Psyllid ID: psy14874


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010-----
MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNK
cccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHcccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHcccHHHHcccHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccHHHHHHHcccccHHcccccccHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccc
cHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccEccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccHEEEEEEEEEcccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEccccccccc
MLEQMSGTEISKALNkqtsigwtplLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLgasidatddqgqkpihvaaQNNFPEVAQIFLRahpslvtattkdgntcAHIAAMQGSVGVIEELMKFDRSGVIsarnrvteatplqlaaegghANVVRVLVKAGasctdenktgFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLshvpgtvksdpptgasflgelgsesgmtplhlaaysGNENVVRLLLNSagvqvdaqtqengynplhlacFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGqgaeinatdkggarsIHTAARYGHVGIINTLlqkgekvdvttnnlacGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLgqgaeinaTDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLgasidatddqgqkpihvaaQNNFPEVAQIFLRahpslvtatTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFilcppvwicftlslghkynkvpIIKFMSYLTSHMYLMFLLMLVGitpiypvvrpnlvpYWYEWTLLVWLSGLLLfeltnpsdksglgWVKLAVLLFGIFGVALHLLEYTFIlsegkitthllpFQFVYNLMVcsknhnnkpmeefvlmspapvdtAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFilcppvwicftlslghkynk
MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPlqlaaegghaNVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHvpgtvksdppTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKafinsksrvGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNK
MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATEllalaaGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTllvwlsglllfelTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATEllalaaGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNK
****************QTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEE***SKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVP************************PLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATT*****AKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGH****
ML*Q*SGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHK***
**********SKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNK
MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKS***TGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNKVPIIKFMSYLTSHMYLMFLLMLVGITPIYPVVRPNLVPYWYEWTLLVWLSGLLLFELTNPSDKSGLGWVKLAVLLFGIFGVALHLLEYTFILSEGKITTHLLPFQFVYNLMVCSKNHNNKPMEEFVLMSPAPVDTAAKLSSIYITLATKEKERAKDLIAAGKHCEGMATELLALAAGADSAGRILTATDRRNIEFLDVLIENEQKEVIAHTVVQRYLQELWQGSLNWAAWKTMLLFLTFILCPPVWICFTLSLGHKYNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1015 2.2.26 [Sep-21-2011]
Q12955 4377 Ankyrin-3 OS=Homo sapiens yes N/A 0.580 0.134 0.314 5e-75
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.579 0.299 0.317 4e-68
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.578 0.150 0.317 1e-67
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.574 0.147 0.320 2e-67
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.563 0.304 0.329 2e-62
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.510 0.278 0.296 4e-59
O150841053 Serine/threonine-protein no N/A 0.603 0.582 0.289 1e-54
Q5F478990 Serine/threonine-protein no N/A 0.596 0.611 0.291 4e-53
Q505D11053 Serine/threonine-protein no N/A 0.603 0.582 0.284 6e-53
B2RXR6993 Serine/threonine-protein no N/A 0.585 0.598 0.294 3e-51
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function desciption
 Score =  283 bits (724), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 215/683 (31%), Positives = 332/683 (48%), Gaps = 94/683 (13%)

Query: 26  LIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSR 85
           L A   GH+E     + N   +++ +Q G +ALHLA++ G+++V   LL  +A +++ ++
Sbjct: 46  LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATK 105

Query: 86  VGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGA 145
            G TALH+A++ G A++ + LV + A V +  +    TPL++AA+   L+V K LLD GA
Sbjct: 106 KGNTALHIASLAGQAEVVKVLVTNGANV-NAQSQNGFTPLYMAAQENHLEVVKFLLDNGA 164

Query: 146 SIDATDDQGQKPIHVAAQNNFPEVAQIFLRAH-------PSLVTATTKD----------- 187
           S     + G  P+ VA Q    +V  + L          P+L  A  KD           
Sbjct: 165 SQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQN 224

Query: 188 ----------GNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHA 237
                     G T  HIAA  G++ V   L+    +   +ARN +   TPL +A++ G+A
Sbjct: 225 DNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDI---TPLHVASKRGNA 281

Query: 238 NVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVA 297
           N+V++L+  GA    + + G T +H  A++GH QV+E +    A  +   K G++ LH+A
Sbjct: 282 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMA 341

Query: 298 AYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLN 357
                 + V+ LL H    V  D  T             +T LH+AA+ G+  V ++LL+
Sbjct: 342 TQGDHLNCVQLLLQH---NVPVDDVT----------NDYLTALHVAAHCGHYKVAKVLLD 388

Query: 358 SAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGH 417
                 +A+   NG+ PLH+AC    + V+ LLL   A  +Q+  ++G T +H+AA  GH
Sbjct: 389 KKA-NPNAKAL-NGFTPLHIACKKNRIKVMELLLKHGAS-IQAVTESGLTPIHVAAFMGH 445

Query: 418 LQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVT 477
           + +V  L+  GA  N T+  G  ++H AAR G   ++  L+Q G +V+            
Sbjct: 446 VNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA--------- 496

Query: 478 VVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHK 537
                            K+ +T LHI+A  G   +V+ LL QGA  NA            
Sbjct: 497 -----------------KDDQTPLHISARLGKADIVQQLLQQGASPNAA----------- 528

Query: 538 AFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVC 597
                 +  G T LHL+A  G+ D+  FL+ DH A + I T +  TPLH+AA+ G+L+V 
Sbjct: 529 ------TTSGYTPLHLSAREGHEDVAAFLL-DHGASLSITTKKGFTPLHVAAKYGKLEVA 581

Query: 598 KLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKEKERAKDLIAA 657
            LLL   AS DA    G  P+HVAA  +  +VA + L    S   A           IAA
Sbjct: 582 NLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAA 639

Query: 658 GKHCEGMATELLALAAGADSAGR 680
            K+   +AT LL   A A++  R
Sbjct: 640 KKNQMDIATTLLEYGADANAVTR 662




Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments.
Homo sapiens (taxid: 9606)
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1015
328718834 1716 PREDICTED: serine/threonine-protein phos 0.480 0.284 0.756 0.0
383850421 1711 PREDICTED: serine/threonine-protein phos 0.367 0.218 0.791 0.0
48095512 1711 PREDICTED: serine/threonine-protein phos 0.367 0.218 0.793 0.0
340728309 1477 PREDICTED: serine/threonine-protein phos 0.367 0.252 0.788 0.0
307197305 1482 Ankyrin-1 [Harpegnathos saltator] 0.479 0.328 0.760 0.0
380011932 1711 PREDICTED: LOW QUALITY PROTEIN: serine/t 0.367 0.218 0.791 0.0
350403217 1712 PREDICTED: serine/threonine-protein phos 0.367 0.217 0.788 0.0
340728307 1712 PREDICTED: serine/threonine-protein phos 0.367 0.217 0.788 0.0
332020535 1538 Ankyrin-1 [Acromyrmex echinatior] 0.479 0.316 0.756 0.0
307185525 1504 Ankyrin-1 [Camponotus floridanus] 0.479 0.323 0.752 0.0
>gi|328718834|ref|XP_001945728.2| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/496 (75%), Positives = 426/496 (85%), Gaps = 8/496 (1%)

