (310)
T cd01337 81 KPGMTRDDLFNINAGIVRDLATAVAKACPKALILIISNPVNSTVPIAAEVLKKAGVYDPKRLFGVTTLDVVRANTFVAEL 160 (310)
T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHhCCCeEEEEccCchhhHHHHHHHHHHHhcCCCHHHEEeeechHHHHHHHHHHHH
Confidence 88
Q ss_pred cCCCCCCeeEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHhc
Q psy14621 96 KGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQ 175 (248)
Q Consensus 96 l~v~p~~V~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl~ 175 (248)
++++|++|++|||||||||||||+||+++|..+++++++++|.++|+++||+|+++|.|||+|+||+|.++++|+++|++
T Consensus 161 l~v~~~~V~~~v~GeHsGds~vp~~S~~~~~~~~~~~~~~~i~~~v~~~g~~Ii~~k~gkg~t~~~~a~a~~~iv~aIl~ 240 (310)
T cd01337 161 LGLDPAKVNVPVIGGHSGVTILPLLSQCQPPFTFDQEEIEALTHRIQFGGDEVVKAKAGAGSATLSMAYAGARFANSLLR 240 (310)
T ss_pred hCcCHHHEEEEEEecCCCCceecccccccccccCCHHHHHHHHHHHHHHHHHHHhCccCCCCcchhHHHHHHHHHHHHHH
Confidence 89999999999999998899999999999876777767999999999999999997546899999999999999999997
Q ss_pred ccCCCCeEEEeeEecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy14621 176 GLKGESNVIECAYVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245 (248)
Q Consensus 176 ~l~~~~~il~~s~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~~l~~~ 245 (248)
++++++.++|+++++++ | +++|||+||++|++||++++++++|+++|+++|++|++.|++.++.+++|+
T Consensus 241 ~~~~~~~~~~~s~~~~~-g~~~v~~s~P~~ig~~Gv~~i~~l~~L~~~E~~~l~~S~~~i~~~~~~g~~~~ 310 (310)
T cd01337 241 GLKGEKGVIECAYVESD-VTEAPFFATPVELGKNGVEKNLGLGKLNDYEKKLLEAALPELKKNIEKGVDFV 310 (310)
T ss_pred hcCCCcceEEEEEEecc-CCCceEEEEEEEEeCCeEEEEeCCCCCCHHHHHHHHHHHHHHHHHHhhhcccC
Confidence 54467788888888877 7 899999999999999999999923999999999999999999999999884
|
MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. |
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1495|consensus | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00112 malate dehydrogenase (NADP); Provisional | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1494|consensus | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05295 MDH_like Malate dehydrogenase-like | Back alignment and domain information |
|---|
| >PLN00135 malate dehydrogenase | Back alignment and domain information |
|---|
| >PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >TIGR01756 LDH_protist lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >KOG1496|consensus | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >KOG1494|consensus | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1429|consensus | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >KOG1430|consensus | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1371|consensus | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12320 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >KOG2304|consensus | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1502|consensus | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2336|consensus | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2018|consensus | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 248 | ||||
| 2dfd_A | 342 | Crystal Structure Of Human Malate Dehydrogenase Typ | 5e-61 | ||
| 1mld_A | 314 | Refined Structure Of Mitochondrial Malate Dehydroge | 2e-59 | ||
| 2pwz_A | 312 | Crystal Structure Of The Apo Form Of E.Coli Malate | 2e-43 | ||
| 1ib6_A | 312 | Crystal Structure Of R153c E. Coli Malate Dehydroge | 5e-43 | ||
| 1emd_A | 312 | Crystal Structure Of A Ternary Complex Of Escherich | 5e-43 | ||
| 1smk_A | 326 | Mature And Translocatable Forms Of Glyoxysomal Mala | 2e-42 | ||
| 1sev_A | 362 | Mature And Translocatable Forms Of Glyoxysomal Mala | 2e-42 | ||
| 4e0b_A | 313 | 2.17 Angstrom Resolution Crystal Structure Of Malat | 1e-36 | ||
| 2hjr_A | 328 | Crystal Structure Of Cryptosporidium Parvum Malate | 2e-04 | ||
| 3tl2_A | 315 | Crystal Structure Of Bacillus Anthracis Str. Ames M | 2e-04 |
| >pdb|2DFD|A Chain A, Crystal Structure Of Human Malate Dehydrogenase Type 2 Length = 342 | Back alignment and structure |
|
| >pdb|1MLD|A Chain A, Refined Structure Of Mitochondrial Malate Dehydrogenase From Porcine Heart And The Consensus Structure For Dicarboxylic Acid Oxidoreductases Length = 314 | Back alignment and structure |
| >pdb|2PWZ|A Chain A, Crystal Structure Of The Apo Form Of E.Coli Malate Dehydrogenase Length = 312 | Back alignment and structure |
| >pdb|1IB6|A Chain A, Crystal Structure Of R153c E. Coli Malate Dehydrogenase Length = 312 | Back alignment and structure |
| >pdb|1EMD|A Chain A, Crystal Structure Of A Ternary Complex Of Escherichia Coli Malate Dehydrogenase, Citrate And Nad At 1.9 Angstroms Resolution Length = 312 | Back alignment and structure |
| >pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 326 | Back alignment and structure |
| >pdb|1SEV|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 362 | Back alignment and structure |
| >pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 | Back alignment and structure |
| >pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 | Back alignment and structure |
| >pdb|3TL2|A Chain A, Crystal Structure Of Bacillus Anthracis Str. Ames Malate Dehydrogenase In Closed Conformation Length = 315 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 4e-79 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 1e-25 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 1e-77 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 9e-26 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 1e-74 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 2e-21 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 3e-13 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 3e-13 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 1e-12 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 2e-12 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 5e-12 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 6e-12 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 6e-12 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 1e-11 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 2e-11 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 3e-11 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 3e-11 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 3e-11 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 4e-11 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 4e-11 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 9e-11 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 2e-10 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 2e-10 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 3e-10 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 3e-10 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 3e-10 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 3e-10 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 5e-10 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 5e-10 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 8e-10 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 1e-09 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 1e-09 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 4e-09 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 6e-09 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 3e-08 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 5e-08 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 7e-08 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 6e-07 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-04 |
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 | Back alignment and structure |
|---|
Score = 240 bits (614), Expect = 4e-79
Identities = 81/154 (52%), Positives = 114/154 (74%)
Query: 94 QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
++ GL+P DV+VPV+GGHAG+TI+PL+SQ P SF +++ LT RIQ GTEVV+AKA
Sbjct: 167 EVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKA 226
Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
GAGSATLSMAYA +FA + ++GL+G++ VIECA+V S VTE +F++ V LG+NGIE+
Sbjct: 227 GAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEV 286
Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAK 247
LG L+++E+ ++ A EL +I KG F+
Sbjct: 287 YSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS 320
