Psyllid ID: psy14882
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 743 | ||||||
| 242009414 | 950 | conserved hypothetical protein [Pediculu | 0.390 | 0.305 | 0.614 | 1e-123 | |
| 385258475 | 988 | chitinase [Plutella xylostella] | 0.370 | 0.278 | 0.613 | 1e-119 | |
| 193690615 | 998 | PREDICTED: hypothetical protein LOC10016 | 0.394 | 0.293 | 0.585 | 1e-119 | |
| 391226659 | 987 | chitinase 7 [Spodoptera exigua] | 0.366 | 0.275 | 0.607 | 1e-117 | |
| 389614581 | 412 | chitinase 7, partial [Papilio polytes] | 0.384 | 0.694 | 0.596 | 1e-117 | |
| 357628787 | 768 | hypothetical protein KGM_22454 [Danaus p | 0.399 | 0.386 | 0.568 | 1e-116 | |
| 332020739 | 987 | Putative chitinase 3 [Acromyrmex echinat | 0.387 | 0.291 | 0.575 | 1e-114 | |
| 158286667 | 1017 | AGAP006898-PA [Anopheles gambiae str. PE | 0.394 | 0.288 | 0.556 | 1e-114 | |
| 111608523 | 445 | chitinase [Helicoverpa assulta] | 0.327 | 0.546 | 0.804 | 1e-114 | |
| 312378809 | 1022 | hypothetical protein AND_09539 [Anophele | 0.362 | 0.263 | 0.591 | 1e-114 |
| >gi|242009414|ref|XP_002425481.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509328|gb|EEB12743.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 449 bits (1155), Expect = e-123, Method: Compositional matrix adjust.
Identities = 231/376 (61%), Positives = 253/376 (67%), Gaps = 86/376 (22%)
Query: 246 QLREAFEAEAQEVKKPRLLLTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWES 305
+LREAFEAEAQEVKKPRLLLTAAVPVGPDNI+ GYDVPAVA YLDFINLMAYDFHGKWE
Sbjct: 199 ELREAFEAEAQEVKKPRLLLTAAVPVGPDNIRSGYDVPAVASYLDFINLMAYDFHGKWER 258
Query: 306 QVGHNAPLRSPSSDSEWRKQLSVENAANMWVRLGAPKEQASFTLVDPTKFDIGAPASGGG 365
+ GHNAPL +PSSDSEWRKQLSVENAA WVRLGAP
Sbjct: 259 ETGHNAPLHAPSSDSEWRKQLSVENAAGTWVRLGAP------------------------ 294
Query: 366 EPGKYTAEAGFMSYYEKYLPKEKLIIGMPTYGRTFTLTNPAVFKVNSPASGGGKAGEYTI 425
K+KLIIGMPTYGRTFTL+NP V+KVNSPASGGGKAGE
Sbjct: 295 --------------------KDKLIIGMPTYGRTFTLSNPKVYKVNSPASGGGKAGE--- 331
Query: 426 SKEKLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCEMLRNGAG 485
YT E GF++YYE+CEMLR GA
Sbjct: 332 --------------------------------------YTKEGGFLAYYEICEMLRKGAS 353
Query: 486 YVWDDEMKVPYLVHGDQWVGFDDEKSIRYKMNWLKDNGYGGAMVWTVDMDDFTGTVCGGD 545
Y+WDDEMKVPYLV GDQWVGFDDEKSIR+KM WLK NG+GGAMVWTVDMDDFTGT+CGG
Sbjct: 354 YIWDDEMKVPYLVDGDQWVGFDDEKSIRHKMKWLKSNGFGGAMVWTVDMDDFTGTICGGK 413
Query: 546 VKYPLIGAMREELNGIPRANNAKDVDWAKVAGNVEVETVTKPAPIKIDVSELLSKKKTTT 605
VKYPLIGAMREEL GIPR NNAKD+DW+KVA ++ + KP PIKIDVS+LLSK K T
Sbjct: 414 VKYPLIGAMREELLGIPRENNAKDIDWSKVANSIVEVNIEKPEPIKIDVSDLLSKFKKPT 473
Query: 606 IQKQETSNLIDTKAAR 621
K N+I + R
Sbjct: 474 KAKT-VENVITSTNER 488
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|385258475|gb|AFI55112.1| chitinase [Plutella xylostella] | Back alignment and taxonomy information |
|---|
| >gi|193690615|ref|XP_001950380.1| PREDICTED: hypothetical protein LOC100165452 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|391226659|gb|AFM38213.1| chitinase 7 [Spodoptera exigua] | Back alignment and taxonomy information |
|---|
| >gi|389614581|dbj|BAM20331.1| chitinase 7, partial [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|357628787|gb|EHJ77971.1| hypothetical protein KGM_22454 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|332020739|gb|EGI61144.1| Putative chitinase 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|158286667|ref|XP_308858.4| AGAP006898-PA [Anopheles gambiae str. PEST] gi|157020578|gb|EAA04006.4| AGAP006898-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|111608523|gb|ABH10948.1| chitinase [Helicoverpa assulta] | Back alignment and taxonomy information |
|---|
| >gi|312378809|gb|EFR25277.1| hypothetical protein AND_09539 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 743 | ||||||
| FB|FBgn0035398 | 1013 | Cht7 "Cht7" [Drosophila melano | 0.345 | 0.253 | 0.7 | 1e-174 | |
| UNIPROTKB|E2R8B1 | 483 | CHIA "Uncharacterized protein" | 0.281 | 0.432 | 0.502 | 1.8e-97 | |
| UNIPROTKB|F1MH27 | 472 | CHIA "Acidic mammalian chitina | 0.281 | 0.442 | 0.484 | 1.4e-95 | |
| UNIPROTKB|Q95M17 | 472 | CHIA "Acidic mammalian chitina | 0.281 | 0.442 | 0.488 | 2.3e-95 | |
| RGD|1303058 | 473 | Chia "chitinase, acidic" [Ratt | 0.270 | 0.424 | 0.521 | 3.8e-95 | |
| ZFIN|ZDB-GENE-030131-1140 | 500 | chia.6 "chitinase, acidic.6" [ | 0.279 | 0.416 | 0.525 | 1.6e-94 | |
| UNIPROTKB|I3LL32 | 477 | CHIA "Uncharacterized protein" | 0.279 | 0.436 | 0.465 | 1.6e-94 | |
| MGI|MGI:1932052 | 473 | Chia "chitinase, acidic" [Mus | 0.270 | 0.424 | 0.516 | 1.1e-93 | |
| UNIPROTKB|F1NM30 | 481 | CHIA "Uncharacterized protein" | 0.277 | 0.428 | 0.486 | 1.1e-93 | |
| UNIPROTKB|F1NMM2 | 482 | CHIA "Uncharacterized protein" | 0.277 | 0.427 | 0.486 | 1.1e-93 |
| FB|FBgn0035398 Cht7 "Cht7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 998 (356.4 bits), Expect = 1.0e-174, Sum P(4) = 1.0e-174
Identities = 189/270 (70%), Positives = 219/270 (81%)
Query: 29 EVVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKLSSFESNDETKDGKVGL 88
++VCYYTNWSQYR KIGKF PEDI DLCTHIIFAFGWLKK KLSS+ESNDETKD GL
Sbjct: 124 KIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPGL 183
Query: 89 YERIEQLKKANPKLKTLLAIGGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLD 148
YER+ LKKANPKLK LLA+GGWSFGTQKFK+MS +RY+RQTF+YSA+PFLR+R FDGLD
Sbjct: 184 YERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLD 243
Query: 149 IDWEYPAGTDDKKNYVLLLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKGGYDVPAV 208
+DWEYP G+DDKKN+VLLLKELREAFEAEAQE+KKPRLLL+AAVPVGPDNI+GGYDVPA+
Sbjct: 244 MDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAI 303
Query: 209 AGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQLREAFEAEAQ---EVKKPRLLL 265
A YLDFINLMAYDFHGKWE + GHNAPL +PS+DSEW+ + + + A ++ P+ L
Sbjct: 304 ASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKL 363
Query: 266 TAAVPV--------GPDNIKGGYDVPAVAG 287
+P PD K G + PA G
Sbjct: 364 VIGMPTYGRSFTLANPD--KHGPNAPASGG 391
|
|
| UNIPROTKB|E2R8B1 CHIA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MH27 CHIA "Acidic mammalian chitinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q95M17 CHIA "Acidic mammalian chitinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1303058 Chia "chitinase, acidic" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1140 chia.6 "chitinase, acidic.6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LL32 CHIA "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1932052 Chia "chitinase, acidic" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NM30 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMM2 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 743 | |||
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-113 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-113 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 3e-78 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 7e-67 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 1e-62 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 5e-61 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 8e-49 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 2e-47 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 2e-46 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 1e-39 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 1e-26 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 3e-23 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-22 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 1e-18 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 5e-18 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 1e-16 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-14 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 9e-12 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 6e-10 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 6e-09 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 1e-08 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 5e-08 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 2e-07 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 6e-07 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 8e-07 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 2e-06 | |