Query: 1    MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHL 60
            ML  MS TE+ +++N+Q+S+GWTPLLIAC+RGHM LVNTMLNNHARVDVFD EGRSALHL
Sbjct: 630  MLNGMSPTEVQQSMNRQSSVGWTPLLIACHRGHMSLVNTMLNNHARVDVFDNEGRSALHL 689

Query: 61   AAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLR 120
            AAE GYLKVCDALLTHKAFINSKSRVG TALHLAAMNG+ADLCRFL+HDH AVIDILTLR
Sbjct: 690  AAERGYLKVCDALLTHKAFINSKSRVGWTALHLAAMNGFADLCRFLIHDHNAVIDILTLR 749

Query: 121  KQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSL 180
            KQTPLHLAA AGQL+VC+LLLDLGA+IDATDDQGQKPIH+A+QNN+PEV  +FL+ HP L
Sbjct: 750  KQTPLHLAASAGQLEVCRLLLDLGANIDATDDQGQKPIHIASQNNYPEVVHLFLQQHPQL 809

Query: 181  VTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVV 240
            V A+TKDGNTCAHIAAMQGSV VI ELMKFD++GVISARNR+TEATPLQLAAEGGHA VV
Sbjct: 810  VLASTKDGNTCAHIAAMQGSVTVIIELMKFDKNGVISARNRITEATPLQLAAEGGHAQVV 869

Query: 241  RVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYF 300
            +VLV+AGASC+DENK GFTAVHLAAQNGH  VLE +RSS++L + SK+LG+TALH+AAY 
Sbjct: 870  KVLVRAGASCSDENKAGFTAVHLAAQNGHLAVLEVLRSSQSLKISSKRLGMTALHMAAYC 929

Query: 301  GQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAG 360
            GQ DTVRELLSH+P TVKSDPP+G S LG LG+ESGMTPLH AAYSGNENVVRLLLNSAG
Sbjct: 930  GQTDTVRELLSHIPATVKSDPPSGVSVLGVLGNESGMTPLHFAAYSGNENVVRLLLNSAG 989

Query: 361  VQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQM 420
            VQVDA T E+GYN LHLACFGGHVTVVGLLLSRAADLL S+D NGKTCLHIAA++GH  M
Sbjct: 990  VQVDASTVESGYNALHLACFGGHVTVVGLLLSRAADLLHSSDLNGKTCLHIAASYGHYAM 1049

Query: 421  VEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLAC------- 473
            VEVLLGQGAEINATDK G  ++H AAR G++ ++  L++ G      TN  A        
Sbjct: 1050 VEVLLGQGAEINATDKNGWTAMHCAARAGYLDVVKLLVESGASPKAETNYGASPIWFAAQ 1109

Query: 474  -GHVTVVGLLLSRAAD 488
             GH  V+  L+++  D
Sbjct: 1110 EGHNDVLEYLMTKEHD 1125




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383850421|ref|XP_003700794.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|48095512|ref|XP_392309.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Apis mellifera] Back     alignment and taxonomy information
>gi|340728309|ref|XP_003402468.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307197305|gb|EFN78597.1| Ankyrin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380011932|ref|XP_003690046.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Apis florea] Back     alignment and taxonomy information
>gi|350403217|ref|XP_003486733.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728307|ref|XP_003402467.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332020535|gb|EGI60950.1| Ankyrin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307185525|gb|EFN71501.1| Ankyrin-1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1015
FB|FBgn00169201726 nompC "no mechanoreceptor pote 0.520 0.305 0.677 6.3e-258
ZFIN|ZDB-GENE-030728-71614 trpn1 "transient receptor pote 0.454 0.285 0.529 1.5e-162
WB|WBGene000066161924 trp-4 [Caenorhabditis elegans 0.448 0.236 0.473 3e-146
MGI|MGI:88026 1961 Ank3 "ankyrin 3, epithelial" [ 0.592 0.306 0.311 4.1e-62
UNIPROTKB|F1PJ90 1782 ANK3 "Uncharacterized protein" 0.591 0.336 0.315 4.5e-62
RGD|620156843 Ank2 "ankyrin 2, neuronal" [Ra 0.595 0.716 0.307 1.5e-61
UNIPROTKB|Q12955 4377 ANK3 "Ankyrin-3" [Homo sapiens 0.591 0.137 0.314 3.8e-61
UNIPROTKB|F1NJ80 1699 ANK3 "Uncharacterized protein" 0.583 0.348 0.303 9.2e-61
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.583 0.340 0.303 9.6e-61
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.583 0.324 0.303 1.1e-60
FB|FBgn0016920 nompC "no mechanoreceptor potential C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1859 (659.5 bits), Expect = 6.3e-258, Sum P(2) = 6.3e-258
 Identities = 366/540 (67%), Positives = 439/540 (81%)

Query:     1 MLEQMSGTEISKALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHL 60
             M+  M+ T+I KA+N+Q+S+GWTPLLIAC+RGHMELVN +L NHARVDVFD EGRSALHL
Sbjct:   640 MISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHL 699

Query:    61 AAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLR 120
             AAE GYL VCDALLT+KAFINSKSRVGRTALHLAAMNG+  L +FL+ DH AVIDILTLR
Sbjct:   700 AAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLR 759

Query:   121 KQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSL 180
             KQTPLHLAA +GQ++VC+LLL+LGA+IDATDD GQKPIHVAAQNN+ EVA++FL+ HPSL
Sbjct:   760 KQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSL 819

Query:   181 VTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVV 240
             V AT+KDGNTCAHIAAMQGSV VIEELMKFDRSGVISARN++T+ATPLQLAAEGGHA+VV
Sbjct:   820 VNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVV 879

Query:   241 RVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYF 300
             + LV+AGASCT+ENK GFTAVHLAAQNGH QVL+ ++S+ +L + SKKLG+T LHVAAY+
Sbjct:   880 KALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYY 939

Query:   301 GQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAG 360
             GQADTVRELL+ VP TVKS+ PTG S  G+LG+ESGMTPLHLAA+SGNENVVRLLLNSAG
Sbjct:   940 GQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAG 999

Query:   361 VQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQM 420
             VQVDA T ENGYNPLHLACFGGH++VVGLLLSR+A+LLQS D+NG+T LHIAA HGH+QM
Sbjct:  1000 VQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQM 1059

Query:   421 VEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLAC------- 473
             VE+LLGQGAEINATD+ G   +H AA+ GH+ ++  L + G      TN   C       
Sbjct:  1060 VEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETN-YGCAAIWFAA 1118

Query:   474 --GHVTVVGLLLSRAADL--LQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKV 529
               GH  V+  L+++  D   L    +     + ++  H +  + E +L   A ++   K+
Sbjct:  1119 SEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKL 1178


GO:0005262 "calcium channel activity" evidence=IEA;ISS
GO:0006816 "calcium ion transport" evidence=ISS
GO:0007638 "mechanosensory behavior" evidence=IMP
GO:0005216 "ion channel activity" evidence=ISS
GO:0008381 "mechanically-gated ion channel activity" evidence=NAS;TAS
GO:0050954 "sensory perception of mechanical stimulus" evidence=NAS
GO:0007605 "sensory perception of sound" evidence=IMP
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0030506 "ankyrin binding" evidence=NAS
GO:0050974 "detection of mechanical stimulus involved in sensory perception" evidence=TAS
GO:0070588 "calcium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005929 "cilium" evidence=IDA
GO:0040011 "locomotion" evidence=IMP
GO:0050975 "sensory perception of touch" evidence=IMP
ZFIN|ZDB-GENE-030728-7 trpn1 "transient receptor potential cation channel, subfamily N, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00006616 trp-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:88026 Ank3 "ankyrin 3, epithelial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ90 ANK3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q12955 ANK3 "Ankyrin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ80 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1015
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-22
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-20
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-18
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-16
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-15
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-15
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-13
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-13
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-12
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-11
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-10
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-10
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-10
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-10
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-09
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-09
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-09
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-09
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-08
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-08
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-07
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-06
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 1e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
PHA02743166 PHA02743, PHA02743, Viral ankyrin protein; Provisi 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-05
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-05
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 6e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-05
smart0024830 smart00248, ANK, ankyrin repeats 8e-05
smart0024830 smart00248, ANK, ankyrin repeats 8e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
PHA02743166 PHA02743, PHA02743, Viral ankyrin protein; Provisi 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-04
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 7e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 8e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 8e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.002
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 0.003
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  124 bits (314), Expect = 2e-33
 Identities = 55/127 (43%), Positives = 81/127 (63%), Gaps = 1/127 (0%)

Query: 48  DVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLV 107
           +  D++GR+ LHLAA +G+L+V   LL + A +N+K   GRT LHLAA NG+ ++ + L+
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 108 HDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFP 167
            +  A ++       TPLHLAA  G L V KLLL  GA ++A D  G+ P+H+AA+N   
Sbjct: 61  -EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHL 119

Query: 168 EVAQIFL 174
           EV ++ L
Sbjct: 120 EVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222925 PHA02743, PHA02743, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222925 PHA02743, PHA02743, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1015
KOG4177|consensus 1143 100.0
KOG4177|consensus 1143 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG3609|consensus 822 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG3609|consensus 822 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
TIGR00870 743 trp transient-receptor-potential calcium channel p 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02798489 ankyrin-like protein; Provisional 99.98
PHA02875413 ankyrin repeat protein; Provisional 99.98
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG3614|consensus 1381 99.97
KOG0509|consensus600 99.96
KOG0509|consensus600 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG4369|consensus 2131 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
KOG4369|consensus 2131 99.92
KOG0502|consensus296 99.9
KOG0502|consensus296 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG0507|consensus854 99.88
PLN03192823 Voltage-dependent potassium channel; Provisional 99.86
KOG0507|consensus854 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.85
KOG3676|consensus 782 99.85
PHA02741169 hypothetical protein; Provisional 99.85
KOG0514|consensus452 99.83
KOG0514|consensus452 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.82
KOG0505|consensus527 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.8
KOG0505|consensus527 99.79
PHA02741169 hypothetical protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.77
KOG0512|consensus228 99.75
KOG0512|consensus228 99.73
PHA02736154 Viral ankyrin protein; Provisional 99.72
KOG0195|consensus448 99.71
KOG0195|consensus448 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.61
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.59
KOG3676|consensus782 99.58
KOG4214|consensus117 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.37
KOG4214|consensus117 99.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.35
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
KOG0515|consensus752 99.26
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.24
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.23
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.23
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.21
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.19
KOG1710|consensus396 99.16
KOG1710|consensus396 99.15
KOG0515|consensus752 99.09
KOG3614|consensus 1381 98.84
PF1360630 Ank_3: Ankyrin repeat 98.65
KOG0783|consensus 1267 98.62
PF0834463 TRP_2: Transient receptor ion channel II; InterPro 98.56
KOG0782|consensus1004 98.5
KOG0818|consensus669 98.48
KOG0506|consensus622 98.48
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.48
PF1360630 Ank_3: Ankyrin repeat 98.47
KOG0506|consensus622 98.47
KOG0783|consensus 1267 98.45
KOG0782|consensus1004 98.41
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.39
KOG0511|consensus516 98.12
KOG0818|consensus669 98.08
KOG0522|consensus560 98.07
KOG2384|consensus223 98.0
KOG0522|consensus560 97.99
KOG0705|consensus749 97.94
KOG0705|consensus749 97.9
KOG2384|consensus223 97.88
KOG0521|consensus785 97.86
KOG0511|consensus516 97.59
KOG0520|consensus975 97.54
KOG0521|consensus785 97.49
KOG0520|consensus975 97.31
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.28
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.64
KOG2505|consensus591 95.53
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.5
KOG2505|consensus591 95.39
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.25
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.16
PLN03223 1634 Polycystin cation channel protein; Provisional 91.88
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.15
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.85
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.57
PF08016425 PKD_channel: Polycystin cation channel; InterPro: 84.01
KOG3599|consensus 798 81.5
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=3e-59  Score=547.54  Aligned_cols=586  Identities=35%  Similarity=0.486  Sum_probs=400.4