|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 100.0 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 100.0 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 100.0 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 100.0 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 100.0 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 100.0 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 100.0 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 100.0 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 100.0 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 100.0 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 100.0 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 100.0 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 100.0 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 100.0 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 100.0 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 100.0 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 100.0 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 100.0 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 100.0 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 100.0 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 100.0 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 100.0 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 100.0 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 100.0 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 100.0 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 100.0 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 100.0 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 100.0 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 100.0 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 100.0 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 100.0 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 100.0 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 100.0 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 100.0 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 100.0 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 100.0 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 100.0 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 100.0 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 99.96 | |
| 1up7_A | 417 | 6-phospho-beta-glucosidase; hydrolase, family4 hyd | 99.93 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 99.91 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 99.88 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 99.36 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 98.91 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 98.81 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.19 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 96.09 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 96.02 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 96.01 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 95.89 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 95.83 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.74 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.72 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 95.71 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 95.69 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 95.67 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 95.67 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 95.6 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 95.56 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 95.54 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 95.54 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 95.52 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 95.51 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 95.47 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 95.46 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 95.43 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 95.42 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 95.36 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 95.34 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.31 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 95.28 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 95.27 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 95.23 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 95.22 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.21 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.21 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 95.14 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 95.05 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 95.04 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 95.04 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 95.03 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 95.02 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 95.02 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 95.01 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 94.96 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 94.94 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 94.89 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 94.89 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 94.88 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 94.88 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 94.86 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 94.83 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 94.82 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.81 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 94.79 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 94.77 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 94.77 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 94.77 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 94.77 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 94.76 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 94.76 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 94.76 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 94.75 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 94.73 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 94.72 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 94.71 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 94.7 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 94.7 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 94.68 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 94.68 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 94.67 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 94.63 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 94.62 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 94.62 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 94.62 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 94.61 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 94.59 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 94.58 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 94.57 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 94.54 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 94.53 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 94.53 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.52 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 94.5 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 94.48 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 94.47 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 94.46 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 94.45 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 94.44 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 94.39 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 94.39 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 94.38 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 94.38 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 94.38 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 94.37 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 94.35 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 94.35 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 94.35 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 94.34 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 94.31 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 94.3 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 94.28 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 94.28 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 94.27 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 94.26 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 94.26 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 94.26 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 94.24 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 94.24 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 94.22 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 94.22 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 94.21 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 94.2 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 94.19 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 94.19 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 94.16 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.14 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 94.1 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 94.08 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 94.08 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 94.07 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 94.05 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 94.04 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 94.04 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 94.02 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 94.0 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 93.99 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 93.97 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 93.96 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 93.92 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 93.91 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 93.9 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 93.88 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 93.85 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 93.82 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 93.81 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 93.79 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 93.79 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 93.78 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 93.74 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 93.72 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 93.71 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 93.7 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 93.69 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 93.67 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 93.64 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 93.63 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 93.58 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 93.57 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 93.57 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 93.55 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 93.53 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 93.53 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 93.52 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 93.5 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 93.48 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 93.46 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 93.46 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 93.45 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 93.44 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 93.43 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 93.42 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 93.42 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 93.41 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 93.4 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 93.39 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 93.38 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 93.36 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 93.36 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 93.35 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 93.34 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 93.33 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 93.31 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 93.31 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 93.3 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 93.29 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 93.26 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 93.25 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 93.25 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 93.24 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 93.24 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 93.19 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 93.14 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 93.14 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 93.08 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 93.08 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 93.06 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 93.05 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 93.05 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 93.03 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 93.03 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 93.02 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 92.99 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 92.98 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 92.97 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 92.94 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 92.94 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 92.93 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 92.91 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 92.91 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 92.9 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 92.88 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 92.86 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 92.84 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 92.82 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 92.82 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 92.81 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 92.8 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 92.79 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 92.79 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 92.78 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 92.76 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 92.74 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 92.74 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 92.73 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 92.72 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 92.72 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 92.7 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 92.67 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 92.65 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 92.6 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 92.58 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 92.57 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 92.56 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 92.56 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 92.55 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 92.55 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 92.55 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 92.54 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 92.52 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 92.51 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 92.51 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 92.51 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 92.5 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 92.49 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 92.48 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 92.48 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 92.48 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 92.47 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 92.44 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 92.42 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 92.42 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 92.38 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 92.37 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 92.36 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 92.34 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 92.33 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 92.33 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 92.33 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 92.31 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 92.27 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 92.27 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 92.25 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 92.25 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 92.25 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 92.22 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 92.21 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 92.19 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 92.18 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 92.16 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 92.15 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 92.15 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 92.14 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 92.13 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 92.11 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 92.1 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 92.1 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 92.07 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 92.06 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 92.04 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 91.98 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 91.96 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 91.96 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 91.95 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 91.95 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 91.94 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 91.94 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 91.91 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 91.9 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 91.87 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 91.85 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 91.85 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 91.85 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 91.84 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 91.83 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 91.82 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 91.81 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 91.8 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 91.79 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 91.75 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 91.75 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 91.74 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 91.73 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 91.73 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 91.72 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 91.71 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 91.68 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 91.67 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 91.66 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 91.65 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 91.62 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 91.62 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 91.6 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 91.59 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 91.58 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 91.58 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 91.57 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 91.57 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 91.56 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 91.55 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 91.55 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 91.54 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 91.51 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 91.51 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 91.5 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 91.49 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 91.44 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 91.43 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 91.42 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 91.41 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 91.37 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 91.36 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 91.34 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 91.33 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 91.33 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 91.32 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 91.28 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 91.27 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 91.26 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 91.25 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 91.25 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 91.22 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 91.22 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 91.22 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 91.2 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 91.19 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 91.17 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 91.16 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 90.51 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 91.15 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 91.14 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 91.14 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 91.12 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 91.11 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 91.11 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 91.11 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 91.06 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 91.04 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 91.03 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 91.02 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 91.0 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 90.98 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 90.94 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 90.92 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 90.91 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 90.9 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 90.89 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 90.88 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 90.84 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 90.82 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 90.8 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 90.8 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 90.79 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 90.79 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 90.79 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 90.78 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 90.78 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 90.77 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 90.74 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 90.72 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 90.65 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 90.65 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 90.64 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 90.64 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 90.62 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 90.62 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 90.61 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 90.59 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 90.58 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 90.57 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 90.56 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 90.55 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 90.55 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 90.5 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 90.49 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 90.48 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 90.46 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 90.46 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 90.46 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 90.45 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 90.42 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 90.39 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 90.39 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 90.39 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 90.38 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 90.35 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 90.34 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 90.32 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 90.29 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 90.28 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 90.28 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 90.26 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 90.26 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 90.25 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 90.25 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 90.24 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 90.23 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 90.22 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 90.22 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 90.22 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 90.2 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 90.19 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 90.17 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 90.14 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 90.14 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 90.07 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 90.03 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 90.02 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 90.01 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 89.98 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 89.98 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 89.97 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 89.97 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 89.96 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 89.96 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 89.94 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 89.91 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 89.87 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 89.87 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 89.86 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 89.84 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 89.84 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 89.8 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 89.8 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 89.79 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 89.79 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 89.78 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 89.75 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 89.73 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 89.72 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 89.71 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 89.66 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 89.65 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 89.62 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 89.61 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 89.55 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 89.54 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 89.49 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 89.48 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 89.47 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 89.47 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 89.46 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 89.43 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 89.42 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 89.42 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 89.42 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 89.41 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 89.4 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 89.36 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 89.35 |
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-49 Score=358.84 Aligned_cols=212 Identities=57% Similarity=0.906 Sum_probs=189.6
Q ss_pred cEEEEEcCCCccHHHHHHHHHhC-CCcceEEEEecCC-chhhHhhhcCccCCCeEEEEc--Cc-------h---------
Q psy14621 34 AKVMVAGASGGIGQPLSLLLKQS-PLVDHLSLYDIVH-TPGVAADLSHIESKAHVQAFN--GA-------D--------- 93 (248)
Q Consensus 34 ~KV~IiGaaG~VG~~~a~~l~~~-~l~~elvLiDi~~-a~g~a~DL~~~~~~~~v~~~~--~~-------d--------- 93 (248)
|||+||||+|+||+++|++|+++ ++++||+|+|+++ ++|++|||+|+.++++++.+. ++ |
T Consensus 1 mKV~IiGAaG~VG~~~a~~L~~~~~~~~el~L~Di~~~~~G~a~Dl~~~~~~~~v~~~~~~~~~~~~~~aDivii~ag~~ 80 (312)
T 3hhp_A 1 MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVA 80 (312)
T ss_dssp CEEEEETTTSHHHHHHHHHHHHHSCTTEEEEEECSSTTHHHHHHHHHTSCSSEEEEEECSSCCHHHHTTCSEEEECCSCS
T ss_pred CEEEEECCCCHHHHHHHHHHHhCCCCCceEEEEecCCCchhHHHHhhCCCCCceEEEecCCCcHHHhCCCCEEEEeCCCC
Confidence 69999997799999999999987 8999999999998 889999999987666776542 11 1
Q ss_pred -------------------------------------------------------------------------------h
Q psy14621 94 -------------------------------------------------------------------------------Q 94 (248)
Q Consensus 94 -------------------------------------------------------------------------------~ 94 (248)
+
T Consensus 81 rkpG~~R~dll~~N~~I~~~i~~~i~~~~p~a~vlvvtNPvd~~t~~a~~~~k~sg~~p~~rv~G~~~LD~~R~~~~la~ 160 (312)
T 3hhp_A 81 RKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAE 160 (312)
T ss_dssp CCTTCCHHHHHHHHHHHHHHHHHHHHHHCTTSEEEECSSCHHHHHHHHHHHHHHTTCCCTTSEEECCHHHHHHHHHHHHH
T ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCcEEEEecCcchhHHHHHHHHHHHcCCCCcceEEEEechhHHHHHHHHHH
Confidence 7
Q ss_pred hcCCCCCCeeEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHh
Q psy14621 95 LKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLI 174 (248)
Q Consensus 95 ~l~v~p~~V~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl 174 (248)
++|++|++|++||||||||+||||+||++. -..++++++++|.++|+++|++|+++|.|+|+|+||+|.|+++++++|+
T Consensus 161 ~lgv~~~~v~~~V~G~Hsg~t~vp~~S~~~-g~~~~~~~~~~i~~~v~~~g~eIi~~k~g~gst~~s~a~a~~~~~~ai~ 239 (312)
T 3hhp_A 161 LKGKQPGEVEVPVIGGHSGVTILPLLSQVP-GVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239 (312)
T ss_dssp HHTCCGGGCCCCEEECSSGGGEEECGGGCT-TCCCCHHHHHHHHHHHHTHHHHHHHHTTTSCCCCHHHHHHHHHHHHHHH
T ss_pred HhCcChhHcceeEEeccCCCceeeecccCC-CCCCCHHHHHHHHHHHHhhhHHHHhhccCCCCchhHHHHHHHHHHHHHH
Confidence 789999999999999999999999999983 2347788899999999999999999765679999999999999999996
Q ss_pred cccCCCCeEEEeeEecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhc
Q psy14621 175 QGLKGESNVIECAYVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAKGEEFVAK 247 (248)
Q Consensus 175 ~~l~~~~~il~~s~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~~l~~~~~ 247 (248)
.+|+|+++++||+|++++ | +++|||+||++|++|+++++++++||++|+++|++|+++|++.++++++|.++
T Consensus 240 ~~l~~~~~v~~~s~~~g~-g~~~v~~s~P~~~g~~Gv~~v~~~~~L~~~E~~~l~~s~~~l~~~i~~g~~~~~~ 312 (312)
T 3hhp_A 240 RALQGEQGVVECAYVEGD-GQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK 312 (312)
T ss_dssp HHHTTCSSCEEEEEEECC-CSSCSEEEEEEEEETTEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred HHcCCCCceEEEEEecCC-CCcceEEEeEEEEeCCEEEEEcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence 666699999999999977 4 68999999999999999999984599999999999999999999999999763
|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 248 | ||||
| d1mlda2 | 169 | d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S | 1e-43 | |
| d2cmda2 | 167 | d.162.1.1 (A:146-312) Malate dehydrogenase {Escher | 2e-42 | |
| d1guza2 | 163 | d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro | 3e-27 | |
| d5mdha2 | 179 | d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S | 3e-24 | |
| d1uxja2 | 164 | d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro | 3e-23 | |
| d1llda2 | 170 | d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid | 1e-21 | |
| d1hyha2 | 163 | d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy | 2e-21 | |
| d1hyea2 | 168 | d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd | 1e-19 | |
| d1o6za2 | 161 | d.162.1.1 (A:163-330) Malate dehydrogenase {Archae | 1e-19 | |
| d1ez4a2 | 171 | d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto | 3e-19 | |
| d1llca2 | 172 | d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto | 3e-19 | |
| d1ldma2 | 169 | d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi | 1e-18 | |
| d1t2da2 | 165 | d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar | 1e-18 | |
| d1ldna2 | 168 | d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil | 1e-18 | |
| d1b8pa2 | 171 | d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp | 2e-18 | |
| d1a5za2 | 172 | d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm | 5e-18 | |
| d1i0za2 | 172 | d.162.1.1 (A:161-332) Lactate dehydrogenase {Human | 1e-17 | |
| d2ldxa2 | 172 | d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse | 2e-17 | |
| d1y6ja2 | 169 | d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost | 3e-17 | |
| d1y7ta2 | 173 | d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu | 5e-17 | |
| d7mdha2 | 188 | d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu | 7e-17 | |
| d1pzga2 | 174 | d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop | 4e-16 | |
| d1mlda1 | 144 | c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s | 2e-13 | |
| d1mlda1 | 144 | c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s | 1e-06 | |
| d1ojua2 | 152 | d.162.1.1 (A:164-331) Lactate dehydrogenase {Archa | 5e-12 | |
| d7mdha1 | 175 | c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( | 7e-11 | |
| d7mdha1 | 175 | c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( | 5e-06 | |
| d2cmda1 | 145 | c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi | 1e-10 | |
| d1o6za1 | 142 | c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon | 4e-08 | |
| d1o6za1 | 142 | c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon | 5e-07 | |
| d5mdha1 | 154 | c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s | 5e-08 | |
| d5mdha1 | 154 | c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s | 1e-04 | |
| d1llda1 | 143 | c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac | 7e-08 | |
| d1llda1 | 143 | c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac | 0.001 | |
| d1y6ja1 | 142 | c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi | 2e-07 | |
| d1y6ja1 | 142 | c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi | 3e-06 | |
| d1y7ta1 | 154 | c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th | 4e-06 | |
| d1ez4a1 | 146 | c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac | 5e-06 | |
| d1ez4a1 | 146 | c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac | 0.002 | |
| d1guza1 | 142 | c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium | 9e-06 | |
| d1guza1 | 142 | c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium | 8e-04 | |
| d1uxja1 | 142 | c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex | 1e-05 | |
| d2ldxa1 | 159 | c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu | 2e-05 | |
| d2ldxa1 | 159 | c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu | 0.002 | |
| d1hyea1 | 145 | c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge | 2e-05 | |
| d1hyea1 | 145 | c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge | 1e-04 | |
| d1a5za1 | 140 | c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto | 3e-05 | |
| d1a5za1 | 140 | c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto | 2e-04 | |
| d1i0za1 | 160 | c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho | 4e-05 | |
| d1i0za1 | 160 | c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho | 0.002 | |
| d1ojua1 | 142 | c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon | 5e-05 | |
| d1ojua1 | 142 | c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon | 0.003 | |
| d1t2da1 | 150 | c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p | 1e-04 | |
| d1ldna1 | 148 | c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus | 1e-04 | |
| d1ldna1 | 148 | c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus | 0.001 | |
| d1pzga1 | 154 | c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas | 5e-04 |
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LDH C-terminal domain-like superfamily: LDH C-terminal domain-like family: Lactate & malate dehydrogenases, C-terminal domain domain: Malate dehydrogenase species: Pig (Sus scrofa) [TaxId: 9823]
Score = 143 bits (361), Expect = 1e-43
Identities = 107/152 (70%), Positives = 126/152 (82%)
Query: 94 QLKGLNPTDVNVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKA 153
+LKGL+P V+VPVIGGHAG TIIPLISQ TP V FP DQL LTGRIQEAGTEVVKAKA
Sbjct: 15 ELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAKA 74
Query: 154 GAGSATLSMAYAGARFAFSLIQGLKGESNVIECAYVKSDVTEASYFSTPVHLGKNGIEKN 213
GAGSATLSMAYAGARF FSL+ + G+ V+EC++VKS T+ YFSTP+ LGK GIEKN
Sbjct: 75 GAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEKN 134
Query: 214 LGLGKLSDFEKELVKAAVPELKKNIAKGEEFV 245
LG+GK+S FE++++ A+PELK +I KGEEFV
Sbjct: 135 LGIGKISPFEEKMIAEAIPELKASIKKGEEFV 166
|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 | Back information, alignment and structure |
|---|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 | Back information, alignment and structure |
|---|
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 | Back information, alignment and structure |
|---|
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 152 | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| d1ojua2 | 152 | Lactate dehydrogenase {Archaeon Archaeoglobus fulg | 100.0 | |
| d1uxja2 | 164 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 100.0 | |
| d1guza2 | 163 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 100.0 | |
| d1ez4a2 | 171 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 100.0 | |
| d1llda2 | 170 | Lactate dehydrogenase {Bifidobacterium longum, str | 100.0 | |
| d1y6ja2 | 169 | Lactate dehydrogenase {Clostridium thermocellum [T | 100.0 | |
| d5mdha2 | 179 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 100.0 | |
| d1pzga2 | 174 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 99.98 | |
| d1t2da2 | 165 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 99.98 | |
| d1a5za2 | 172 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 99.97 | |
| d1mlda2 | 169 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.97 | |
| d7mdha2 | 188 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 99.97 | |
| d1hyea2 | 168 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 99.97 | |
| d2cmda2 | 167 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 99.97 | |
| d1hyha2 | 163 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 99.97 | |
| d1ldna2 | 168 | Lactate dehydrogenase {Bacillus stearothermophilus | 99.97 | |
| d1i0za2 | 172 | Lactate dehydrogenase {Human (Homo sapiens), heart | 99.97 | |
| d1llca2 | 172 | Lactate dehydrogenase {Lactobacillus casei [TaxId: | 99.97 | |
| d1ldma2 | 169 | Lactate dehydrogenase {Dogfish (Squalus acanthias) | 99.97 | |
| d1o6za2 | 161 | Malate dehydrogenase {Archaeon Haloarcula marismor | 99.96 | |
| d2ldxa2 | 172 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 99.96 | |
| d1y7ta2 | 173 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 99.96 | |
| d1b8pa2 | 171 | Malate dehydrogenase {Aquaspirillum arcticum [TaxI | 99.95 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 99.44 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 99.43 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 99.43 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 99.42 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 99.41 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 99.4 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 99.39 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.39 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 99.37 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 99.32 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 99.32 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 99.31 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 99.28 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 99.22 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 99.16 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 99.15 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 99.14 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 99.08 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 98.95 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 98.87 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 98.44 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 98.24 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 98.16 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 98.16 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 97.03 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.99 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 96.97 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 96.92 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 96.89 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.86 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.71 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 96.66 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.62 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 96.61 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.57 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 96.56 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 96.55 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.5 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 96.44 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 96.43 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.43 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 96.39 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 96.39 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 96.38 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 96.38 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 96.33 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 96.29 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 96.27 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.13 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.12 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.11 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 96.04 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 96.02 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 96.0 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.96 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 95.95 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 95.89 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 95.84 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 95.81 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 95.8 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 95.76 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 95.72 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 95.71 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 95.71 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.65 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 95.65 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 95.6 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 95.59 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 95.58 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 95.49 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 95.47 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 95.47 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 95.44 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 95.43 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 95.43 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 95.4 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 95.3 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 95.3 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 95.22 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 95.2 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 95.15 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 95.15 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.14 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 95.05 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.0 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 94.83 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.79 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 94.77 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 94.75 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 94.72 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 94.7 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 94.65 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 94.64 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 94.54 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 94.54 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 94.52 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.5 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 94.48 | |
| d1up7a2 | 253 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 94.41 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.4 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 94.38 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.33 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 94.33 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 94.22 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.19 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 94.12 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 94.11 | |
| d1s6ya2 | 270 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 94.04 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.0 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 93.98 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 93.94 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 93.88 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 93.85 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 93.79 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 93.79 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 93.75 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 93.65 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 93.57 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 93.57 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 93.56 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 93.56 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.5 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.32 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 93.28 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 93.28 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 93.15 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 93.12 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 93.06 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 93.06 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.03 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 93.02 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 92.99 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 92.78 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.78 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 92.69 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 92.65 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 92.57 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 92.52 | |
| d1u8xx2 | 276 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 92.49 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 92.44 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 92.29 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 92.26 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 92.24 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 92.22 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 92.18 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 92.01 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 91.96 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 91.87 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 91.83 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 91.83 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 91.69 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 91.45 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 91.31 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 90.95 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 90.92 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 90.89 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 90.77 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 90.61 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 90.59 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 90.55 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 90.52 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 90.52 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 90.39 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 90.34 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 90.31 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 90.23 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 90.21 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 90.19 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 90.18 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 90.06 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 90.02 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 89.91 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 89.91 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 89.86 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 89.85 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 89.82 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 89.72 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 89.71 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 89.67 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.57 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 89.56 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 89.55 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 89.4 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 89.39 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 89.37 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 89.33 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 89.23 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 89.22 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 89.16 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 89.06 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 89.04 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 88.99 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 88.97 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 88.82 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 88.81 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 88.72 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 88.69 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 88.61 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 88.57 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 88.57 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 88.55 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 88.5 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 88.43 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 88.4 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 88.04 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 88.04 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 88.04 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 87.8 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 87.74 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 87.73 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 87.68 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 87.67 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 87.61 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 87.53 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 87.46 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 87.45 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 87.45 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 87.43 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 87.33 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 87.33 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 87.29 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 87.21 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 87.14 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 87.13 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 87.11 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 87.07 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 86.97 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 86.91 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 86.86 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 86.66 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 86.52 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 86.48 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 86.46 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 86.45 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 86.35 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 86.35 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 86.15 | |
| d1vjta2 | 278 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 85.73 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 85.65 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 85.62 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 85.48 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 85.2 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 85.09 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 85.06 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 84.94 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 84.9 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 84.87 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 84.61 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 84.59 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 84.55 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 84.55 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 84.54 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 84.2 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 84.11 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 84.02 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 83.72 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 83.57 | |
| d1obba2 | 308 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 83.26 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 83.17 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 82.95 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 82.93 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 82.88 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 82.74 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 82.03 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 82.0 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 81.99 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 81.91 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 81.68 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 81.6 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 81.42 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 81.23 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 80.99 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 80.82 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 80.61 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 80.39 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 80.01 |
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LDH C-terminal domain-like superfamily: LDH C-terminal domain-like family: Lactate & malate dehydrogenases, C-terminal domain domain: Lactate dehydrogenase species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00 E-value=2.7e-36 Score=245.46 Aligned_cols=132 Identities=23% Similarity=0.325 Sum_probs=119.4
Q ss_pred CCCCCCe-eEeEEeccCCCcccccccCcccCCCCChHHHHHHHHHHhhccceeeeccCCCCchhHHHHHHHHHHHHHHhc
Q psy14621 97 GLNPTDV-NVPVIGGHAGITIIPLISQATPSVSFPDDQLKALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFAFSLIQ 175 (248)
Q Consensus 97 ~v~p~~V-~~~ViGeHsGds~vp~wS~a~p~~~~~~~~~~~i~~~v~~~g~eIi~~k~gkgst~~siA~a~~~iv~aIl~ 175 (248)
++.+.++ ++|||||| ||||||+||.++.-. +.++++|.+++|++|++|++ +||+|+||||+++++|+++|+.
T Consensus 15 ~~~~~~v~~a~ViGeH-Gds~vp~~S~~~i~g---~~~~~~i~~~v~~~g~eIi~---~kG~t~~gia~a~~~iv~aIl~ 87 (152)
T d1ojua2 15 NAGARNIRRAWIIGEH-GDSMFVAKSLADFDG---EVDWEAVENDVRFVAAEVIK---RKGATIFGPAVAIYRMVKAVVE 87 (152)
T ss_dssp HTTCBSCCCCCEEBCS-STTCEECGGGCCCBS---CCCHHHHHHHHHTTHHHHHH---HHSSCCHHHHHHHHHHHHHHHT
T ss_pred ccCCCCcceeEEEecC-CCccccccccccccC---ccchhHhHHHHHHHHHHhhh---hccceeccHHHHHHHHHHHHHh
Confidence 4567777 99999999 999999999987321 22467899999999999999 4899999999999999999999
Q ss_pred ccCCCCeEEEee-EecCCCC-CceEEEeeEEEcCCcEEEEecCCCCCHHHHHHHHHHHHHHHHHHHH
Q psy14621 176 GLKGESNVIECA-YVKSDVT-EASYFSTPVHLGKNGIEKNLGLGKLSDFEKELVKAAVPELKKNIAK 240 (248)
Q Consensus 176 ~l~~~~~il~~s-~~~g~yg-~~v~~s~Pv~lg~~Gv~~i~~l~~Ls~~E~~~L~~Sa~~I~~~i~~ 240 (248)
|+++++|+| |++++|| +++|+|+||++|++|++ ++++ +||++|+++|++|++.||+.++.
T Consensus 88 ---d~~~v~pvs~~l~geyG~~dv~lsvP~vig~~Gve-i~~l-~L~~~E~~~l~~Sa~~ik~~i~~ 149 (152)
T d1ojua2 88 ---DTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAE-VADI-KLSDEEIEKLRNSAKILRERLEE 149 (152)
T ss_dssp ---TCCCEEEEEEEEESGGGCEEEEEEEEEEEETTEEE-ECCC-CCCHHHHHHHHHHHHHHHHHHHT
T ss_pred ---cCCCceeeeEEeccccCCCCEEEEeEEEECCCceE-EEcC-CCCHHHHHHHHHHHHHHHHHHHH
Confidence 999999998 9999999 89999999999999995 8899 69999999999999999998875
|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|