| cd02871 | 312 | cd02871, GH18_chitinase_D-like, GH18 domain of Chi | 1e-05 | |
| cd06549 | 298 | cd06549, GH18_trifunctional, GH18 domain of an unc | 1e-05 | |
| cd02876 | 318 | cd02876, GH18_SI-CLP, Stabilin-1 interacting chiti | 1e-05 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 9e-05 | |
| cd06544 | 253 | cd06544, GH18_narbonin, Narbonin is a plant 2S pro | 2e-04 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 0.001 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 0.003 |
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
Score = 347 bits (892), Expect = e-113
Identities = 125/221 (56%), Positives = 153/221 (69%), Gaps = 11/221 (4%)
Query: 30 VVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKLSSFESNDETKDGKVGLY 89
VVCY+TNW+QYR GKF PE+I+P LCTHII+AF L + DE D +GLY
Sbjct: 1 VVCYFTNWAQYRPGNGKFVPENIDPFLCTHIIYAFAGL--NPDGNIIILDEWNDIDLGLY 58
Query: 90 ERIEQLKKANPKLKTLLAIGGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLDI 149
ER LK+ NP LKTLLAIGGW+FG+ KF M+ S +R+TFI SA+ FLR+ FDGLD+
Sbjct: 59 ERFNALKEKNPNLKTLLAIGGWNFGSAKFSAMAASPENRKTFIKSAIAFLRKYGFDGLDL 118
Query: 150 DWEYPAG----TDDKKNYVLLLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKGGYDV 205
DWEYP +DK+N+V LLKELREAFE EA PRLLLTAAV G + I YD+
Sbjct: 119 DWEYPGQRGGPPEDKENFVTLLKELREAFEPEA-----PRLLLTAAVSAGKETIDAAYDI 173
Query: 206 PAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQ 246
P ++ YLDFIN+M YDFHG WE GHN+PL + S+D+ Q
Sbjct: 174 PEISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQ 214
|
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362 |
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119350 cd02871, GH18_chitinase_D-like, GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >gnl|CDD|119366 cd06549, GH18_trifunctional, GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|119355 cd02876, GH18_SI-CLP, Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119361 cd06544, GH18_narbonin, Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 743 | |||
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| KOG2806|consensus | 432 | 100.0 | ||
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 100.0 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 100.0 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 100.0 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 100.0 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 100.0 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 100.0 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 100.0 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 99.98 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 99.97 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 99.96 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.96 | |
| KOG2091|consensus | 392 | 99.91 | ||
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.88 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.83 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.79 | |
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 99.52 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 99.07 | |
| KOG2806|consensus | 432 | 99.06 | ||
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 98.85 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 98.78 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 98.73 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 98.71 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 98.69 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 98.34 | |
| KOG4701|consensus | 568 | 98.34 | ||
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 98.24 | |
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 98.23 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 98.19 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 97.96 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 97.75 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 97.72 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 97.71 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 97.25 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 96.92 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 96.46 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 95.3 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 94.88 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 94.68 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 92.15 | |
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 88.94 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 87.05 | |
| TIGR01370 | 315 | cysRS possible cysteinyl-tRNA synthetase, Methanoc | 86.22 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 85.13 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 84.25 | |
| KOG2331|consensus | 526 | 80.96 | ||
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 80.52 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 80.22 |
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-69 Score=592.41 Aligned_cols=357 Identities=58% Similarity=1.076 Sum_probs=299.4
Q ss_pred EEEEEeCCccccccCCCCCCCCCCCCCccEEEEeeEEeeCCCe-eeccCCCccccchhhHHHHHHHHHHhCCCcEEEEEE
Q psy14882 30 VVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKL-SSFESNDETKDGKVGLYERIEQLKKANPKLKTLLAI 108 (743)
Q Consensus 30 VvgYy~~W~~~~~~~~~f~~~~Ip~~~~THIiyaFa~i~~~~~-~sf~~~~~~~d~~~g~~~~l~~LK~~nP~lKVllSI 108 (743)
|+|||++|+.++++.+.|.+++||+++||||+|+|+.+++.+. ...+. ..+...+.++++.+||++||++|||+||
T Consensus 1 v~~y~~~w~~~~~~~~~~~~~~i~~~~~Thv~y~f~~i~~~g~~~~~~~---~~d~~~~~~~~~~~lk~~~p~lkvlisi 77 (362)
T cd02872 1 VVCYFTNWAQYRPGNGKFVPENIDPFLCTHIIYAFAGLNPDGNIIILDE---WNDIDLGLYERFNALKEKNPNLKTLLAI 77 (362)
T ss_pred CEEEECcchhcCCCCCCcChhHCCcccCCEEEEeeEEECCCCCEEecCc---hhhhhhhHHHHHHHHHhhCCCceEEEEE
Confidence 6899999999998888999999999999999999999988643 33322 1223456789999999999999999999
Q ss_pred cCCCCCchhhhhhcCCHHHHHHHHHHHHHHHHhCCCCeeeeeccCCCC----CccHHHHHHHHHHHHHHHHHHHhhcCCC
Q psy14882 109 GGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLDIDWEYPAG----TDDKKNYVLLLKELREAFEAEAQEVKKP 184 (743)
Q Consensus 109 GGw~~ss~~fs~~ls~~~~R~~FI~sIv~~lk~ygfDGVDIDWEyP~~----~~dk~nfv~LLkeLR~~L~~~~~~~~~~ 184 (743)
|||+.++..|+.++++++.|++||++|+++|++|+|||||||||+|.. ++++++|+.||++||++|++.. +
T Consensus 78 GG~~~~~~~f~~~~~~~~~r~~fi~~iv~~l~~~~~DGidiDwE~p~~~~~~~~d~~~~~~ll~~lr~~l~~~~-----~ 152 (362)
T cd02872 78 GGWNFGSAKFSAMAASPENRKTFIKSAIAFLRKYGFDGLDLDWEYPGQRGGPPEDKENFVTLLKELREAFEPEA-----P 152 (362)
T ss_pred cCCCCCcchhHHHhCCHHHHHHHHHHHHHHHHHcCCCCeeeeeeccccCCCCHHHHHHHHHHHHHHHHHHHhhC-----c
Confidence 999987778999999999999999999999999999999999999974 4789999999999999998752 4
Q ss_pred cEEEEEeccCCCCCCCCCCCccccccccceEEeeeccCCCCCCcccccCCCCCCCCCchHHHHHHHHHHHHHhcccccce
Q psy14882 185 RLLLTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQLREAFEAEAQEVKKPRLL 264 (743)
Q Consensus 185 ~~lLSiAvpa~~~~~~~~yd~~~L~~~vDfInlMtYD~~G~w~~~~g~~Spl~~~~~~~~~~lr~~~~~~~~~~~~~~~~ 264 (743)
+++||+++|+.+..+...||+++|.++
T Consensus 153 ~~~ls~av~~~~~~~~~~~d~~~l~~~----------------------------------------------------- 179 (362)
T cd02872 153 RLLLTAAVSAGKETIDAAYDIPEISKY----------------------------------------------------- 179 (362)
T ss_pred CeEEEEEecCChHHHhhcCCHHHHhhh-----------------------------------------------------
Confidence 799999999865444334555555554
Q ss_pred eeeecCCCCCCCcCcccccccccchheeehhhccCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCccc
Q psy14882 265 LTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWRKQLSVENAANMWVRLGAPKEQ 344 (743)
Q Consensus 265 lt~a~~~~~~~~~~~~d~~~l~~~vD~iniMtYD~~g~w~~~tGh~apL~~~~~~~~~~~~~~v~~av~~w~~~G~p~~~ 344 (743)
+||||+||||+||.|...+||+|||+....+......++++.+|+.|++.|+|
T Consensus 180 ------------------------vD~v~vmtYD~~~~~~~~~g~~spl~~~~~~~~~~~~~~v~~~v~~~~~~gvp--- 232 (362)
T cd02872 180 ------------------------LDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAP--- 232 (362)
T ss_pred ------------------------cceEEEecccCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCC---
Confidence 45555555555555655788888888766554334567899999999999988
Q ss_pred ccccccCCCcccCCCCCCCCCCCCcccccchhhhhhhhcCCCCceEEeeccccccccccCCCccccCCCCCCCCCCCccc
Q psy14882 345 ASFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEKYLPKEKLIIGMPTYGRTFTLTNPAVFKVNSPASGGGKAGEYT 424 (743)
Q Consensus 345 ~~~~~~d~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~v~~~KLvLGlp~YGr~w~l~~~~~~~~~~p~~g~g~~g~~~ 424 (743)
++||+||||+|||.|++.++.+.+
T Consensus 233 -----------------------------------------~~KlvlGlp~YG~~~~~~~~~~~~--------------- 256 (362)
T cd02872 233 -----------------------------------------PEKLVLGIPTYGRSFTLASPSNTG--------------- 256 (362)
T ss_pred -----------------------------------------HHHeEeccccccceeeecCCccCC---------------
Confidence 999999999999999987654332
Q ss_pred ccccccccCCCCcCCcccccCCCCCCCCCCCCCCCCCCcccccCccccHHHHHHHhhCCceEEecCCCceeEEEeCCEEE
Q psy14882 425 ISKEKLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCEMLRNGAGYVWDDEMKVPYLVHGDQWV 504 (743)
Q Consensus 425 ~~~~k~~~g~~~~g~~~~~~~p~~~~~g~~~~~~~~~g~~~~~~G~l~Y~ei~~~~~~g~~~~wD~~a~~py~~~~~~~I 504 (743)
+|++..+.+.+|.++.+.|.++|.|||+.+.+++...||+.+++||++++++||
T Consensus 257 --------------------------~g~~~~g~~~~g~~~~~~g~~~y~ei~~~~~~~~~~~~D~~~~~~y~~~~~~~v 310 (362)
T cd02872 257 --------------------------VGAPASGPGTAGPYTREAGFLAYYEICEFLKSGWTVVWDDEQKVPYAYKGNQWV 310 (362)
T ss_pred --------------------------CCCccCCCCCCCCCcCCCccchHHHHHHhhcCCcEEEEeCCcceeEEEECCEEE
Confidence 344455556667777899999999999877668999999999999999999999
Q ss_pred EeCCHHHHHHHHHHHHHcCCceEEEEeccCCCCCCcccCCCCCcchHHHHHHHh
Q psy14882 505 GFDDEKSIRYKMNWLKDNGYGGAMVWTVDMDDFTGTVCGGDVKYPLIGAMREEL 558 (743)
Q Consensus 505 sYDd~~Si~~K~~yak~~gLgGv~vW~L~~Dd~~g~~cg~~~~~pll~a~~~~l 558 (743)
+|||++||+.|++||+++||||+|+|+|++||+.|. ||.+ .|||+++|++.|
T Consensus 311 ~ydd~~Si~~K~~~~~~~~lgGv~iW~l~~DD~~g~-cg~~-~~pLl~~i~~~~ 362 (362)
T cd02872 311 GYDDEESIALKVQYLKSKGLGGAMVWSIDLDDFRGT-CGQG-KYPLLNAINRAL 362 (362)
T ss_pred EeCCHHHHHHHHHHHHhCCCceEEEEeeecCcCCCc-cCCC-CCcHHHHHHHhC
Confidence 999999999999999999999999999999999997 9875 799999999875
|
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la |
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >KOG2091|consensus | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >KOG4701|consensus | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG2331|consensus | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 743 | ||||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 3e-63 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 4e-47 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 3e-63 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 2e-47 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 3e-63 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 3e-47 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 3e-63 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 3e-47 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 8e-63 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 4e-47 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 4e-61 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 2e-51 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 4e-61 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 3e-51 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 2e-52 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 6e-39 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 2e-52 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 1e-41 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 4e-52 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 3e-41 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 5e-52 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 8e-38 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 2e-51 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 5e-38 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 4e-51 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 9e-38 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 4e-51 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 7e-38 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 5e-51 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-37 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 2e-50 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 3e-37 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 5e-50 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 4e-40 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 1e-48 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 2e-39 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 2e-44 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 3e-40 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 2e-30 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 2e-07 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 3e-30 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 3e-05 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 5e-30 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 2e-07 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 7e-30 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 2e-07 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 1e-29 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 1e-14 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 1e-29 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 1e-05 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 4e-29 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 2e-05 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 1e-27 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 1e-15 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 1e-24 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 2e-13 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 2e-24 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 2e-13 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 1e-20 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 7e-05 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 1e-18 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 1e-05 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 1e-18 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 1e-05 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 1e-18 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 1e-05 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 3e-18 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 2e-05 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 4e-18 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 2e-05 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 9e-18 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 2e-05 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 1e-17 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 1e-05 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 1e-17 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 2e-05 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 3e-17 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 2e-05 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 3e-17 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 2e-05 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 6e-17 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 1e-07 | ||
| 3qok_A | 420 | Crystal Structure Of Putative Chitinase Ii From Kle | 6e-17 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 3e-16 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 1e-07 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 5e-16 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 2e-13 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 5e-16 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 1e-13 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 5e-16 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 1e-13 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 1e-15 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 2e-13 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 2e-15 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 2e-13 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 2e-15 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 2e-13 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 2e-15 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 1e-13 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 2e-15 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 1e-07 | ||
| 4dws_C | 546 | Crystal Structure Of A Chitinase From The Yersinia | 3e-15 | ||
| 4dws_D | 546 | Crystal Structure Of A Chitinase From The Yersinia | 3e-15 | ||
| 4dws_A | 546 | Crystal Structure Of A Chitinase From The Yersinia | 5e-15 | ||
| 4dws_B | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-14 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 2e-14 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 3e-05 | ||
| 4a5q_A | 546 | Crystal Structure Of The Chitinase Chi1 Fitted Into | 3e-09 | ||
| 3oa5_A | 574 | The Structure Of Chi1, A Chitinase From Yersinia En | 3e-09 | ||
| 3cz8_A | 319 | Crystal Structure Of Putative Sporulation-Specific | 2e-04 |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
|
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|4DWS|C Chain C, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|D Chain D, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|A Chain A, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|B Chain B, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|4A5Q|A Chain A, Crystal Structure Of The Chitinase Chi1 Fitted Into The 3d Structure Of The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|3OA5|A Chain A, The Structure Of Chi1, A Chitinase From Yersinia Entomophaga Length = 574 | Back alignment and structure |
| >pdb|3CZ8|A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis Length = 319 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 743 | |||
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 1e-132 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 1e-103 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 1e-94 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 1e-102 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 8e-97 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 1e-102 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 3e-96 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 1e-100 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 1e-100 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 1e-100 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 4e-97 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 1e-94 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 1e-85 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 2e-94 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 8e-93 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 7e-80 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 3e-92 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 8e-73 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 6e-92 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 1e-73 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 9e-92 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 7e-83 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 6e-90 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 2e-72 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 2e-89 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 6e-73 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 3e-84 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 6e-69 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 7e-79 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 1e-62 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 6e-77 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 5e-65 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 6e-75 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 2e-63 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 4e-73 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 7e-46 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 8e-66 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 2e-18 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 4e-05 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 7e-59 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 4e-42 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 3e-47 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 5e-08 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 1e-37 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 4e-36 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 2e-16 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 1e-34 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 5e-07 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 1e-33 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 1e-12 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 2e-07 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 5e-33 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 4e-06 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 1e-30 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 2e-07 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 4e-19 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 8e-19 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 1e-13 |
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
Score = 397 bits (1021), Expect = e-132
Identities = 103/557 (18%), Positives = 180/557 (32%), Gaps = 168/557 (30%)
Query: 30 VVCYYTNWSQYRTKIGKFQPEDIEPDL--CTHIIFAFGWLKKGKLSSFESNDETKDGKVG 87
+VCYY + S R +GK D+E L C+H+++ + L+ L ++ N+ D
Sbjct: 4 LVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENL-DIYKH 62
Query: 88 LYERIEQLKKANPKLKTLLAIGGWSF-----GTQKFKEMSKSRYSRQTFIYSAVPFLRQR 142
+ + LK+ P LK LL++GG + + + + FI SA ++
Sbjct: 63 QFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTY 122
Query: 143 NFDGLDIDWEYPAGTDDKKNYVLLLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKGG 202
FDGLD+ +++P K + L L + P + +
Sbjct: 123 GFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPH------AALHKEQ---- 172
Query: 203 YDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQLREAFEAEAQEVKKPR 262
F L+ ++++ A+
Sbjct: 173 -----------FTALVRD--------------------------VKDSLRADG------- 188
Query: 263 LLLTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWES--QVGHNAPLRSPSSDS 320
LL+ V ++ +D+PA+ G +DF+NL +DF + + ++AP+ P
Sbjct: 189 FLLSLTVLPNVNSTWY-FDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSK 247
Query: 321 EWRKQLSVENAANMWVRLGAPKEQASFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYY 380
+ L+ + W+ G
Sbjct: 248 DRLAHLNADFQVEYWLSQGF---------------------------------------- 267
Query: 381 EKYLPKEKLIIGMPTYGRTFTLTNPAVFKVNSPASGGGKAGEYTISKEKLMIGMPTYGRS 440
P K+ +G+ TYG + LT SG
Sbjct: 268 ----PSNKINLGVATYGNAWKLTKD---------SGLEGVP------------------- 295
Query: 441 FTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCEMLRNGAGYV------------- 487
+ SG G + + G +SY E+C L N
Sbjct: 296 ----------VVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSD 345
Query: 488 ----WDDEMKVPYL--VHGDQWVGFDDEKSIRYKMNWLKDNGYGGAMVWTVDMDDFTGTV 541
+ P + WV +DD S K + + GG ++ + DDF G
Sbjct: 346 PTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQ- 404
Query: 542 CGGDVKYPLIGAMREEL 558
C GD KYP++ A++ L
Sbjct: 405 CSGD-KYPILRAIKYRL 420
|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 743 | |||
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 100.0 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 100.0 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 100.0 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 100.0 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 100.0 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 100.0 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 100.0 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 100.0 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 100.0 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 100.0 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 100.0 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.97 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.95 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.94 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.94 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.94 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.93 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.92 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.9 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.83 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.81 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 99.71 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 99.69 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 99.18 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 99.12 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 99.1 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 99.1 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 99.07 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 99.0 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 98.98 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 98.95 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 98.93 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 98.82 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 98.75 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 98.65 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 98.64 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 98.51 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 98.5 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 98.48 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 98.48 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 98.44 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 98.32 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 98.02 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 97.91 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 97.11 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 96.76 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 96.66 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 96.45 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 96.05 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 95.81 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 95.81 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 94.04 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 93.54 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 89.18 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 87.52 | |
| 2aam_A | 309 | Hypothetical protein TM1410; structural genomics, | 85.14 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 83.8 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 82.86 |
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-77 Score=654.52 Aligned_cols=364 Identities=45% Similarity=0.877 Sum_probs=313.2
Q ss_pred cEEEEEEeCCccccccCCCCCCCCCCCCCccEEEEeeEEeeCCCeeeccCCCccccchhhHHHHHHHHHHhCCCcEEEEE
Q psy14882 28 LEVVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKLSSFESNDETKDGKVGLYERIEQLKKANPKLKTLLA 107 (743)
Q Consensus 28 ~~VvgYy~~W~~~~~~~~~f~~~~Ip~~~~THIiyaFa~i~~~~~~sf~~~~~~~d~~~g~~~~l~~LK~~nP~lKVllS 107 (743)
+||||||++|+.||++.++|.+++||+++||||+|+|+.|++++....+. ....+++++.+||++||++|||||
T Consensus 2 ~rvV~Yy~~W~~~r~~~~~~~~~~i~~~~~THi~yaFa~i~~~~~~~~~~------~~~~~~~~~~~lK~~~p~lKvllS 75 (365)
T 4ay1_A 2 YKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDK------SEVMLYQTINSLKTKNPKLKILLS 75 (365)
T ss_dssp CEEEEEEESGGGGSCTTSCCCGGGCCTTTCSEEEEEEEEEETTEEECCCT------THHHHHHHHHHHHHHCTTCEEEEE
T ss_pred eEEEEEECCccccCCCCCCCChhHCCcccCCEEEEEeEEecCCeeEECCc------cHHHHHHHHHHHHHHCCCCEEEEE
Confidence 69999999999999988899999999999999999999999887654322 234578999999999999999999
Q ss_pred EcCCCCCchhhhhhcCCHHHHHHHHHHHHHHHHhCCCCeeeeeccCCCCCccHHHHHHHHHHHHHHHHHHHhhcCCCcEE
Q psy14882 108 IGGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLDIDWEYPAGTDDKKNYVLLLKELREAFEAEAQEVKKPRLL 187 (743)
Q Consensus 108 IGGw~~ss~~fs~~ls~~~~R~~FI~sIv~~lk~ygfDGVDIDWEyP~~~~dk~nfv~LLkeLR~~L~~~~~~~~~~~~l 187 (743)
||||+++++.|+.+++++++|++||++|++||++|+|||||||||||. ..++.+|+.||++||++|+++..+..++.++
T Consensus 76 iGGw~~~s~~Fs~~~~~~~~R~~Fi~siv~~~~~~~fDGiDiDWEyP~-~~d~~~~~~ll~elr~~~~~~~~~~~~~~~~ 154 (365)
T 4ay1_A 76 IGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPD-QKENTHFTVLIHELAEAFQKDFTKSTKERLL 154 (365)
T ss_dssp EEETTTTTGGGTTGGGSHHHHHHHHHHHHHHHHHTTCCEEEEEESCCH-HHHHHHHHHHHHHHHHHHHHHHHTCSSCCCE
T ss_pred EeCCCCCCchHHHHHcCHHHHHHHHHHHHHHHHhcCCceEEEeeecCC-cccccccHHHHHHHHHHHHHHHhhhccCceE
Confidence 999998788999999999999999999999999999999999999997 4789999999999999999877766677899
Q ss_pred EEEeccCCCCCCCCCCCccccccccceEEeeeccCCCCCCcccccCCCCCCCCCchHHHHHHHHHHHHHhcccccceeee
Q psy14882 188 LTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQLREAFEAEAQEVKKPRLLLTA 267 (743)
Q Consensus 188 LSiAvpa~~~~~~~~yd~~~L~~~vDfInlMtYD~~G~w~~~~g~~Spl~~~~~~~~~~lr~~~~~~~~~~~~~~~~lt~ 267 (743)
||+++|+.+..+...||+++|.++|||||||||||||.|+.
T Consensus 155 lt~a~~~~~~~~~~~~d~~~i~~~vD~inlMtYD~~g~w~~--------------------------------------- 195 (365)
T 4ay1_A 155 LTAGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEK--------------------------------------- 195 (365)
T ss_dssp EEEEEECCHHHHHHHCCHHHHHHHCSEEEEECCCSSCTTCS---------------------------------------
T ss_pred EEeecCCChhhhhhhcchhhhhhcccEEEEEcccccCcccC---------------------------------------
Confidence 99999987665544455655555555555555555555443
Q ss_pred ecCCCCCCCcCcccccccccchheeehhhccCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCcccccc
Q psy14882 268 AVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWRKQLSVENAANMWVRLGAPKEQASF 347 (743)
Q Consensus 268 a~~~~~~~~~~~~d~~~l~~~vD~iniMtYD~~g~w~~~tGh~apL~~~~~~~~~~~~~~v~~av~~w~~~G~p~~~~~~ 347 (743)
...+||+||||....+.......+++.+|+.|+++|+|
T Consensus 196 ------------------------------------~~~tg~~apL~~~~~~~~~~~~~~v~~av~~~~~~gvp------ 233 (365)
T 4ay1_A 196 ------------------------------------PLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMP------ 233 (365)
T ss_dssp ------------------------------------SCBCCCSSCSSCCTTCCGGGGGSSHHHHHHHHHHTTCC------
T ss_pred ------------------------------------CCcCCCCCCCCCCccccCccccccHHHHHHHHHHcCCC------
Confidence 01589999999887776666778999999999999988
Q ss_pred cccCCCcccCCCCCCCCCCCCcccccchhhhhhhhcCCCCceEEeeccccccccccCCCccccCCCCCCCCCCCcccccc
Q psy14882 348 TLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEKYLPKEKLIIGMPTYGRTFTLTNPAVFKVNSPASGGGKAGEYTISK 427 (743)
Q Consensus 348 ~~~d~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~v~~~KLvLGlp~YGr~w~l~~~~~~~~~~p~~g~g~~g~~~~~~ 427 (743)
++||+||||+|||+|++.++.+
T Consensus 234 --------------------------------------~~KlvlGip~YGr~~~~~~~~~-------------------- 255 (365)
T 4ay1_A 234 --------------------------------------SEKVVMGIPTYGHSFTLASAET-------------------- 255 (365)
T ss_dssp --------------------------------------GGGEEEEEESEEEEEEESSSCC--------------------
T ss_pred --------------------------------------HHHeeeccCccceeeeecCCCC--------------------
Confidence 9999999999999999876432
Q ss_pred cccccCCCCcCCcccccCCCCCCCCCCCCCCCCCCcccccCccccHHHHHHHhhCCceEEecCCCceeEEEeCCEEEEeC
Q psy14882 428 EKLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCEMLRNGAGYVWDDEMKVPYLVHGDQWVGFD 507 (743)
Q Consensus 428 ~k~~~g~~~~g~~~~~~~p~~~~~g~~~~~~~~~g~~~~~~G~l~Y~ei~~~~~~g~~~~wD~~a~~py~~~~~~~IsYD 507 (743)
..+++..+++.+|+++.+.|+++|.|||+.+. +....||.++++||.+++++||+||
T Consensus 256 ----------------------~~~~~~~~~~~~g~~t~~~g~~~y~e~~~~~~-~~~~~~~~~~~~~y~~~~~~~vsyd 312 (365)
T 4ay1_A 256 ----------------------TVGAPASGPGAAGPITESSGFLAYYEICQFLK-GAKITRLQDQQVPYAVKGNQWVGYD 312 (365)
T ss_dssp ----------------------STTCBEEEECCCCTTTCCTTEEEHHHHHHHHT-TCEEEECTTTCCEEEEETTEEEECC
T ss_pred ----------------------CCCCcccCCCCCccccccCCeeeHHHHHHHhc-CCceEEecCCeeEEEEECCEEEEeC
Confidence 12334455567788889999999999998765 6788999999999999999999999
Q ss_pred CHHHHHHHHHHHHHcCCceEEEEeccCCCCCCcccCCCCCcchHHHHHHHhCCC
Q psy14882 508 DEKSIRYKMNWLKDNGYGGAMVWTVDMDDFTGTVCGGDVKYPLIGAMREELNGI 561 (743)
Q Consensus 508 d~~Si~~K~~yak~~gLgGv~vW~L~~Dd~~g~~cg~~~~~pll~a~~~~l~~~ 561 (743)
|++||++|++||+++||||+|+|+|++|||+|.+|+++ ++|||+||+++|+++
T Consensus 313 d~~Si~~K~~y~~~~~LgGv~~W~l~~DD~~G~~~~~~-~~pLl~ai~~~lG~l 365 (365)
T 4ay1_A 313 DVKSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQG-PYPLVQAVKRSLGSL 365 (365)
T ss_dssp CHHHHHHHHHHHHHTTCSEEEEECGGGSCTTSTTTSSC-SSHHHHHHHHHHHC-
T ss_pred CHHHHHHHHHHHHhcCCCEEEEEeCCCcCCCCCcCCCC-cchHHHHHHHHhcCC
Confidence 99999999999999999999999999999999988776 899999999999764
|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 743 | ||||
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 4e-64 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-19 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 4e-19 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 6e-60 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-19 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 5e-19 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-55 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 2e-18 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 5e-15 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 2e-55 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 8e-21 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 2e-12 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 2e-53 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 1e-19 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 1e-05 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 7e-53 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 0.003 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 4e-50 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 8e-19 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-11 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 2e-48 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 9e-11 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 5e-48 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 2e-04 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 4e-47 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 1e-09 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 8e-44 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 7e-07 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 2e-42 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 1e-11 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 8e-37 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 3e-13 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 4e-04 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 1e-29 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 2e-10 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 9e-28 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 9e-12 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 1e-25 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 1e-09 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 5e-25 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 2e-04 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 7e-18 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 8e-05 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 1e-17 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 7e-08 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 2e-15 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 5e-15 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 1e-13 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 4e-13 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 3e-04 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 1e-10 | |
| d1goia3 | 88 | d.26.3.1 (A:292-379) Chitinase B {Serratia marcesc | 8e-05 | |
| d1w9pa2 | 62 | d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumi | 2e-04 | |
| d1ll7a2 | 62 | d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidio | 3e-04 |
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Chitotriosidase species: Human (Homo sapiens) [TaxId: 9606]
Score = 213 bits (543), Expect = 4e-64
Identities = 113/221 (51%), Positives = 148/221 (66%), Gaps = 10/221 (4%)
Query: 30 VVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKLSSFESNDETKDGKVGLY 89
+VCY+TNW+QYR +F P+D++P LCTH+I+AF + +LS+ E NDE LY
Sbjct: 3 LVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDE------TLY 56
Query: 90 ERIEQLKKANPKLKTLLAIGGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLDI 149
+ LKK NPKLKTLLAIGGW+FGTQKF +M + +RQTF+ SA+ FLR+ +FDGLD+
Sbjct: 57 QEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDL 116
Query: 150 DWEYPAG----TDDKKNYVLLLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKGGYDV 205
DWEYP DK+ + L+++L AF+ EAQ K RLLL+AAVP G + GY+V
Sbjct: 117 DWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEV 176
Query: 206 PAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQ 246
+A LDF+NLMAYDFHG WE GHN+PL +S
Sbjct: 177 DKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAA 217
|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Length = 88 | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 62 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 743 | |||
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 100.0 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.97 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.95 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.94 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.92 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.88 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.87 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.6 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 99.47 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 99.31 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 99.3 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 98.98 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 98.85 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 98.78 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 98.73 | |
| d1goia3 | 88 | Chitinase B {Serratia marcescens [TaxId: 615]} | 98.19 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 98.08 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 98.04 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 97.87 | |
| d1w9pa2 | 62 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 97.77 | |
| d1ll7a2 | 62 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 97.76 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 97.75 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 97.61 | |
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 97.57 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 97.44 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 97.44 | |
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 97.06 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 97.03 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 96.8 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 96.71 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 91.71 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 91.42 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 87.78 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 87.3 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 85.53 |
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Signal processing protein (SPC-40, MGP-40) species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00 E-value=7.6e-62 Score=513.29 Aligned_cols=291 Identities=44% Similarity=0.882 Sum_probs=247.3
Q ss_pred cEEEEEEeCCccccccCCCCCCCCCCCCCccEEEEeeEEeeCCCeeeccCCCccccchhhHHHHHHHHHHhCCCcEEEEE
Q psy14882 28 LEVVCYYTNWSQYRTKIGKFQPEDIEPDLCTHIIFAFGWLKKGKLSSFESNDETKDGKVGLYERIEQLKKANPKLKTLLA 107 (743)
Q Consensus 28 ~~VvgYy~~W~~~~~~~~~f~~~~Ip~~~~THIiyaFa~i~~~~~~sf~~~~~~~d~~~g~~~~l~~LK~~nP~lKVllS 107 (743)
+||||||++|+.||++...|.+++||+++||||+|+|+.+++++....+.. ....++++.+||+++|++|||+|
T Consensus 1 ~kvv~Yy~~w~~~r~~~~~~~~~~i~~~~~THiiyafa~i~~~~~~~~~~~------~~~~~~~~~~lk~~~~~lKvllS 74 (292)
T d2pi6a1 1 YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANISNNEIDTWEWN------DVTLYDTLNTLKNRNPKLKTLLS 74 (292)
T ss_dssp CEEEEEEEGGGGGSSGGGCCCGGGSCTTTCSEEEEEEEEEETTEEECCSTT------HHHHHHHHHHHHHHCTTCEEEEE
T ss_pred CeEEEEEccccccCCCCCCCChhHCCcccCCEEEEEEEEecCCCceecccc------cHHHHHHHHHHHhhCCCceEEEE
Confidence 589999999999999888999999999999999999999998765543321 34578999999999999999999
Q ss_pred EcCCCCCchhhhhhcCCHHHHHHHHHHHHHHHHhCCCCeeeeeccCCCCCccHHHHHHHHHHHHHHHHHHHhhcCCCcEE
Q psy14882 108 IGGWSFGTQKFKEMSKSRYSRQTFIYSAVPFLRQRNFDGLDIDWEYPAGTDDKKNYVLLLKELREAFEAEAQEVKKPRLL 187 (743)
Q Consensus 108 IGGw~~ss~~fs~~ls~~~~R~~FI~sIv~~lk~ygfDGVDIDWEyP~~~~dk~nfv~LLkeLR~~L~~~~~~~~~~~~l 187 (743)
||||++++..|+.+++++++|++||++|+++|++|+|||||||||||. ..++.+|+.|+++||++|++..+.. +..++
T Consensus 75 vGG~~~~~~~fs~~~~~~~~r~~fi~si~~~l~~~~fDGiDiDwE~p~-~~~~~~~~~l~~~lr~~l~~~~~~~-~~~~~ 152 (292)
T d2pi6a1 75 VGGWNFGPERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPG-RRDKRHLTTLVKEMKAEFIREAQAG-TEQLL 152 (292)
T ss_dssp EETTTSCHHHHHHHHTSHHHHHHHHHHHHHHHHHHTCSEEEEECSCCC-GGGHHHHHHHHHHHHHHHHHHHTTS-SCCCE
T ss_pred EeccccCchHHHHHhccHHHHHHHHHHHHHHHHhcCCCeEEEeccccc-cccccccchhHHHHHHHHHHHHhcc-CCCcc
Confidence 999998888999999999999999999999999999999999999997 4788999999999999999876543 45789
Q ss_pred EEEeccCCCCCCCCCCCccccccccceEEeeeccCCCCCCcccccCCCCCCCCCchHHHHHHHHHHHHHhcccccceeee
Q psy14882 188 LTAAVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWQLREAFEAEAQEVKKPRLLLTA 267 (743)
Q Consensus 188 LSiAvpa~~~~~~~~yd~~~L~~~vDfInlMtYD~~G~w~~~~g~~Spl~~~~~~~~~~lr~~~~~~~~~~~~~~~~lt~ 267 (743)
++++++..+..+...|+++
T Consensus 153 ~s~~~~~~~~~~~~~~~~~------------------------------------------------------------- 171 (292)
T d2pi6a1 153 LSAAVSAGKIAIDRGYDIA------------------------------------------------------------- 171 (292)
T ss_dssp EEEEEECCHHHHHHHCCHH-------------------------------------------------------------
T ss_pred eecccCchhhHHhccccHH-------------------------------------------------------------
Confidence 9999887655443334444
Q ss_pred ecCCCCCCCcCcccccccccchheeehhhccCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCcccccc
Q psy14882 268 AVPVGPDNIKGGYDVPAVAGYLDFINLMAYDFHGKWESQVGHNAPLRSPSSDSEWRKQLSVENAANMWVRLGAPKEQASF 347 (743)
Q Consensus 268 a~~~~~~~~~~~~d~~~l~~~vD~iniMtYD~~g~w~~~tGh~apL~~~~~~~~~~~~~~v~~av~~w~~~G~p~~~~~~ 347 (743)
++.+++||||+||||+||.|++.+||+||||....+.. ....+++.+|+.|++.|+|
T Consensus 172 ----------------~l~~~vD~invMtYD~~g~~~~~~g~~apL~~~~~~~~-~~~~~v~~~v~~~~~~Gvp------ 228 (292)
T d2pi6a1 172 ----------------QISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDAS-SRFSNADYAVSYMLRLGAP------ 228 (292)
T ss_dssp ----------------HHHHHCSEEEEETTCCSCTTCCBCCCSSCSSCCSSSCS-CTTSSHHHHHHHHHHTTCC------
T ss_pred ----------------HHHhhCCEEEEecccccCCCCCccccCCCCCCCCcccC-cCCccHHHHHHHHHHCCCC------
Confidence 44555555555556666666667888888886655433 2346899999999999988
Q ss_pred cccCCCcccCCCCCCCCCCCCcccccchhhhhhhhcCCCCceEEeeccccccccccCCCccccCCCCCCCCCCCcccccc
Q psy14882 348 TLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEKYLPKEKLIIGMPTYGRTFTLTNPAVFKVNSPASGGGKAGEYTISK 427 (743)
Q Consensus 348 ~~~d~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~v~~~KLvLGlp~YGr~w~l~~~~~~~~~~p~~g~g~~g~~~~~~ 427 (743)
++||+||||
T Consensus 229 --------------------------------------~~KlvlGip--------------------------------- 237 (292)
T d2pi6a1 229 --------------------------------------ANKLVMGIP--------------------------------- 237 (292)
T ss_dssp --------------------------------------GGGEEEEEE---------------------------------
T ss_pred --------------------------------------HHHeEEEec---------------------------------
Confidence 999999964
Q ss_pred cccccCCCCcCCcccccCCCCCCCCCCCCCCCCCCcccccCccccHHHHHHHhhCCceEEecCCCceeEEEeCCEEEEeC
Q psy14882 428 EKLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCEMLRNGAGYVWDDEMKVPYLVHGDQWVGFD 507 (743)
Q Consensus 428 ~k~~~g~~~~g~~~~~~~p~~~~~g~~~~~~~~~g~~~~~~G~l~Y~ei~~~~~~g~~~~wD~~a~~py~~~~~~~IsYD 507 (743)
||
T Consensus 238 ------------------------------------------------------------------------------yd 239 (292)
T d2pi6a1 238 ------------------------------------------------------------------------------TD 239 (292)
T ss_dssp ------------------------------------------------------------------------------SC
T ss_pred ------------------------------------------------------------------------------CC
Confidence 58
Q ss_pred CHHHHHHHHHHHHHcCCceEEEEeccCCCCCCcccCCCCCcchHHHHHHHhC
Q psy14882 508 DEKSIRYKMNWLKDNGYGGAMVWTVDMDDFTGTVCGGDVKYPLIGAMREELN 559 (743)
Q Consensus 508 d~~Si~~K~~yak~~gLgGv~vW~L~~Dd~~g~~cg~~~~~pll~a~~~~l~ 559 (743)
|++||+.|++||+++||||||+|+|++|||+|.+||.+.+||||+||++.|+
T Consensus 240 d~~Si~~K~~~~~~~~lgGv~iW~l~~DD~~G~~cg~~~~~pll~~i~~~L~ 291 (292)
T d2pi6a1 240 DQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLA 291 (292)
T ss_dssp CHHHHHHHHHHHHHTTCSEEEEECGGGSCSSSCSSSSCCSSHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHCCCceEEEEecccccCCCCcCCCCCCchHHHHHHHHhc
Confidence 9999999999999999999999999999999999998889999999999985
|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|