Q ss_pred             hhHhhHhhccCCCCCCc-HHHHHHhcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCC
Q psy14874          7 GTEISKALNKQTSIGWT-PLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSR   85 (1015)
Q Consensus         7 ~~~~~~~~n~~~~~g~t-~L~~A~~~g~~~iv~~Ll~~g~~~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~ga~in~~~~   85 (1015)
                      +++..-.....|..|++ .||.||++|+.+.++.|+++..+.+...+.+.||+|+|+-.|+.+++++|+..|+.++....
T Consensus         6 ~~~~~a~~~~~~~~~~~~~l~~a~r~~~~~~~~~l~~~e~~~~~~sk~~~~pl~~aa~~~~~~v~~~ll~~~a~v~~~~~   85 (1143)
T KOG4177|consen    6 HDRAVAVLLENDVKGRLPALHIAARNDDTNAAKLLLQNEHNADVDSKSGFTPLHIAAHYGNENVAELLLNRGAIVNATAR   85 (1143)
T ss_pred             cccccccccccCccccchHHHHHHhccchhhcccccccccccchhcccccCHHHHHhhhhhhhhhhhhhccccccCcccc
Confidence            33444444444545544 36666666666666666665544444444556666666666666666666666666666666


Q ss_pred             CCCcHHHHHHHcCCHHHHHHHHhccCccccccccCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHH----
Q psy14874         86 VGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVA----  161 (1015)
Q Consensus        86 ~g~t~L~~A~~~g~~eiv~~Ll~~~~~~i~~~~~~g~t~L~~Aa~~g~~~ivk~Ll~~gad~n~~d~~~~t~L~~A----  161 (1015)
                      .|.||||.|+..|+.++++.|+ ..+..++..+..|.||||.|+..|+.+++++|+..|++++.+|+.|.||+++|    
T Consensus        86 ~~~~plh~a~~~~~a~~v~~ll-~~ga~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l~~a~~~~  164 (1143)
T KOG4177|consen   86 NGITPLHVASKRGDAEMVKLLL-CRGAQIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPLHMAAQVA  164 (1143)
T ss_pred             cCccHHHHHHhhcchhHHHHHH-hccCchhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCchhhhcchh
Confidence            6666666666666666666666 34555666666666666666666666666666666666666666666655443    


Q ss_pred             -------------------HHcCChHHHHHHhhcCCCCcccCCCCCchHHHHHHHcCCHHHHHHHHhcCCcccccccCCC
Q psy14874        162 -------------------AQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRV  222 (1015)
Q Consensus       162 -------------------~~~g~~~iv~~Ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~  222 (1015)
                                         ...++.+++++++....+ ....+.+|.||+|.||..+..++++.++.++.+   ....+.
T Consensus       165 ~~~ll~~~~~~d~l~~~~~~~~~~~~~~~ll~~~~~~-~~a~~~~~~tpl~~a~~~nri~~~eLll~~gad---v~a~d~  240 (1143)
T KOG4177|consen  165 CARLLLEYKAPDYLRLHVAAHCGHARVAKLLLDKKAD-PNASALNGFTPLHIACKKNRIKVVELLLKHGAD---VSAKDE  240 (1143)
T ss_pred             hhHHhhhcccchhhhhhHHhhcchHHHHhhhhcccCC-ccccccCCCCchhhhccccccceeeeeeeccCc---CCcccc
Confidence                               345666777777665554 456666777777777777777777777765544   233344


Q ss_pred             CCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCccccccccCCCHHHHHHHcCC
Q psy14874        223 TEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQ  302 (1015)
Q Consensus       223 ~~~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~t~L~~A~~~~~~~iv~~Ll~~~~~~~~~~~~~~t~l~~A~~~~~  302 (1015)
                      .+.+|+|.|+..|+.+++.+|+.+|+.++..+..+.||+|.|+..+..++.++|++++++.........|+++.+...|.
T Consensus       241 ~gl~~lh~a~~~g~~~i~~~l~~~ga~~~~~~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~~~~kt~l~~a~~~g~  320 (1143)
T KOG4177|consen  241 SGLTPLHVAAFMGHLDIVKLLLQHGASVNVSTVRGETPLHMAARAGQVEVCKLLLQNGADVLAKARDDQTPLHIASRLGH  320 (1143)
T ss_pred             cCccHHHHHHhccchhHHHHHHhcccccCcccccccCcchhhhccchhhhHhhhhccCcccccccccccChhhhhcccch
Confidence            66677777777777777777777777777777777777777777777777777777777766666667777777777777


Q ss_pred             HHHHHHHHhcCCCCCCCCCCCCCccccccCCCCCCCHHHHHHhcCCHHHHHHHHhhcCCCcccccccCCccHHHHHHhCC
Q psy14874        303 ADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGG  382 (1015)
Q Consensus       303 ~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~~g~~~~~~~~~~g~tpL~~A~~~g  382 (1015)
                      .+++..+++.+....             .....+.+|+|+++..++.++..++... +.+ .....+.+.+|+|.|+..|
T Consensus       321 ~~i~~~~l~~~~~~~-------------aar~~g~t~lHlaa~~~~~~~~~~l~~~-~~~-~~~a~~k~~~pl~la~~~g  385 (1143)
T KOG4177|consen  321 EEIVHLLLQAGATPN-------------AARTAGYTPLHLAAKEGQVEVAGALLEH-GAQ-RRQAEEKGFTPLHLAVKSG  385 (1143)
T ss_pred             HHHHHHHhhccCCcc-------------ccCcCCcccccHhhhhhhHHHHHHhhcc-ccc-cCcccccCCcchhhhcccC
Confidence            777777776654432             2345567777777777777755555542 222 2234456677777777777


Q ss_pred             CHHHHHHHHHhcchhhcccCCCCCcHHHHHHHcCCHHHHHHHhhCCCCcccCCCCCCCHHHHHHHhC-CHHHHHHHHhcC
Q psy14874        383 HVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYG-HVGIINTLLQKG  461 (1015)
Q Consensus       383 ~~~iv~~Ll~~~~~~~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~ga~i~~~~~~g~t~L~~A~~~g-~~~~v~~Ll~~g  461 (1015)
                      ..++++.++..|.+ .+.....|.||||.|+..++..+++.++++|++++..+..|.||+|+|+..| ..+....+++.|
T Consensus       386 ~~~~v~Lll~~ga~-~~~~gk~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g  464 (1143)
T KOG4177|consen  386 RVSVVELLLEAGAD-PNSAGKNGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYG  464 (1143)
T ss_pred             chhHHHhhhhccCC-cccCCCCCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhcC
Confidence            77777777777776 5666777777777777777777777777777777777777777777777777 666667777777


Q ss_pred             CCCcccccccccCchHHHHHHHHhhhhhhhhcCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCcchh--------------
Q psy14874        462 EKVDVTTNNLACGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINATD--------------  527 (1015)
Q Consensus       462 ~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~--------------  527 (1015)
                      .+++...                          ..|.||||+|+..|+.++++.|++.++..+...              
T Consensus       465 ~~~n~~s--------------------------~~G~T~Lhlaaq~Gh~~~~~llle~~~~~~~~~~~~l~~lhla~~~~  518 (1143)
T KOG4177|consen  465 ADPNAVS--------------------------KQGFTPLHLAAQEGHTEVVQLLLEGGANDNLDAKKGLTPLHLAADED  518 (1143)
T ss_pred             CCcchhc--------------------------cccCcchhhhhccCCchHHHHhhhcCCccCccchhccchhhhhhhhh
Confidence            7666542                          444555555555555555555555443332221              


Q ss_pred             --hHHHhhhhccccccccCCCCCcHHHHHHHcCcHHHHHHHHhcCCccccccccCCCCHHHHHHHcCCHHHHHHHHHcCC
Q psy14874        528 --KVCDALLTHKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGA  605 (1015)
Q Consensus       528 --~~~~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~T~L~~A~~~~~~~iv~~Ll~~ga  605 (1015)
                        ..+..++.++++++.++..|.||||.|+..|+.++|++|++++.+ .+.++..|+||||.||..|+.+|+.+|+++|+
T Consensus       519 ~v~~~~~l~~~ga~v~~~~~r~~TpLh~A~~~g~v~~VkfLLe~gAd-v~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA  597 (1143)
T KOG4177|consen  519 TVKVAKILLEHGANVDLRTGRGYTPLHVAVHYGNVDLVKFLLEHGAD-VNAKDKLGYTPLHQAAQQGHNDIAELLLKHGA  597 (1143)
T ss_pred             hHHHHHHHhhcCCceehhcccccchHHHHHhcCCchHHHHhhhCCcc-ccccCCCCCChhhHHHHcChHHHHHHHHHcCC
Confidence              133444444555577888999999999999999999999987665 47778999999999999999999999999999


Q ss_pred             CCCCCCCCCCCHHHHHHhcCChHHHHHHHHhCCcc
Q psy14874        606 SIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSL  640 (1015)
Q Consensus       606 ~~~~~d~~g~t~l~~A~~~~~~~~~~~ll~~~~~~  640 (1015)
                      ++|..|.+|.|||++|+..++.++++.+...+...
T Consensus       598 ~vna~d~~g~TpL~iA~~lg~~~~~k~l~~~~~~~  632 (1143)
T KOG4177|consen  598 SVNAADLDGFTPLHIAVRLGYLSVVKLLKVVTATP  632 (1143)
T ss_pred             CCCcccccCcchhHHHHHhcccchhhHHHhccCcc
Confidence            99999999999999999999999999999877663



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3614|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3614|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF08344 TRP_2: Transient receptor ion channel II; InterPro: IPR013555 TRP (transient receptor potential) channels can be described as tetramers formed by subunits with six transmembrane domains and containing cation-selective pores, which in several cases show high calcium permeability Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
>KOG3599|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1015
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-41
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-41
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-40
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-23
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-26
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-25
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-22
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-23
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-18
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-23
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 8e-18
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-17
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-23
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-18
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-22
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-18
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-21
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-20
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-17
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-21
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-18
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-20
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-19
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-16
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-20
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-15
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 8e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-17
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-20
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-19
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-15
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-20
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-15
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-19
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-14
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-19
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-15
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-19
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-15
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 9e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-19
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-16
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-19
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-18
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-16
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-18
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-16
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-09
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-18
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-16
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-18
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-18
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-18
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-15
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-18
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-17
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-18
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-17
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-18
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-17
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-16
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 9e-18
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-17
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-17
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-14
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-12
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-16
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-14
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 8e-15
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 3e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-14
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-12
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 7e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-05
1uoh_A226 Human Gankyrin Length = 226 6e-14
1uoh_A226 Human Gankyrin Length = 226 2e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-08
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-13
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-13
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-13
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-08
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-13
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-13
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-13
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-13
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-10
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 4e-13
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-10
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-13
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 9e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-13
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 7e-13
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 9e-10
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-13
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-09
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 9e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 8e-13
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-09
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 8e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-13
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-10
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-10
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 6e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-10
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-09
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-12
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-08
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 6e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-11
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 7e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 6e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-11
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 1e-10
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-08
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-10
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-10
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-10
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-10
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-10
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-04
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 5e-10
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 5e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 5e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 8e-09
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 6e-10
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-06
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 9e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-04
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-08
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-08
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 6e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-08
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 5e-07
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 7e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 7e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-05
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-07
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 1e-07
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 1e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 7e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 7e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 9e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 1e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 5e-07
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-06
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 5e-07
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 8e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 9e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-06
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 5e-06
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 7e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 8e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 3e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 7e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 6e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 7e-05
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 1e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 3e-04
1ycs_B239 P53-53bp2 Complex Length = 239 5e-04
1sw6_A327 S. Cerevisiae Swi6 Ankyrin-Repeat Fragment Length = 6e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 7e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 8e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 169 bits (427), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 130/404 (32%), Positives = 206/404 (50%), Gaps = 25/404 (6%) Query: 23 TPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINS 82 TPL +A GH+ +V +L A +V + + + LH+AA G+ +V LL +KA +N+ Sbjct: 16 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 75 Query: 83 KSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLD 142 K++ +T LH AA G+ ++ + L+ ++A ++ T TPLH+AA G ++ LL+ Sbjct: 76 KAKDDQTPLHCAARIGHTNMVKLLLENNANP-NLATTAGHTPLHIAAREGHVETVLALLE 134 Query: 143 LGASIDATDDQGQKPIHVAAQNNFPEVAQIFLR--AHPSLVTATTKDGNTCAHIAAMQGS 200 AS +G P+HVAA+ VA++ L AHP+ A K+G T H+A + Sbjct: 135 KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN---AAGKNGLTPLHVAVHHNN 191 Query: 201 VGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTA 260 + +++ L+ S A N TPL +AA+ V R L++ G S E+ G T Sbjct: 192 LDIVKLLLPRGGSPHSPAWNGY---TPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP 248 Query: 261 VHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSD 320 +HLAAQ GH +++ + S +A K G+T LH+ A G L+ H Sbjct: 249 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH-------- 300 Query: 321 PPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACF 380 + + + G TPLH+A++ GN +V+ LL V+A+T+ GY+PLH A Sbjct: 301 -----GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQA-DVNAKTKL-GYSPLHQAAQ 353 Query: 381 GGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVL 424 GH +V LLL A +G T L IA G++ + +VL Sbjct: 354 QGHTDIVTLLLKNGAS-PNEVSSDGTTPLAIAKRLGYISVTDVL 396
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1SW6|A Chain A, S. Cerevisiae Swi6 Ankyrin-Repeat Fragment Length = 327 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1015
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-115
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-113
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-111
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-65
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-83
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-79
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-77
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-64
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-51
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-49
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-77
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-77
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-74
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-72
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-72
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-70
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-57
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-50
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-42
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-31
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-72
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-70
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-65
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-65
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-53
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-72
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-65
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-58
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-57
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-70
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-61
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-60
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-57
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-53
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-32
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-68
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-63
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-60
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-56
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-53
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-68
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-61
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-60
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-57
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-53
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-44
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-68
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-61
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-60
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-55
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-48
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-36
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-33
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-67
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-59
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-54
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-50
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-48
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-48
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-63
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-60
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-52
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-50
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-38
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-63
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-60
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-50
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-45
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-44
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-40
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-30
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-62
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-56
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-54
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-50
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-53
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-51
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-50
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-50
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-59
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-50
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-49
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-45
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-44
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-40
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-35
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-54
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-53
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-51
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-50
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-47
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-43
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-42
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-42
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-41
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-38
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-52
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-46
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-46
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-43
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-37
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-36
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-34
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-51
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-47
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-47
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-44
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-50
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-49
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-43
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-35
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-50
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-45
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-39
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-35
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-50
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-48
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-40
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-37
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-35
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-30
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-20
2rfa_A232 Transient receptor potential cation channel subfa 4e-50
2rfa_A232 Transient receptor potential cation channel subfa 2e-46
2rfa_A232 Transient receptor potential cation channel subfa 1e-42
2rfa_A232 Transient receptor potential cation channel subfa 4e-38
2rfa_A232 Transient receptor potential cation channel subfa 5e-37
2rfa_A232 Transient receptor potential cation channel subfa 5e-26
2rfa_A232 Transient receptor potential cation channel subfa 3e-16
2rfa_A232 Transient receptor potential cation channel subfa 9e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-47
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-39
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-37
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-35
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-33
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-47
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-43
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-39
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-38
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-42
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-36
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-46
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-38
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-35
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-43
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-43
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-39
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-37
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-35
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-32
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-33
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-33
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-42
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-34
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-31
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-29
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-42
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-40
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-37
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-35
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-26
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-41
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-40
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-36
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 4e-41
2pnn_A273 Transient receptor potential cation channel subfa 6e-41
2pnn_A273 Transient receptor potential cation channel subfa 3e-35
2pnn_A273 Transient receptor potential cation channel subfa 7e-34
2pnn_A273 Transient receptor potential cation channel subfa 6e-30
2pnn_A273 Transient receptor potential cation channel subfa 1e-24
2pnn_A273 Transient receptor potential cation channel subfa 6e-20
2pnn_A273 Transient receptor potential cation channel subfa 1e-15
2pnn_A273 Transient receptor potential cation channel subfa 6e-12
2pnn_A273 Transient receptor potential cation channel subfa 4e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-34
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-29
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-40
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-40
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-36
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-34
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-33
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-32
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-17
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
2etb_A256 Transient receptor potential cation channel subfam 1e-39
2etb_A256 Transient receptor potential cation channel subfam 4e-37
2etb_A256 Transient receptor potential cation channel subfam 1e-35
2etb_A256 Transient receptor potential cation channel subfam 6e-33
2etb_A256 Transient receptor potential cation channel subfam 8e-33
2etb_A256 Transient receptor potential cation channel subfam 3e-27
2etb_A256 Transient receptor potential cation channel subfam 7e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-39
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-35
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-35
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-39
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-28
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-36
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-33
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-27
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-34
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-34
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-32
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-32
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-32
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-34
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-27
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-32
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-20
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-30
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-28
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  359 bits (925), Expect = e-115
 Identities = 142/547 (25%), Positives = 219/547 (40%), Gaps = 116/547 (21%)

Query: 76  HKAFINSKSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQ 135
                      G T LH+A+  G+  + + L+    A  ++  ++ +TPLH+AA AG  +
Sbjct: 3   PGISGGGGGESGLTPLHVASFMGHLPIVKNLL-QRGASPNVSNVKVETPLHMAARAGHTE 61

Query: 136 VCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIA 195
           V K LL   A ++A     Q P+H AA+     + ++ L  + +     T  G+T     
Sbjct: 62  VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLL-ENNANPNLATTAGHT----- 115

Query: 196 AMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENK 255
                                          PL +AA  GH   V  L++  AS     K
Sbjct: 116 -------------------------------PLHIAAREGHVETVLALLEKEASQACMTK 144

Query: 256 TGFTAVHLAAQNGHNQVLEEMRSSKALNVYSK-KLGVTALHVAAYFGQADTVRELLSHVP 314
            GFT +H+AA+ G  +V E +    A +  +  K G+T LHVA +    D V+ LL    
Sbjct: 145 KGFTPLHVAAKYGKVRVAELLLERDA-HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-- 201

Query: 315 GTVKSDPPTGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNP 374
                    G S      + +G TPLH+AA      V R LL   G   +A++   G  P
Sbjct: 202 ---------GGSP--HSPAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAES-VQGVTP 248

Query: 375 LHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVLLGQGAEINAT 434
           LHLA   GH  +V LLLS+ A+     +K+G T LH+ A  GH+ + +VL+  G  ++AT
Sbjct: 249 LHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDAT 307

Query: 435 DKGGARSIHTAARYGHVGIINTLLQKGEKVDVTTNNLACGHVTVVGLLLSRAADLLQSAD 494
            + G   +H A+ YG++ ++  LLQ    V+                             
Sbjct: 308 TRMGYTPLHVASHYGNIKLVKFLLQHQADVNAK--------------------------T 341

Query: 495 KNGKTCLHIAATHGHLQMVEVLLGQGAEINATDKVCDALLTHKAFINSKSRVGRTALHLA 554
           K G + LH AA  GH  +V +LL  GA  N                      G T L +A
Sbjct: 342 KLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-----------------DGTTPLAIA 384

Query: 555 AMNGYADLCRFL--VHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDD 612
              GY  +   L  V D  + + +    + +                +LD+        D
Sbjct: 385 KRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETV---------DEILDVSE------D 429

Query: 613 QGQKPIH 619
           +G++ I 
Sbjct: 430 EGEELIS 436


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1015
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.77
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.76
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.58
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3.9e-56  Score=515.83  Aligned_cols=395  Identities=33%  Similarity=0.479  Sum_probs=332.1

Q ss_pred             hhccCCCCCCcHHHHHHhcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHH
Q psy14874         13 ALNKQTSIGWTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALH   92 (1015)
Q Consensus        13 ~~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~ga~in~~~~~g~t~L~   92 (1015)
                      .+|..+..|+||||.||..|+.++|++|+++|++++..+..|.||||+|+..|+.+++++|+++|++++.++..|.||||
T Consensus         6 ~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~   85 (437)
T 1n11_A            6 SGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLH   85 (437)
T ss_dssp             ---------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHH
T ss_pred             CccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHH
Confidence            46788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCHHHHHHHHhccCccccccccCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCChHHHHH
Q psy14874         93 LAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQI  172 (1015)
Q Consensus        93 ~A~~~g~~eiv~~Ll~~~~~~i~~~~~~g~t~L~~Aa~~g~~~ivk~Ll~~gad~n~~d~~~~t~L~~A~~~g~~~iv~~  172 (1015)
                      +|+..|+.+++++|++ .+++++..+..|.||||+|+..|+.+++++|++.|++.+..+..|.||||+|+..|+.+++++
T Consensus        86 ~A~~~g~~~~v~~Ll~-~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~  164 (437)
T 1n11_A           86 CAARIGHTNMVKLLLE-NNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEL  164 (437)
T ss_dssp             HHHHHTCHHHHHHHHH-HTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHH
T ss_pred             HHHHCCCHHHHHHHHh-CCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHH
Confidence            9999999999999995 578889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcCCCCcccCCCCCchHHHHHHHcCCHHHHHHHHhcCCcccccccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCC
Q psy14874        173 FLRAHPSLVTATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTD  252 (1015)
Q Consensus       173 Ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~ga~~~~  252 (1015)
                      |++++.+ .+..+..|.||||+|+..|+.+++++|++.+....   ..+..+.||||.|+..|+.+++++|+++|++++.
T Consensus       165 Ll~~g~~-~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~---~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~  240 (437)
T 1n11_A          165 LLERDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH---SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA  240 (437)
T ss_dssp             HHHTTCC-TTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSC---CCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTC
T ss_pred             HHhCCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC---CcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCC
Confidence            9998876 56677778888888888888887777777655432   2233566777777777777777777777777777


Q ss_pred             CCCCCCCHHHHHHHcCCHHHHHHHHhCCCccccccccCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCCccccccC
Q psy14874        253 ENKTGFTAVHLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELG  332 (1015)
Q Consensus       253 ~~~~~~t~L~~A~~~~~~~iv~~Ll~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~  332 (1015)
                      .+..|.|||++|+..|+.+++++|++.+++...                                              .
T Consensus       241 ~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~----------------------------------------------~  274 (437)
T 1n11_A          241 ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL----------------------------------------------G  274 (437)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTC----------------------------------------------C
T ss_pred             CCCCCCCHHHHHHHCCCHHHHHHHHhcCCCCCC----------------------------------------------C
Confidence            777777777777777777777776665543222                                              2


Q ss_pred             CCCCCCHHHHHHhcCCHHHHHHHHhhcCCCcccccccCCccHHHHHHhCCCHHHHHHHHHhcchhhcccCCCCCcHHHHH
Q psy14874        333 SESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIA  412 (1015)
Q Consensus       333 ~~~~~t~L~~A~~~g~~~~v~~Ll~~~g~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~L~~A  412 (1015)
                      +..|.||||+|+..|+.+++++|++. |.+++.. +..|.||||+|+..|+.+++++|+++|++ ++..+..|.||||+|
T Consensus       275 ~~~g~t~L~~A~~~~~~~~~~~Ll~~-g~~~~~~-~~~g~t~L~~A~~~g~~~~v~~Ll~~gad-~n~~~~~g~t~L~~A  351 (437)
T 1n11_A          275 NKSGLTPLHLVAQEGHVPVADVLIKH-GVMVDAT-TRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQA  351 (437)
T ss_dssp             CTTCCCHHHHHHHHTCHHHHHHHHHH-TCCTTCC-CSSCCCHHHHHHHSSCSHHHHHHHHTTCC-TTCCCTTSCCHHHHH
T ss_pred             CCCCCCHHHHHHHcCCHHHHHHHHhC-CccCCCC-CCCCCCHHHHHHHcCcHHHHHHHHhcCCC-CCCCCCCCCCHHHHH
Confidence            34577888888888888888888864 7777754 56789999999999999999999999988 678899999999999


Q ss_pred             HHcCCHHHHHHHhhCCCCcccCCCCCCCHHHHHHHhCCHHHHHHHHhcC
Q psy14874        413 ATHGHLQMVEVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLLQKG  461 (1015)
Q Consensus       413 ~~~g~~~iv~~Ll~~ga~i~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g  461 (1015)
                      +..|+.+++++|+++|++++.+|..|.||+++|++.|+.+++++|....
T Consensus       352 ~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~~  400 (437)
T 1n11_A          352 AQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVT  400 (437)
T ss_dssp             HHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHC
T ss_pred             HHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999987654



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1015
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-61
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-55
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-53
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-48
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-38
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-41
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-34
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-32
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-28
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-28
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-27
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.004
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-35
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-35
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-32
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-30
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-30
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-29
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-30
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-28
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-29
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-22
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-27
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-26
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-20
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-24
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-20
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-18
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-16
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.003
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 4e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 5e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  212 bits (540), Expect = 3e-61
 Identities = 124/417 (29%), Positives = 202/417 (48%), Gaps = 24/417 (5%)

Query: 23  TPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINS 82
           TPL +A   GH+ +V  +L   A  +V + +  + LH+AA  G+ +V   LL +KA +N+
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 83  KSRVGRTALHLAAMNGYADLCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLD 142
           K++  +T LH AA  G+ ++ + L+ ++ A  ++ T    TPLH+AA  G ++    LL+
Sbjct: 62  KAKDDQTPLHCAARIGHTNMVKLLL-ENNANPNLATTAGHTPLHIAAREGHVETVLALLE 120

Query: 143 LGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLVTATTKDGNTCAHIAAMQGSVG 202
             AS      +G  P+HVAA+     VA++ L    +   A  K+G T  H+A    ++ 
Sbjct: 121 KEASQACMTKKGFTPLHVAAKYGKVRVAELLLE-RDAHPNAAGKNGLTPLHVAVHHNNLD 179

Query: 203 VIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAVH 262
           +++ L+   R G   +       TPL +AA+     V R L++ G S   E+  G T +H
Sbjct: 180 IVKLLL--PRGGSPHSPAW-NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLH 236

Query: 263 LAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPP 322
           LAAQ GH +++  + S +A      K G+T LH+ A  G       L+ H          
Sbjct: 237 LAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH---------- 286

Query: 323 TGASFLGELGSESGMTPLHLAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGG 382
            G     +  +  G TPLH+A++ GN  +V+               + GY+PLH A   G
Sbjct: 287 -GVMV--DATTRMGYTPLHVASHYGNIKLVK--FLLQHQADVNAKTKLGYSPLHQAAQQG 341

Query: 383 HVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMVEVL---LGQGAEINATDK 436
           H  +V LLL   A        +G T L IA   G++ + +VL     + + +  +DK
Sbjct: 342 HTDIVTLLLKNGAS-PNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDK 397


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1015
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.78
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.8e-46  Score=423.39  Aligned_cols=383  Identities=34%  Similarity=0.494  Sum_probs=327.5

Q ss_pred             CcHHHHHHhcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHH
Q psy14874         22 WTPLLIACNRGHMELVNTMLNNHARVDVFDQEGRSALHLAAEHGYLKVCDALLTHKAFINSKSRVGRTALHLAAMNGYAD  101 (1015)
Q Consensus        22 ~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~ga~in~~~~~g~t~L~~A~~~g~~e  101 (1015)
                      .||||+||..|+.++|++|+++|+++|..|..|+||||+|+..|+.++|++|+++|++++.++..|.||||+|+..|+.+
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~   80 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN   80 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHH
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHH
Confidence            39999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccCccccccccCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCChHHHHHHhhcCCCCc
Q psy14874        102 LCRFLVHDHAAVIDILTLRKQTPLHLAAEAGQLQVCKLLLDLGASIDATDDQGQKPIHVAAQNNFPEVAQIFLRAHPSLV  181 (1015)
Q Consensus       102 iv~~Ll~~~~~~i~~~~~~g~t~L~~Aa~~g~~~ivk~Ll~~gad~n~~d~~~~t~L~~A~~~g~~~iv~~Ll~~~~~~~  181 (1015)
                      ++++|+.. ............+++..+...+...........+...+..+..+.++++.|+..++.+++++|++.+.+ .
T Consensus        81 ~~~~Ll~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~-~  158 (408)
T d1n11a_          81 MVKLLLEN-NANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-P  158 (408)
T ss_dssp             HHHHHHHH-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-T
T ss_pred             HHHHHHHh-hhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCC-C
Confidence            99999954 445566667778899999999999988888888888888888888999999998888888888887665 2


Q ss_pred             ccCCCCCchHHHHHHHcCCHHHHHHHHhcCCcccccccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHH
Q psy14874        182 TATTKDGNTCAHIAAMQGSVGVIEELMKFDRSGVISARNRVTEATPLQLAAEGGHANVVRVLVKAGASCTDENKTGFTAV  261 (1015)
Q Consensus       182 ~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~t~L  261 (1015)
                      +..+.                                    .+.+||+.|+..|+.+++++|+++|++++..+..|.||+
T Consensus       159 ~~~~~------------------------------------~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l  202 (408)
T d1n11a_         159 NAAGK------------------------------------NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPL  202 (408)
T ss_dssp             TCCCS------------------------------------SCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHH
T ss_pred             CcCCC------------------------------------cCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcc
Confidence            33333                                    344666667777777777777777888888888888888


Q ss_pred             HHHHHcCCHHHHHHHHhCCCccccccccCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCCccccccCCCCCCCHHH
Q psy14874        262 HLAAQNGHNQVLEEMRSSKALNVYSKKLGVTALHVAAYFGQADTVRELLSHVPGTVKSDPPTGASFLGELGSESGMTPLH  341 (1015)
Q Consensus       262 ~~A~~~~~~~iv~~Ll~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~  341 (1015)
                      +.+....+.+....++.........+..+.||++.|+..++.++++.+........             ..+..|.+|++
T Consensus       203 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~-------------~~~~~g~~~l~  269 (408)
T d1n11a_         203 HIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN-------------LGNKSGLTPLH  269 (408)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTT-------------CCCTTCCCHHH
T ss_pred             hhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhccccccc-------------cccCCCCChhh
Confidence            88888888888888887777666667777888888888888888888877643322             23456889999


Q ss_pred             HHHhcCCHHHHHHHHhhcCCCcccccccCCccHHHHHHhCCCHHHHHHHHHhcchhhcccCCCCCcHHHHHHHcCCHHHH
Q psy14874        342 LAAYSGNENVVRLLLNSAGVQVDAQTQENGYNPLHLACFGGHVTVVGLLLSRAADLLQSADKNGKTCLHIAATHGHLQMV  421 (1015)
Q Consensus       342 ~A~~~g~~~~v~~Ll~~~g~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~L~~A~~~g~~~iv  421 (1015)
                      .|+..++.+++++|++ .|++++.. ...+.||||.++..++.++++++++.|++ ++.+|..|.||||.|++.|+.++|
T Consensus       270 ~a~~~~~~~i~~~Ll~-~g~~~~~~-~~~~~t~L~~~~~~~~~~~~~~ll~~g~~-in~~d~~G~T~Lh~A~~~g~~~iv  346 (408)
T d1n11a_         270 LVAQEGHVPVADVLIK-HGVMVDAT-TRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIV  346 (408)
T ss_dssp             HHHHHTCHHHHHHHHH-HTCCTTCC-CSSCCCHHHHHHHSSCSHHHHHHHHTTCC-TTCCCTTSCCHHHHHHHTTCHHHH
T ss_pred             hhhhcCcHHHHHHHHH-CCCccccc-cccccccchhhcccCcceeeeeecccccc-ccccCCCCCCHHHHHHHcCCHHHH
Confidence            9999999999999997 48888754 45688999999999999999999999988 688899999999999999999999


Q ss_pred             HHHhhCCCCcccCCCCCCCHHHHHHHhCCHHHHHHHH
Q psy14874        422 EVLLGQGAEINATDKGGARSIHTAARYGHVGIINTLL  458 (1015)
Q Consensus       422 ~~Ll~~ga~i~~~~~~g~t~L~~A~~~g~~~~v~~Ll  458 (1015)
                      ++|+++||++|.+|.+|.||||+|++.|+.+++++|.
T Consensus       347 ~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~L~  383 (408)
T d1n11a_         347 TLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLK  383 (408)
T ss_dssp             HHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            9999999999999999999999999999999988654



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure