Psyllid ID: psy14770


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWYKGTRKVGFLLSF
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccc
cccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHcccHHHHHHHHHHHHcccccEEEEEEcc
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSslrdsvpslqgekvevpgshvdtldqgfwykgtrkvgfllsf
msdderdydiesaekrahhnalerkrrdhikdsfsslrdsvpslqgekvevpgshvdtldqgfwykgtrkVGFLLSF
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWYKGTRKVGFLLSF
******************************************************HVDTLDQGFWYKGTRKVGFLL**
********************ALERKRRDHIKDSFSSLRDSVPSLQG**********DTLDQGFWYKGTRKVGFLLSF
**********ESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWYKGTRKVGFLLSF
***********************RKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWYKGTRKVGFLLSF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWYKGTRKVGFLLSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
P52162160 Protein max OS=Gallus gal yes N/A 0.779 0.375 0.640 7e-14
P61244160 Protein max OS=Homo sapie no N/A 0.779 0.375 0.640 7e-14
P61245160 Protein max OS=Felis catu N/A N/A 0.779 0.375 0.640 7e-14
P52164160 Protein max OS=Rattus nor yes N/A 0.779 0.375 0.640 7e-14
P28574160 Protein max OS=Mus muscul no N/A 0.779 0.375 0.640 7e-14
P52161165 Protein max OS=Danio reri yes N/A 0.688 0.321 0.685 3e-13
Q07016163 Protein max OS=Xenopus la N/A N/A 0.649 0.306 0.703 3e-13
P91664161 Protein max OS=Drosophila yes N/A 0.636 0.304 0.527 8e-13
P24793437 N-myc protein OS=Xenopus N/A N/A 0.558 0.098 0.511 2e-06
P03966462 N-myc proto-oncogene prot no N/A 0.506 0.084 0.512 4e-05
>sp|P52162|MAX_CHICK Protein max OS=Gallus gallus GN=MAX PE=3 SV=1 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (71%), Gaps = 4/64 (6%)

Query: 2  SDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQ 61
          SD+E+     +A+KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK     S    LD+
Sbjct: 11 SDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK----ASRAQILDK 66

Query: 62 GFWY 65
             Y
Sbjct: 67 ATEY 70




Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC-MAX complex is a transcriptional activator, whereas the MAD-MAX complex is a repressor.
Gallus gallus (taxid: 9031)
>sp|P61244|MAX_HUMAN Protein max OS=Homo sapiens GN=MAX PE=1 SV=1 Back     alignment and function description
>sp|P61245|MAX_FELCA Protein max OS=Felis catus GN=MAX PE=2 SV=1 Back     alignment and function description
>sp|P52164|MAX_RAT Protein max OS=Rattus norvegicus GN=Max PE=1 SV=1 Back     alignment and function description
>sp|P28574|MAX_MOUSE Protein max OS=Mus musculus GN=Max PE=1 SV=1 Back     alignment and function description
>sp|P52161|MAX_DANRE Protein max OS=Danio rerio GN=max PE=2 SV=1 Back     alignment and function description
>sp|Q07016|MAX_XENLA Protein max OS=Xenopus laevis GN=max PE=2 SV=1 Back     alignment and function description
>sp|P91664|MAX_DROME Protein max OS=Drosophila melanogaster GN=Max PE=1 SV=1 Back     alignment and function description
>sp|P24793|MYCN_XENLA N-myc protein OS=Xenopus laevis GN=mycn PE=2 SV=1 Back     alignment and function description
>sp|P03966|MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus GN=Mycn PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
240849031141 bhlhzip transcription factor max/bigmax- 0.636 0.347 0.877 3e-17
312385888 179 hypothetical protein AND_00219 [Anophele 0.636 0.273 0.9 3e-16
260836929115 hypothetical protein BRAFLDRAFT_188887 [ 0.805 0.539 0.651 8e-15
443684885161 hypothetical protein CAPTEDRAFT_118760 [ 0.844 0.403 0.562 1e-14
383861970171 PREDICTED: protein max-like [Megachile r 0.636 0.286 0.657 1e-14
350421414171 PREDICTED: protein max-like [Bombus impa 0.636 0.286 0.657 2e-14
340726942171 PREDICTED: protein max-like isoform 1 [B 0.636 0.286 0.657 2e-14
340726944161 PREDICTED: protein max-like isoform 2 [B 0.636 0.304 0.657 2e-14
209154632156 max [Salmo salar] 0.831 0.410 0.686 3e-14
380018849171 PREDICTED: protein max-like isoform 1 [A 0.636 0.286 0.657 4e-14
>gi|240849031|ref|NP_001155631.1| bhlhzip transcription factor max/bigmax-like [Acyrthosiphon pisum] gi|239790453|dbj|BAH71787.1| ACYPI005523 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/49 (87%), Positives = 48/49 (97%)

Query: 1  MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKV 49
          MSDD+RD ++E+AEKRAHHNALERKRRDHIKDSF+SLRDSVPSLQGEKV
Sbjct: 1  MSDDDRDVELETAEKRAHHNALERKRRDHIKDSFTSLRDSVPSLQGEKV 49




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312385888|gb|EFR30280.1| hypothetical protein AND_00219 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|260836929|ref|XP_002613458.1| hypothetical protein BRAFLDRAFT_188887 [Branchiostoma floridae] gi|229298843|gb|EEN69467.1| hypothetical protein BRAFLDRAFT_188887 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|443684885|gb|ELT88674.1| hypothetical protein CAPTEDRAFT_118760 [Capitella teleta] Back     alignment and taxonomy information
>gi|383861970|ref|XP_003706457.1| PREDICTED: protein max-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350421414|ref|XP_003492834.1| PREDICTED: protein max-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726942|ref|XP_003401810.1| PREDICTED: protein max-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340726944|ref|XP_003401811.1| PREDICTED: protein max-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|209154632|gb|ACI33548.1| max [Salmo salar] Back     alignment and taxonomy information
>gi|380018849|ref|XP_003693333.1| PREDICTED: protein max-like isoform 1 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
FB|FBgn0017578161 Max "Max" [Drosophila melanoga 0.467 0.223 0.777 6.6e-16
UNIPROTKB|G3V2R5125 MAX "Protein max" [Homo sapien 0.779 0.48 0.666 1.3e-15
UNIPROTKB|G3V563121 MAX "Protein max" [Homo sapien 0.779 0.495 0.666 1.3e-15
UNIPROTKB|Q6V3B194 MAX "MAX protein" [Homo sapien 0.779 0.638 0.666 1.3e-15
UNIPROTKB|F2Z5K0151 MAX "Uncharacterized protein" 0.779 0.397 0.666 1.3e-15
UNIPROTKB|A8E4Q8162 MAX "MAX protein" [Bos taurus 0.805 0.382 0.640 4.2e-15
UNIPROTKB|P52162160 MAX "Protein max" [Gallus gall 0.779 0.375 0.640 1.1e-14
UNIPROTKB|E2QZS2160 MAX "Uncharacterized protein" 0.779 0.375 0.640 1.1e-14
UNIPROTKB|P61244160 MAX "Protein max" [Homo sapien 0.779 0.375 0.640 1.1e-14
UNIPROTKB|P61245160 MAX "Protein max" [Felis catus 0.779 0.375 0.640 1.1e-14
FB|FBgn0017578 Max "Max" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 6.6e-16, Sum P(2) = 6.6e-16
 Identities = 28/36 (77%), Positives = 36/36 (100%)

Query:    13 AEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEK 48
             AEKRAHHNALER+RRDHIK+SF++LR++VP+L+GEK
Sbjct:    38 AEKRAHHNALERRRRDHIKESFTNLREAVPTLKGEK 73


GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS;IDA
GO:0005634 "nucleus" evidence=IC;ISS
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
UNIPROTKB|G3V2R5 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V563 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V3B1 MAX "MAX protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5K0 MAX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A8E4Q8 MAX "MAX protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P52162 MAX "Protein max" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZS2 MAX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61244 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P61245 MAX "Protein max" [Felis catus (taxid:9685)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52162MAX_CHICKNo assigned EC number0.64060.77920.375yesN/A
P52161MAX_DANRENo assigned EC number0.68510.68830.3212yesN/A
P52164MAX_RATNo assigned EC number0.64060.77920.375yesN/A
P91664MAX_DROMENo assigned EC number0.52770.63630.3043yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 1e-11
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 5e-09
smart0035353 smart00353, HLH, helix loop helix domain 4e-05
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 53.6 bits (130), Expect = 1e-11
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQ 61
          +R  HN  ER+RRD I D+F  LR+ +P+   +K+    S  + L  
Sbjct: 1  RRKAHNERERRRRDRINDAFEELRELLPTPPNKKL----SKAEILRL 43


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
1hlo_A80 The Crystal Structure Of An Intact Human Max-Dna Co 1e-14
1an2_A86 Recognition By Max Of Its Cognate Dna Through A Dim 2e-14
1r05_A87 Solution Structure Of Max B-Hlh-Lz Length = 87 3e-14
1nlw_B76 Crystal Structure Of Mad-Max Recognizing Dna Length 1e-13
1nkp_B83 Crystal Structure Of Myc-Max Recognizing Dna Length 1e-13
1nkp_A88 Crystal Structure Of Myc-Max Recognizing Dna Length 3e-04
>pdb|1HLO|A Chain A, The Crystal Structure Of An Intact Human Max-Dna Complex: New Insights Into Mechanisms Of Transcriptional Control Length = 80 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 5/60 (8%) Query: 7 DYDIES-AEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQGFWY 65 D ++ES A+KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK S LD+ Y Sbjct: 3 DIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK----ASRAQILDKATEY 58
>pdb|1AN2|A Chain A, Recognition By Max Of Its Cognate Dna Through A Dimeric BHLHZ DOMAIN Length = 86 Back     alignment and structure
>pdb|1R05|A Chain A, Solution Structure Of Max B-Hlh-Lz Length = 87 Back     alignment and structure
>pdb|1NLW|B Chain B, Crystal Structure Of Mad-Max Recognizing Dna Length = 76 Back     alignment and structure
>pdb|1NKP|B Chain B, Crystal Structure Of Myc-Max Recognizing Dna Length = 83 Back     alignment and structure
>pdb|1NKP|A Chain A, Crystal Structure Of Myc-Max Recognizing Dna Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 1e-14
1hlo_A80 Protein (transcription factor MAX); transcriptiona 2e-14
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 6e-13
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 4e-11
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 2e-10
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 2e-10
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 2e-06
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
 Score = 61.6 bits (150), Expect = 1e-14
 Identities = 33/35 (94%), Positives = 34/35 (97%)

Query: 14 EKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEK 48
          +KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK
Sbjct: 1  DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK 35


>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.68
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.67
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.58
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.58
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.55
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.49
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.46
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.45
4ati_A118 MITF, microphthalmia-associated transcription fact 99.4
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.4
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.34
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.32
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.28
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.78
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.65
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.55
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.99
4ath_A83 MITF, microphthalmia-associated transcription fact 97.76
3muj_A138 Transcription factor COE3; immunoglobulin like fol 83.44
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
Probab=99.68  E-value=5.4e-17  Score=102.02  Aligned_cols=51  Identities=22%  Similarity=0.251  Sum_probs=45.0

Q ss_pred             HHHHhHHHHHhhHHHHHHHHHHHhhhCCCCC-CCCcchhHHHHHhhhhhhhhhhhe
Q psy14770         15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQ-GEKVEVPGSHVDTLDQGFWYKGTR   69 (77)
Q Consensus        15 kR~~HN~lERkRR~~ik~~F~~Lr~~VP~l~-~~KaSk~~IL~ktld~~~~~~~~~   69 (77)
                      +|.+||.+||+||++||+||+.|++.||.+. +.|+||+.||.+|++    ||.++
T Consensus         1 ~R~~HN~~ER~RR~~lk~~f~~Lr~~vP~~~~~~k~sk~~iL~kA~~----yI~~L   52 (80)
T 1nlw_A            1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKL----HIKKL   52 (80)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHH----HHHHH
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCHHHHHHHHHH----HHHHH
Confidence            4899999999999999999999999999995 689999999888776    55543



>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 77
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 5e-10
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 4e-09
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 1e-08
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 5e-08
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-07
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 1e-06
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 7e-06
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 47.8 bits (114), Expect = 5e-10
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 14 EKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVEVPGSHVDTLDQ 61
          ++RA HN +ER+RRD I +    L   +P    E  +   S    L +
Sbjct: 4  KRRAQHNEVERRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSK 51


>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.53
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.5
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.48
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.46
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 98.42
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Mad protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55  E-value=2.9e-15  Score=90.84  Aligned_cols=47  Identities=23%  Similarity=0.334  Sum_probs=42.9

Q ss_pred             HHHHhHHHHHhhHHHHHHHHHHHhhhCCCCC-CCCcchhHHHHHhhhh
Q psy14770         15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQ-GEKVEVPGSHVDTLDQ   61 (77)
Q Consensus        15 kR~~HN~lERkRR~~ik~~F~~Lr~~VP~l~-~~KaSk~~IL~ktld~   61 (77)
                      .|.+||.+||+||+.|+.+|+.|++.||.+. +.|.||+.||.+|++|
T Consensus         1 ~R~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~~k~sK~~iL~~A~~y   48 (79)
T d1nlwa_           1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLH   48 (79)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhCccCCCCCCCCHHHHHHHHHHH
Confidence            3889999999999999999999999999986 5799999999888774



>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure