Psyllid ID: psy14920
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 586 | 2.2.26 [Sep-21-2011] | |||||||
| P67777 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P67776 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P67775 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P67774 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P63331 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P63330 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.956 | 1e-147 | |
| P48463 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.952 | 1e-146 | |
| P62716 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.952 | 1e-146 | |
| P62715 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.952 | 1e-146 | |
| P62714 | 309 | Serine/threonine-protein | yes | N/A | 0.435 | 0.825 | 0.952 | 1e-146 |
| >sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 522 bits (1344), Expect = e-147, Method: Compositional matrix adjust.
Identities = 244/255 (95%), Positives = 249/255 (97%)
Query: 329 EILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVET 388
EIL KESNVQEV+CPVTVCGDVHGQFHDLMELF+IGGKSPDTNYLFMGDYVDRGYYSVET
Sbjct: 37 EILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVET 96
Query: 389 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLT 448
VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWK+FTDLFDYLPLT
Sbjct: 97 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT 156
Query: 449 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 508
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA
Sbjct: 157 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 216
Query: 509 GYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 568
GYTFGQDISETFNH+NGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM
Sbjct: 217 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 276
Query: 569 ELDDGLKYSLPLGNP 583
ELDD LKYS +P
Sbjct: 277 ELDDTLKYSFLQFDP 291
|
PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGOL2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I. Activates RAF1 by dephosphorylating it at 'Ser-259'. Oryctolagus cuniculus (taxid: 9986) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6 |
| >sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 586 | ||||||
| 432099987 | 3012 | Testis-expressed sequence 15 protein, pa | 0.435 | 0.084 | 0.952 | 1e-150 | |
| 307168559 | 372 | Serine/threonine-protein phosphatase 2A | 0.426 | 0.672 | 0.988 | 1e-147 | |
| 322801631 | 350 | hypothetical protein SINV_14598 [Solenop | 0.435 | 0.728 | 0.972 | 1e-147 | |
| 345325749 | 409 | PREDICTED: serine/threonine-protein phos | 0.448 | 0.643 | 0.935 | 1e-147 | |
| 66556512 | 309 | PREDICTED: serine/threonine-protein phos | 0.435 | 0.825 | 0.972 | 1e-147 | |
| 242011990 | 309 | serine/threonine-protein phosphatase PP- | 0.435 | 0.825 | 0.972 | 1e-147 | |
| 383850208 | 309 | PREDICTED: serine/threonine-protein phos | 0.435 | 0.825 | 0.972 | 1e-147 | |
| 410039770 | 479 | PREDICTED: serine/threonine-protein phos | 0.426 | 0.521 | 0.976 | 1e-147 | |
| 345485882 | 309 | PREDICTED: serine/threonine-protein phos | 0.435 | 0.825 | 0.968 | 1e-146 | |
| 281348686 | 286 | hypothetical protein PANDA_000749 [Ailur | 0.426 | 0.874 | 0.976 | 1e-146 |
| >gi|432099987|gb|ELK28881.1| Testis-expressed sequence 15 protein, partial [Myotis davidii] | Back alignment and taxonomy information |
|---|
Score = 538 bits (1387), Expect = e-150, Method: Compositional matrix adjust.
Identities = 243/255 (95%), Positives = 248/255 (97%)
Query: 329 EILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVET 388
EIL KESNVQEV+CPVTVCGDVHGQFHDLMELF+IGGKSPDTNYLFMGDYVDRGYYSVET
Sbjct: 2740 EILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVET 2799
Query: 389 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLT 448
VTLLVALKVRY ERITILRGNHESRQITQVYGFYDECLRKYGNANVWK+FTDLFDYLPLT
Sbjct: 2800 VTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT 2859
Query: 449 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 508
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA
Sbjct: 2860 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 2919
Query: 509 GYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 568
GYTFGQDISETFNH+NGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM
Sbjct: 2920 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 2979
Query: 569 ELDDGLKYSLPLGNP 583
ELDD LKYS +P
Sbjct: 2980 ELDDTLKYSFLQFDP 2994
|
Source: Myotis davidii Species: Myotis davidii Genus: Myotis Family: Vespertilionidae Order: Chiroptera Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|307168559|gb|EFN61617.1| Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322801631|gb|EFZ22272.1| hypothetical protein SINV_14598 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|345325749|ref|XP_001512852.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Ornithorhynchus anatinus] | Back alignment and taxonomy information |
|---|
| >gi|66556512|ref|XP_623105.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform isoform 1 [Apis mellifera] gi|340712499|ref|XP_003394796.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Bombus terrestris] gi|350399835|ref|XP_003485654.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Bombus impatiens] gi|380016948|ref|XP_003692429.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242011990|ref|XP_002426726.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus humanus corporis] gi|212510897|gb|EEB13988.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383850208|ref|XP_003700689.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|410039770|ref|XP_003310895.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Pan troglodytes] | Back alignment and taxonomy information |
|---|
| >gi|345485882|ref|XP_001602506.2| PREDICTED: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|281348686|gb|EFB24270.1| hypothetical protein PANDA_000749 [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 586 | ||||||
| UNIPROTKB|Q6P365 | 309 | ppp2ca "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 2.2e-150 | |
| UNIPROTKB|Q8AVH9 | 309 | ppp2ca "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 5.8e-150 | |
| UNIPROTKB|P67774 | 309 | PPP2CA "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 7.4e-150 | |
| UNIPROTKB|F1P7I7 | 309 | PPP2CA "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 7.4e-150 | |
| UNIPROTKB|P67775 | 309 | PPP2CA "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 7.4e-150 | |
| UNIPROTKB|P67776 | 309 | PPP2CA "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 7.4e-150 | |
| UNIPROTKB|P67777 | 309 | PPP2CA "Serine/threonine-prote | 0.424 | 0.805 | 0.975 | 7.4e-150 | |
| ZFIN|ZDB-GENE-040426-877 | 309 | zgc:56064 "zgc:56064" [Danio r | 0.424 | 0.805 | 0.967 | 7.4e-150 | |
| MGI|MGI:1321159 | 309 | Ppp2ca "protein phosphatase 2 | 0.424 | 0.805 | 0.975 | 9.5e-150 | |
| RGD|3380 | 309 | Ppp2ca "protein phosphatase 2, | 0.424 | 0.805 | 0.975 | 9.5e-150 |
| UNIPROTKB|Q6P365 ppp2ca "Serine/threonine-protein phosphatase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Score = 1337 (475.7 bits), Expect = 2.2e-150, Sum P(2) = 2.2e-150
Identities = 243/249 (97%), Positives = 247/249 (99%)
Query: 329 EILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVET 388
EIL KESNVQEV+CPVTVCGDVHGQFHDLMELF+IGGKSPDTNYLFMGDYVDRGYYSVET
Sbjct: 37 EILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVET 96
Query: 389 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLT 448
VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWK+FTDLFDYLPLT
Sbjct: 97 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT 156
Query: 449 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 508
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA
Sbjct: 157 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 216
Query: 509 GYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 568
GYTFGQDISETFNH+NGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM
Sbjct: 217 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 276
Query: 569 ELDDGLKYS 577
ELDD LKYS
Sbjct: 277 ELDDTLKYS 285
|
|
| UNIPROTKB|Q8AVH9 ppp2ca "Serine/threonine-protein phosphatase" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67774 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P7I7 PPP2CA "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67775 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67776 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67777 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-877 zgc:56064 "zgc:56064" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1321159 Ppp2ca "protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3380 Ppp2ca "protein phosphatase 2, catalytic subunit, alpha isozyme" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P11611 | PP2AB_RABIT | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
| P63330 | PP2AA_MOUSE | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| P48463 | PP2AA_CHICK | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
| Q9HFQ2 | PP2A1_EMENI | 3, ., 1, ., 3, ., 1, 6 | 0.8671 | 0.4266 | 0.7598 | yes | N/A |
| P23594 | PP2A1_YEAST | 3, ., 1, ., 3, ., 1, 6 | 0.8040 | 0.4112 | 0.6531 | yes | N/A |
| P23635 | PP2A1_SCHPO | 3, ., 1, ., 3, ., 1, 6 | 0.824 | 0.4163 | 0.7896 | yes | N/A |
| P62716 | PP2AB_RAT | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
| P62714 | PP2AB_HUMAN | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
| P62715 | PP2AB_MOUSE | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
| Q0DBD3 | PP2A1_ORYSJ | 3, ., 1, ., 3, ., 1, 6 | 0.8571 | 0.4180 | 0.8006 | yes | N/A |
| P23696 | PP2A_DROME | 3, ., 1, ., 3, ., 1, 6 | 0.9450 | 0.4283 | 0.8122 | yes | N/A |
| P63331 | PP2AA_RAT | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| Q0E2S4 | PP2A3_ORYSJ | 3, ., 1, ., 3, ., 1, 6 | 0.8408 | 0.4180 | 0.7980 | yes | N/A |
| Q07098 | PP2A2_ARATH | 3, ., 1, ., 3, ., 1, 6 | 0.8333 | 0.4197 | 0.8039 | yes | N/A |
| Q07099 | PP2A1_ARATH | 3, ., 1, ., 3, ., 1, 6 | 0.8333 | 0.4197 | 0.8039 | yes | N/A |
| P67777 | PP2AA_RABIT | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| P67776 | PP2AA_PIG | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| P67775 | PP2AA_HUMAN | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| P67774 | PP2AA_BOVIN | 3, ., 1, ., 3, ., 1, 6 | 0.9568 | 0.4351 | 0.8252 | yes | N/A |
| Q9XZE5 | PP2AA_DICDI | 3, ., 1, ., 3, ., 1, 6 | 0.8431 | 0.4283 | 0.8202 | yes | N/A |
| P11493 | PP2AB_PIG | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8703 | yes | N/A |
| Q0P594 | PP2AB_BOVIN | 3, ., 1, ., 3, ., 1, 6 | 0.9529 | 0.4351 | 0.8252 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3.16 | 0.914 |
| 3rd Layer | 2.3.1 | 0.766 |
| 3rd Layer | 2.3.1.97 | 0.824 |
| 3rd Layer | 3.1.3 | 0.921 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 586 | |||
| cd07415 | 285 | cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos | 0.0 | |
| PTZ00239 | 303 | PTZ00239, PTZ00239, serine/threonine protein phosp | 1e-137 | |
| smart00156 | 271 | smart00156, PP2Ac, Protein phosphatase 2A homologu | 1e-131 | |
| cd07414 | 293 | cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li | 1e-105 | |
| COG5092 | 451 | COG5092, NMT1, N-myristoyl transferase [Lipid meta | 7e-94 | |
| cd07416 | 305 | cd07416, MPP_PP2B, PP2B, metallophosphatase domain | 3e-91 | |
| cd07417 | 316 | cd07417, MPP_PP5_C, PP5, C-terminal metallophospha | 2e-89 | |
| PTZ00480 | 320 | PTZ00480, PTZ00480, serine/threonine-protein phosp | 2e-85 | |
| pfam01233 | 162 | pfam01233, NMT, Myristoyl-CoA:protein N-myristoylt | 2e-83 | |
| PTZ00244 | 294 | PTZ00244, PTZ00244, serine/threonine-protein phosp | 7e-79 | |
| cd00144 | 225 | cd00144, MPP_PPP_family, phosphoprotein phosphatas | 1e-75 | |
| cd07419 | 311 | cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho | 1e-70 | |
| cd07420 | 321 | cd07420, MPP_RdgC, Drosophila melanogaster RdgC an | 9e-50 | |
| cd07418 | 377 | cd07418, MPP_PP7, PP7, metallophosphatase domain | 2e-46 | |
| pfam02799 | 190 | pfam02799, NMT_C, Myristoyl-CoA:protein N-myristoy | 1e-39 | |
| COG0639 | 155 | COG0639, ApaH, Diadenosine tetraphosphatase and re | 1e-39 | |
| pfam00149 | 185 | pfam00149, Metallophos, Calcineurin-like phosphoes | 6e-31 | |
| cd07415 | 285 | cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos | 2e-06 | |
| cd00838 | 131 | cd00838, MPP_superfamily, metallophosphatase super | 3e-05 | |
| cd07425 | 208 | cd07425, MPP_Shelphs, Shewanella-like phosphatases | 4e-05 | |
| cd07424 | 207 | cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos | 2e-04 | |
| PHA02239 | 235 | PHA02239, PHA02239, putative protein phosphatase | 2e-04 | |
| cd07413 | 222 | cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 | 9e-04 | |
| cd07422 | 257 | cd07422, MPP_ApaH, Escherichia coli ApaH and relat | 0.002 | |
| cd07421 | 304 | cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo | 0.003 |
| >gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
Score = 562 bits (1451), Expect = 0.0
Identities = 200/258 (77%), Positives = 223/258 (86%)
Query: 327 ITEILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSV 386
EIL KESNVQ V+ PVTVCGD+HGQF+DL+ELF++GG PDTNYLF+GDYVDRGYYSV
Sbjct: 27 AKEILVKESNVQRVRSPVTVCGDIHGQFYDLLELFRVGGDPPDTNYLFLGDYVDRGYYSV 86
Query: 387 ETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLP 446
ET LL+ALKVRY +RIT+LRGNHESRQITQVYGFYDECLRKYGNANVWK+ TDLFDYLP
Sbjct: 87 ETFLLLLALKVRYPDRITLLRGNHESRQITQVYGFYDECLRKYGNANVWKYCTDLFDYLP 146
Query: 447 LTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPR 506
L AL+D QIFC+HGGLSPSIDTLD IRA+DR QEVPHEGPMCDLLWSDPDD GWGISPR
Sbjct: 147 LAALIDNQIFCVHGGLSPSIDTLDQIRAIDRFQEVPHEGPMCDLLWSDPDDIEGWGISPR 206
Query: 507 GAGYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAA 566
GAGY FGQD+ E FNH+NGLTL+ RAHQLVMEGY W D +VT++SAPNYCYRCGN A+
Sbjct: 207 GAGYLFGQDVVEEFNHNNGLTLICRAHQLVMEGYQWMFDDKLVTVWSAPNYCYRCGNVAS 266
Query: 567 IMELDDGLKYSLPLGNPC 584
IMELD+ LK S +
Sbjct: 267 IMELDEHLKRSFKVFEAA 284
|
PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6. PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities. PP2A comprises about 1% of total cellular proteins. PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation. The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B). The PPP (phosphoprotein phosphatase) family, to which PP2A belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 285 |
| >gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227423 COG5092, NMT1, N-myristoyl transferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|110249 pfam01233, NMT, Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|202401 pfam02799, NMT_C, Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase | Back alignment and domain information |
|---|
| >gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 586 | |||
| KOG2779|consensus | 421 | 100.0 | ||
| COG5092 | 451 | NMT1 N-myristoyl transferase [Lipid metabolism] | 100.0 | |
| KOG0372|consensus | 303 | 100.0 | ||
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 100.0 | |
| KOG0373|consensus | 306 | 100.0 | ||
| cd07420 | 321 | MPP_RdgC Drosophila melanogaster RdgC and related | 100.0 | |
| cd07415 | 285 | MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein | 100.0 | |
| KOG0374|consensus | 331 | 100.0 | ||
| PTZ00239 | 303 | serine/threonine protein phosphatase 2A; Provision | 100.0 | |
| PTZ00480 | 320 | serine/threonine-protein phosphatase; Provisional | 100.0 | |
| PTZ00244 | 294 | serine/threonine-protein phosphatase PP1; Provisio | 100.0 | |
| cd07414 | 293 | MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme | 100.0 | |
| cd07417 | 316 | MPP_PP5_C PP5, C-terminal metallophosphatase domai | 100.0 | |
| smart00156 | 271 | PP2Ac Protein phosphatase 2A homologues, catalytic | 100.0 | |
| cd07416 | 305 | MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca | 100.0 | |
| cd07419 | 311 | MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a | 100.0 | |
| KOG0371|consensus | 319 | 100.0 | ||
| cd07418 | 377 | MPP_PP7 PP7, metallophosphatase domain. PP7 is a p | 100.0 | |
| KOG0375|consensus | 517 | 100.0 | ||
| KOG0377|consensus | 631 | 100.0 | ||
| KOG0376|consensus | 476 | 100.0 | ||
| cd00144 | 225 | MPP_PPP_family phosphoprotein phosphatases of the | 100.0 | |
| PF02799 | 190 | NMT_C: Myristoyl-CoA:protein N-myristoyltransferas | 99.95 | |
| cd07425 | 208 | MPP_Shelphs Shewanella-like phosphatases, metallop | 99.9 | |
| PRK13625 | 245 | bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision | 99.9 | |
| PRK00166 | 275 | apaH diadenosine tetraphosphatase; Reviewed | 99.88 | |
| TIGR00668 | 279 | apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric | 99.87 | |
| cd07422 | 257 | MPP_ApaH Escherichia coli ApaH and related protein | 99.87 | |
| cd07423 | 234 | MPP_PrpE Bacillus subtilis PrpE and related protei | 99.86 | |
| cd07413 | 222 | MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat | 99.86 | |
| PRK11439 | 218 | pphA serine/threonine protein phosphatase 1; Provi | 99.82 | |
| cd07421 | 304 | MPP_Rhilphs Rhilph phosphatases, metallophosphatas | 99.82 | |
| cd07424 | 207 | MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do | 99.81 | |
| PHA02239 | 235 | putative protein phosphatase | 99.8 | |
| PRK09968 | 218 | serine/threonine-specific protein phosphatase 2; P | 99.75 | |
| PF00149 | 200 | Metallophos: Calcineurin-like phosphoesterase; Int | 99.17 | |
| cd00841 | 155 | MPP_YfcE Escherichia coli YfcE and related protein | 98.89 | |
| PF12850 | 156 | Metallophos_2: Calcineurin-like phosphoesterase su | 98.88 | |
| COG0639 | 155 | ApaH Diadenosine tetraphosphatase and related seri | 98.86 | |
| TIGR00040 | 158 | yfcE phosphoesterase, MJ0936 family. Members of th | 98.8 | |
| PRK09453 | 182 | phosphodiesterase; Provisional | 98.79 | |
| cd07397 | 238 | MPP_DevT Myxococcus xanthus DevT and related prote | 98.66 | |
| cd07379 | 135 | MPP_239FB Homo sapiens 239FB and related proteins, | 98.57 | |
| cd00838 | 131 | MPP_superfamily metallophosphatase superfamily, me | 98.51 | |
| KOG0373|consensus | 306 | 98.41 | ||
| PRK05340 | 241 | UDP-2,3-diacylglucosamine hydrolase; Provisional | 98.27 | |
| cd07392 | 188 | MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel | 98.22 | |
| cd07394 | 178 | MPP_Vps29 Homo sapiens Vps29 and related proteins, | 98.21 | |
| cd07388 | 224 | MPP_Tt1561 Thermus thermophilus Tt1561 and related | 98.12 | |
| cd07404 | 166 | MPP_MS158 Microscilla MS158 and related proteins, | 98.07 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 98.07 | |
| cd07399 | 214 | MPP_YvnB Bacillus subtilis YvnB and related protei | 98.05 | |
| cd07403 | 129 | MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel | 98.02 | |
| TIGR01854 | 231 | lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. | 98.0 | |
| cd07400 | 144 | MPP_YydB Bacillus subtilis YydB and related protei | 97.83 | |
| KOG0372|consensus | 303 | 97.76 | ||
| PRK01346 | 411 | hypothetical protein; Provisional | 97.63 | |
| COG0622 | 172 | Predicted phosphoesterase [General function predic | 97.58 | |
| PRK11340 | 271 | phosphodiesterase YaeI; Provisional | 97.53 | |
| cd07385 | 223 | MPP_YkuE_C Bacillus subtilis YkuE and related prot | 97.5 | |
| cd07395 | 262 | MPP_CSTP1 Homo sapiens CSTP1 and related proteins, | 97.46 | |
| PF06874 | 640 | FBPase_2: Firmicute fructose-1,6-bisphosphatase; I | 97.39 | |
| cd07390 | 168 | MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro | 97.27 | |
| PRK11148 | 275 | cyclic 3',5'-adenosine monophosphate phosphodieste | 97.24 | |
| TIGR03729 | 239 | acc_ester putative phosphoesterase. Members of thi | 97.21 | |
| KOG0371|consensus | 319 | 97.18 | ||
| cd07391 | 172 | MPP_PF1019 Pyrococcus furiosus PF1019 and related | 97.09 | |
| cd07396 | 267 | MPP_Nbla03831 Homo sapiens Nbla03831 and related p | 97.02 | |
| KOG0376|consensus | 476 | 96.94 | ||
| TIGR00619 | 253 | sbcd exonuclease SbcD. This family is based on the | 96.94 | |
| PHA02546 | 340 | 47 endonuclease subunit; Provisional | 96.87 | |
| cd07398 | 217 | MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat | 96.84 | |
| COG1409 | 301 | Icc Predicted phosphohydrolases [General function | 96.77 | |
| PRK04036 | 504 | DNA polymerase II small subunit; Validated | 96.72 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 96.69 | |
| cd07402 | 240 | MPP_GpdQ Enterobacter aerogenes GpdQ and related p | 96.66 | |
| cd00840 | 223 | MPP_Mre11_N Mre11 nuclease, N-terminal metallophos | 96.58 | |
| cd00844 | 262 | MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t | 96.55 | |
| COG2129 | 226 | Predicted phosphoesterases, related to the Icc pro | 96.5 | |
| cd08165 | 156 | MPP_MPPE1 human MPPE1 and related proteins, metall | 96.48 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 96.35 | |
| cd00839 | 294 | MPP_PAPs purple acid phosphatases of the metalloph | 96.35 | |
| cd07401 | 256 | MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal | 96.35 | |
| TIGR00024 | 225 | SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 | 96.3 | |
| TIGR00583 | 405 | mre11 DNA repair protein (mre11). All proteins in | 96.15 | |
| cd07393 | 232 | MPP_DR1119 Deinococcus radiodurans DR1119 and rela | 96.13 | |
| cd07383 | 199 | MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase | 96.05 | |
| COG3855 | 648 | Fbp Uncharacterized protein conserved in bacteria | 95.91 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 95.87 | |
| PRK10966 | 407 | exonuclease subunit SbcD; Provisional | 95.84 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 95.75 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 95.5 | |
| COG4186 | 186 | Predicted phosphoesterase or phosphohydrolase [Gen | 95.49 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 95.37 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 95.33 | |
| cd07384 | 171 | MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re | 95.33 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 95.16 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 95.03 | |
| cd07380 | 150 | MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re | 94.83 | |
| cd08166 | 195 | MPP_Cdc1_like_1 uncharacterized subgroup related t | 94.81 | |
| cd07386 | 243 | MPP_DNA_pol_II_small_archeal_C archeal DNA polymer | 94.77 | |
| cd08163 | 257 | MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related | 94.72 | |
| cd00845 | 252 | MPP_UshA_N_like Escherichia coli UshA-like family, | 94.61 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 94.44 | |
| COG2908 | 237 | Uncharacterized protein conserved in bacteria [Fun | 94.37 | |
| COG1408 | 284 | Predicted phosphohydrolases [General function pred | 94.1 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 94.05 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 93.8 | |
| COG0420 | 390 | SbcD DNA repair exonuclease [DNA replication, reco | 93.69 | |
| KOG3325|consensus | 183 | 93.62 | ||
| COG1407 | 235 | Predicted ICC-like phosphoesterases [General funct | 93.48 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 93.45 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 93.26 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 93.1 | |
| cd07410 | 277 | MPP_CpdB_N Escherichia coli CpdB and related prote | 92.67 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 92.12 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 92.11 | |
| PF14582 | 255 | Metallophos_3: Metallophosphoesterase, calcineurin | 92.11 | |
| PLN02533 | 427 | probable purple acid phosphatase | 92.07 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 91.43 | |
| PHA01807 | 153 | hypothetical protein | 91.33 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 91.09 | |
| cd00842 | 296 | MPP_ASMase acid sphingomyelinase and related prote | 90.87 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 90.51 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 90.46 | |
| cd08164 | 193 | MPP_Ted1 Saccharomyces cerevisiae Ted1 and related | 90.37 | |
| cd07412 | 288 | MPP_YhcR_N Bacillus subtilis YhcR endonuclease and | 90.04 | |
| KOG0918|consensus | 476 | 90.0 | ||
| cd07378 | 277 | MPP_ACP5 Homo sapiens acid phosphatase 5 and relat | 89.36 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 89.3 | |
| cd07408 | 257 | MPP_SA0022_N Staphylococcus aureus SA0022 and rela | 88.77 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 88.69 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 88.6 | |
| PTZ00239 | 303 | serine/threonine protein phosphatase 2A; Provision | 88.41 | |
| COG1311 | 481 | HYS2 Archaeal DNA polymerase II, small subunit/DNA | 88.15 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 87.68 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 87.33 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 86.49 | |
| cd07415 | 285 | MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein | 86.07 | |
| cd07411 | 264 | MPP_SoxB_N Thermus thermophilus SoxB and related p | 85.79 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 85.63 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 85.52 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 85.41 | |
| COG1768 | 230 | Predicted phosphohydrolase [General function predi | 84.99 | |
| cd07387 | 257 | MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 | 84.89 | |
| cd07409 | 281 | MPP_CD73_N CD73 ecto-5'-nucleotidase and related p | 84.04 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 84.02 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 83.6 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 83.58 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 83.41 | |
| KOG3662|consensus | 410 | 82.86 | ||
| cd07420 | 321 | MPP_RdgC Drosophila melanogaster RdgC and related | 81.8 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 81.8 |
| >KOG2779|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.7e-118 Score=896.30 Aligned_cols=307 Identities=65% Similarity=1.089 Sum_probs=295.8
Q ss_pred HHHHHhhccccCCCchhhhhhccccccccccCCCCCCCcCcCCCccCCCCCCccCCCCCCCCCCceEEeCCCCChhHHHH
Q psy14920 38 KAMEVFSLQQRSAKTPEEALQKQYQFWSTQPVPKIDEKITTNGPIELDKSPSEIRAEPYSLPPGFQWDTLNLDDPLVLEE 117 (586)
Q Consensus 38 ~Llee~nv~~vsap~t~~~~~~~~~fw~tqpv~~~~~~~~~~g~i~~~~~~~~~~~~p~~lp~~f~w~~~d~~~~~~~~~ 117 (586)
.+++..++.+..+...+++.++.|+||+||||||++|.+..+|||++++.+++|++|||+||.||+|+++|++|.++++|
T Consensus 17 ~~~~l~~~~~~~~~~~~~~~~~~~~fw~tqpV~k~de~~~~~~~i~p~k~~~~i~~ep~~lp~gf~W~tldv~~~~~l~e 96 (421)
T KOG2779|consen 17 KALELMSVIQGPATMMDEAAKKDFKFWSTQPVPKLDEVVTANGPIEPNKIVDRIRQEPYSLPTGFRWETLDVSDFKDLEE 96 (421)
T ss_pred HHHHhcccccCcccccccccccccceeecccccccCccccccCCCCCCcchhhhhhCcccCCCCceeeccCCccHhHHHH
Confidence 34455555556666777788899999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhhhcccccCCCcc------------ceeCCCcceeeeeEEEeecCCeEEEEEeeeeeEEEEeceEeeeeeEEEEeee
Q psy14920 118 LYKLLNENYVEDEDSM------------ALQAPGWCKEWHCGVRVSKSNVLVAFISAIPATLSIYGVSQKMVEINFLCVH 185 (586)
Q Consensus 118 ~~~ll~~~yved~~~~------------al~~pg~~~~w~~gvr~~~~~klv~fi~~~p~~~~v~~~~~~~~~inflcvh 185 (586)
+|+||+||||||+|+| ||+||||+++||||||+++|+||||||||||++||||++.++|+||||||||
T Consensus 97 l~~lL~enyVEd~~~m~rf~Ys~eFl~Wal~~pg~~~~WHiGVRv~~s~kLVaFIsaiP~~irvrdk~vk~veINFLCVH 176 (421)
T KOG2779|consen 97 LYNLLNENYVEDDDSMFRFDYSPEFLKWALQPPGWKKEWHIGVRVKSSKKLVAFISAIPATIRVRDKVVKMVEINFLCVH 176 (421)
T ss_pred HHhhcccCCCCccccchhhhccHHHHHhhhcCCCCccceEEEEEEecCCceEEEEeccccEEEEccceeeeeeEEEEEEe
Confidence 9999999999999997 9999999999999999999999999999999999999999999999999999
Q ss_pred ccccccCchhHHHHHHHhhhcccCceeeehhcCccCCCccccccccccCCCccccccccCCCCCccchHHHHHHhcCCCC
Q psy14920 186 KKLRSKRVAPVLIREITRRVNLKGLFQAVYTAGVVLPKPVGTCRYWHRSLNPKKLIEVKFSHLSRNMTMKRTLKLYGLPE 265 (586)
Q Consensus 186 kklR~krlap~li~Eitrr~~~~~i~qa~yt~g~~lp~p~~~~~y~hr~ln~~kL~~~~fs~~~~~~t~~~~~~~~~lp~ 265 (586)
|||||||||||||||||||||++|||||+||||++||+|||+|||||||||||||++||||+++++|||+|++|+|+||+
T Consensus 177 KkLRSKRlaPvLIrEITRRvnl~gIfqA~yTaGvvLp~PVstcRY~HRsLNpkKL~dv~Fs~l~~~mTm~rt~klykLP~ 256 (421)
T KOG2779|consen 177 KKLRSKRLAPVLIREITRRVNLEGIFQAAYTAGVVLPKPVSTCRYWHRSLNPKKLIDVGFSHLSRNMTMQRTIKLYKLPE 256 (421)
T ss_pred hhhhccccccHHHHHHHHHhhhhhhhhHhhhcceeeccccchhhhhhccCChhHeeEeccccccccchHhhhHhhccCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcCCCcccccCChhHHHHHHHHHhhhcCCCcccChhhhhcccCCCCCceeEEEeec-cchhhhhcccCCceeeeccce
Q psy14920 266 TTKVFGFRPLQEADIPKAHKVLCEFFLRFDLAPIFSEEEFKHWFLPRDGIVYTFVVEN-DGEITEILAKESNVQEVKCPV 344 (586)
Q Consensus 266 ~~~~~glR~m~~~Dv~~v~~Ll~~yl~~f~l~p~fs~eev~Hwflp~~~Vv~syVve~-~~~itd~~s~ep~ll~~~~p~ 344 (586)
+|+|+|+|+|+++|||+|++||.+|++||.++++|++||++|||+|+++|+|+||+|+ .++||||+++ +++|+
T Consensus 257 ~~~T~G~R~me~kDvp~V~~Ll~~yl~qf~la~~f~~eev~Hwf~p~e~VV~syVvesp~g~ITDF~SF------y~lps 330 (421)
T KOG2779|consen 257 TTKTPGLREMEEKDVPAVFRLLRNYLKQFELAPVFDEEEVEHWFLPRENVVYSYVVESPNGKITDFCSF------YSLPS 330 (421)
T ss_pred CCCCCCcccccccchHHHHHHHHHHHHheecccccCHHHhHhhcccccceEEEEEEECCCCcccceeeE------Eeccc
Confidence 9999999999999999999999999999999999999999999999999999999999 5799999998 99999
Q ss_pred EEecCC
Q psy14920 345 TVCGDV 350 (586)
Q Consensus 345 ~v~gdi 350 (586)
+|+|.-
T Consensus 331 Tv~~~~ 336 (421)
T KOG2779|consen 331 TVMGNP 336 (421)
T ss_pred cccCCC
Confidence 999963
|
|
| >COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0372|consensus | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >KOG0373|consensus | Back alignment and domain information |
|---|
| >cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0374|consensus | Back alignment and domain information |
|---|
| >PTZ00239 serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00480 serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00244 serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >cd07416 MPP_PP2B PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0371|consensus | Back alignment and domain information |
|---|
| >cd07418 MPP_PP7 PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0375|consensus | Back alignment and domain information |
|---|
| >KOG0377|consensus | Back alignment and domain information |
|---|
| >KOG0376|consensus | Back alignment and domain information |
|---|
| >cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >PRK00166 apaH diadenosine tetraphosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) | Back alignment and domain information |
|---|
| >cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11439 pphA serine/threonine protein phosphatase 1; Provisional | Back alignment and domain information |
|---|
| >cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >PHA02239 putative protein phosphatase | Back alignment and domain information |
|---|
| >PRK09968 serine/threonine-specific protein phosphatase 2; Provisional | Back alignment and domain information |
|---|
| >PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 | Back alignment and domain information |
|---|
| >cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] | Back alignment and domain information |
|---|
| >COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00040 yfcE phosphoesterase, MJ0936 family | Back alignment and domain information |
|---|
| >PRK09453 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0373|consensus | Back alignment and domain information |
|---|
| >PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase | Back alignment and domain information |
|---|
| >cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0372|consensus | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0622 Predicted phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11340 phosphodiesterase YaeI; Provisional | Back alignment and domain information |
|---|
| >cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] | Back alignment and domain information |
|---|
| >cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03729 acc_ester putative phosphoesterase | Back alignment and domain information |
|---|
| >KOG0371|consensus | Back alignment and domain information |
|---|
| >cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0376|consensus | Back alignment and domain information |
|---|
| >TIGR00619 sbcd exonuclease SbcD | Back alignment and domain information |
|---|
| >PHA02546 47 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1409 Icc Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04036 DNA polymerase II small subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related | Back alignment and domain information |
|---|
| >TIGR00583 mre11 DNA repair protein (mre11) | Back alignment and domain information |
|---|
| >cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10966 exonuclease subunit SbcD; Provisional | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >COG2908 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1408 Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3325|consensus | Back alignment and domain information |
|---|
| >COG1407 Predicted ICC-like phosphoesterases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0918|consensus | Back alignment and domain information |
|---|
| >cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00239 serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1768 Predicted phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain | Back alignment and domain information |
|---|
| >cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >KOG3662|consensus | Back alignment and domain information |
|---|
| >cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 586 | ||||
| 2nyl_C | 293 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 1e-148 | ||
| 3p71_C | 304 | Crystal Structure Of The Complex Of Lcmt-1 And Pp2a | 1e-148 | ||
| 2ie4_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 1e-148 | ||
| 2ie3_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 1e-148 | ||
| 3c5w_C | 310 | Complex Between Pp2a-Specific Methylesterase Pme-1 | 1e-148 | ||
| 2iae_C | 309 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 1e-147 | ||
| 3fga_C | 309 | Structural Basis Of Pp2a And Sgo Interaction Length | 1e-147 | ||
| 1rxt_A | 496 | Crystal Structure Of Human Myristoyl-Coa:protein N- | 1e-106 | ||
| 3iu1_A | 383 | Crystal Structure Of Human Type-I N-Myristoyltransf | 4e-98 | ||
| 2o8a_A | 329 | Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng | 1e-73 | ||
| 1jk7_A | 323 | Crystal Structure Of The Tumor-Promoter Okadaic Aci | 1e-73 | ||
| 3n5u_B | 300 | Crystal Structure Of An Rb C-Terminal Peptide Bound | 2e-73 | ||
| 1fjm_A | 330 | Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor | 2e-73 | ||
| 4g9j_A | 331 | Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P | 3e-73 | ||
| 3e7a_A | 299 | Crystal Structure Of Protein Phosphatase-1 Bound To | 4e-73 | ||
| 3egg_A | 329 | Crystal Structure Of A Complex Between Protein Phos | 4e-73 | ||
| 3v4y_A | 306 | Crystal Structure Of The First Nuclear Pp1 Holoenzy | 4e-73 | ||
| 1u32_A | 293 | Crystal Structure Of A Protein Phosphatase-1: Calci | 8e-72 | ||
| 1s70_A | 330 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 2e-71 | ||
| 4b10_A | 385 | Plasmodium Vivax N-Myristoyltransferase With A Non- | 9e-70 | ||
| 4a95_A | 384 | Plasmodium Vivax N-Myristoyltransferase With Quinol | 1e-69 | ||
| 2p6e_A | 455 | Crystal Structures Of Saccharomyces Cerevisiae N-My | 5e-62 | ||
| 2nmt_A | 422 | Myristoyl-Coa:protein N-Myristoyltransferase Bound | 1e-61 | ||
| 2wuu_A | 421 | Structure Of N-Myristoyltransferase From L. Donovan | 4e-59 | ||
| 2wsa_A | 438 | Crystal Structure Of Leishmania Major N- Myristoylt | 9e-59 | ||
| 1aui_A | 521 | Human Calcineurin Heterodimer Length = 521 | 1e-58 | ||
| 1m63_A | 372 | Crystal Structure Of Calcineurin-Cyclophilin-Cyclos | 2e-58 | ||
| 2p6b_A | 383 | Crystal Structure Of Human Calcineurin In Complex W | 3e-58 | ||
| 3ll8_A | 357 | Crystal Structure Of Calcineurin In Complex With Ak | 3e-58 | ||
| 2jog_A | 327 | Structure Of The Calcineurin-Nfat Complex Length = | 3e-58 | ||
| 3h5z_A | 438 | Crystal Structure Of Leishmania Major N-Myristoyltr | 4e-58 | ||
| 1tco_A | 375 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 4e-58 | ||
| 1mf8_A | 373 | Crystal Structure Of Human Calcineurin Complexed Wi | 4e-58 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 9e-58 | ||
| 1s95_A | 333 | Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 | 2e-57 | ||
| 3h60_A | 315 | Catalytic Domain Of Human SerineTHREONINE PHOSPHATA | 2e-57 | ||
| 1nmt_A | 392 | N-Myristoyl Transferase From Candida Albicans At 2. | 6e-55 | ||
| 3icf_A | 335 | Structure Of Protein SerineTHREONINE PHOSPHATASE FR | 2e-45 |
| >pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 | Back alignment and structure |
|
| >pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 | Back alignment and structure |
| >pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 | Back alignment and structure |
| >pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 | Back alignment and structure |
| >pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 | Back alignment and structure |
| >pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 | Back alignment and structure |
| >pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 | Back alignment and structure |
| >pdb|1RXT|A Chain A, Crystal Structure Of Human Myristoyl-Coa:protein N- Myristoyltransferase. Length = 496 | Back alignment and structure |
| >pdb|3IU1|A Chain A, Crystal Structure Of Human Type-I N-Myristoyltransferase With Bound Myristoyl-Coa Length = 383 | Back alignment and structure |
| >pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 | Back alignment and structure |
| >pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 | Back alignment and structure |
| >pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 | Back alignment and structure |
| >pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 | Back alignment and structure |
| >pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 | Back alignment and structure |
| >pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 | Back alignment and structure |
| >pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 | Back alignment and structure |
| >pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 | Back alignment and structure |
| >pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 | Back alignment and structure |
| >pdb|4B10|A Chain A, Plasmodium Vivax N-Myristoyltransferase With A Non- Hydrolysable Co-Factor Length = 385 | Back alignment and structure |
| >pdb|4A95|A Chain A, Plasmodium Vivax N-Myristoyltransferase With Quinoline Inhibitor Length = 384 | Back alignment and structure |
| >pdb|2P6E|A Chain A, Crystal Structures Of Saccharomyces Cerevisiae N-Myristoyltransferase With Bound Myristoyl-Coa Length = 455 | Back alignment and structure |
| >pdb|2NMT|A Chain A, Myristoyl-Coa:protein N-Myristoyltransferase Bound To Myristoyl-Coa And Peptide Analogs Length = 422 | Back alignment and structure |
| >pdb|2WUU|A Chain A, Structure Of N-Myristoyltransferase From L. Donovani Length = 421 | Back alignment and structure |
| >pdb|2WSA|A Chain A, Crystal Structure Of Leishmania Major N- Myristoyltransferase (Nmt) With Bound Myristoyl-Coa And A Pyrazole Sulphonamide Ligand (Ddd85646) Length = 438 | Back alignment and structure |
| >pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 | Back alignment and structure |
| >pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 | Back alignment and structure |
| >pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 | Back alignment and structure |
| >pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 | Back alignment and structure |
| >pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 | Back alignment and structure |
| >pdb|3H5Z|A Chain A, Crystal Structure Of Leishmania Major N-Myristoyltransferase With Bound Myristoyl-Coa Length = 438 | Back alignment and structure |
| >pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 | Back alignment and structure |
| >pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 | Back alignment and structure |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 | Back alignment and structure |
| >pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 | Back alignment and structure |
| >pdb|1NMT|A Chain A, N-Myristoyl Transferase From Candida Albicans At 2.45 A Length = 392 | Back alignment and structure |
| >pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 | Back alignment and structure |
|---|
Score = 537 bits (1385), Expect = 0.0
Identities = 244/256 (95%), Positives = 249/256 (97%)
Query: 329 EILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVET 388
EIL KESNVQEV+CPVTVCGDVHGQFHDLMELF+IGGKSPDTNYLFMGDYVDRGYYSVET
Sbjct: 37 EILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVET 96
Query: 389 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLT 448
VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWK+FTDLFDYLPLT
Sbjct: 97 VTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT 156
Query: 449 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 508
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA
Sbjct: 157 ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGA 216
Query: 509 GYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 568
GYTFGQDISETFNH+NGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM
Sbjct: 217 GYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM 276
Query: 569 ELDDGLKYSLPLGNPC 584
ELDD LKYS +P
Sbjct: 277 ELDDTLKYSFLQFDPA 292
|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 | Back alignment and structure |
|---|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Length = 496 | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Length = 383 | Back alignment and structure |
|---|
| >4a95_A Glycylpeptide N-tetradecanoyltransferase; malaria; HET: 9MT NHM; 1.55A {Plasmodium vivax} Length = 384 | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Length = 422 | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Length = 421 | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Length = 392 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 586 | |||
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 100.0 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 100.0 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 100.0 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 100.0 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 100.0 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 100.0 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 100.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 100.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 100.0 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 100.0 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 100.0 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 100.0 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 100.0 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 100.0 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 100.0 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 99.96 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 99.89 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 99.78 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 99.6 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 99.58 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 99.54 | |
| 1s3l_A | 190 | Hypothetical protein MJ0936; phosphodiesterase, nu | 98.93 | |
| 1uf3_A | 228 | Hypothetical protein TT1561; metallo-dependent pho | 98.91 | |
| 1su1_A | 208 | Hypothetical protein YFCE; structural genomics, ph | 98.75 | |
| 2a22_A | 215 | Vacuolar protein sorting 29; alpha-beta-BETA-alpha | 98.71 | |
| 2yvt_A | 260 | Hypothetical protein AQ_1956; structural genomics, | 98.64 | |
| 3ck2_A | 176 | Conserved uncharacterized protein (predicted phosp | 98.64 | |
| 1z2w_A | 192 | Vacuolar protein sorting 29; VPS29, retromer, phos | 98.57 | |
| 1xm7_A | 195 | Hypothetical protein AQ_1665; structural genomics, | 98.55 | |
| 2kkn_A | 178 | Uncharacterized protein; protein phosphatase 2A ho | 98.51 | |
| 3ib7_A | 330 | ICC protein; metallophosphoesterase, alpha-beta fo | 98.3 | |
| 3d03_A | 274 | Phosphohydrolase; glycerophosphodiesterase, metall | 98.18 | |
| 2xmo_A | 443 | LMO2642 protein; phosphodiesterase, hydrolase; 1.7 | 97.97 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 97.91 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 97.85 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 97.8 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 97.75 | |
| 3rl5_A | 296 | Metallophosphoesterase mpped2; alpha-beta fold, me | 97.65 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 97.46 | |
| 2nxf_A | 322 | Putative dimetal phosphatase; dinuclear metal cent | 97.32 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 97.3 | |
| 3av0_A | 386 | DNA double-strand break repair protein MRE11; DNA | 97.29 | |
| 1ii7_A | 333 | MRE11 nuclease; RAD50, DNA double-strand break rep | 97.26 | |
| 2q8u_A | 336 | Exonuclease, putative; structural genomics, joint | 97.24 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 97.05 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 96.99 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 96.91 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 96.87 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 96.72 | |
| 3tho_B | 379 | Exonuclease, putative; adenosine triphosphate, bac | 96.63 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 96.62 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 96.57 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 96.53 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 96.51 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 96.5 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 96.49 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 96.25 | |
| 3t1i_A | 431 | Double-strand break repair protein MRE11A; DNA rep | 96.25 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 96.2 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 96.16 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 96.11 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 96.08 | |
| 4fbw_A | 417 | DNA repair protein RAD32; DNA double-strand break | 96.06 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 96.02 | |
| 4fbk_A | 472 | DNA repair and telomere maintenance protein NBS1, | 96.01 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 96.01 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 95.93 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 95.93 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 95.9 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 95.89 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 95.89 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 95.88 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 95.85 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 95.81 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 95.79 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 95.77 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 95.76 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 95.76 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 95.73 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 95.66 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 95.63 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 95.63 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 95.55 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 95.51 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 95.43 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 95.42 | |
| 1ute_A | 313 | Protein (II purple acid phosphatase); tartrate res | 95.42 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 95.39 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 95.35 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 95.32 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 95.26 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 95.21 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 95.2 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 95.16 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 94.9 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 94.89 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 94.81 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 94.78 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 94.76 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 94.69 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 94.68 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 94.68 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 94.66 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 94.66 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 94.65 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 94.64 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 94.58 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 94.58 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 94.55 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 94.46 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 94.45 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 94.39 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 94.39 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 94.38 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 94.36 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 94.27 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 94.2 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 94.17 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 94.14 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 94.11 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 94.09 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 94.04 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 93.96 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 93.94 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 93.92 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 93.81 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 93.81 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 93.73 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 93.72 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 93.71 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 93.68 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 93.66 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 93.64 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 93.54 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 93.54 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 93.53 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 93.41 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 93.27 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 93.2 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 93.16 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 93.11 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 93.03 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 93.01 | |
| 3tgh_A | 342 | Glideosome-associated protein 50; phosphatase fold | 93.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 92.86 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 92.85 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 92.8 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 92.62 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 92.58 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 92.35 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 92.31 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 92.13 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 91.96 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 91.91 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 91.83 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 91.83 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 91.69 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 91.62 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 91.45 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 91.44 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 91.41 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 91.19 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 91.16 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 90.94 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 90.92 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 90.87 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 90.63 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 90.28 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 90.18 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 90.09 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 90.08 | |
| 3qfk_A | 527 | Uncharacterized protein; structural genomics, cent | 89.93 | |
| 1hp1_A | 516 | 5'-nucleotidase; metallophosphatase, dinuclear, me | 89.78 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 89.73 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 89.64 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 89.53 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 89.41 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 89.36 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 88.89 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 88.82 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 88.4 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 87.92 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 87.78 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 87.2 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 87.14 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 86.71 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 86.6 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 86.15 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 86.03 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 85.97 | |
| 2z1a_A | 552 | 5'-nucleotidase; metal-binding, nucleotide-binding | 85.37 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 85.35 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 84.42 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 84.12 | |
| 1t71_A | 281 | Phosphatase, conserved HYPO; crystal, X-RAY crysta | 83.95 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 83.2 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 82.95 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 82.57 | |
| 3ztv_A | 579 | NAD nucleotidase, NADN; hydrolase, NAD pyrophospha | 82.05 | |
| 3ive_A | 509 | Nucleotidase; structural genomics, PSI-2, protein | 81.51 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 81.02 | |
| 3jyf_A | 339 | 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n | 80.32 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 80.1 |
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-116 Score=908.96 Aligned_cols=286 Identities=66% Similarity=1.166 Sum_probs=276.4
Q ss_pred ccccccccccCCCCCCCcCcCCCccCCCCCCccCCCCCCCCCCceEEeCCCCChhHHHHHHHhhhcccccCCCcc-----
Q psy14920 59 KQYQFWSTQPVPKIDEKITTNGPIELDKSPSEIRAEPYSLPPGFQWDTLNLDDPLVLEELYKLLNENYVEDEDSM----- 133 (586)
Q Consensus 59 ~~~~fw~tqpv~~~~~~~~~~g~i~~~~~~~~~~~~p~~lp~~f~w~~~d~~~~~~~~~~~~ll~~~yved~~~~----- 133 (586)
++||||+||||||++|.+.++|||++++ ++||+|||+||+||||++||++|+++++|||+||++|||||||+|
T Consensus 2 ~~~kFW~TQPV~~~~~~~~~~gpI~~~~--~~v~~ep~~Lp~gFeW~~~dl~~~~~l~ely~lL~~nYVEDdd~~FRF~Y 79 (383)
T 3iu1_A 2 RSYQFWDTQPVPKLGEVVNTHGPVEPDK--DNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDY 79 (383)
T ss_dssp CCCTTGGGSSSCCTTCCCCCCBCSSCCC--SSCCCSCCCCCTTEEEEECCTTSHHHHHHHHHHHHHHSCBCTTSCEEECC
T ss_pred CCCccccCCcCCCCCCccCCCCCCCCCh--hhccCCCCCCCCCCEEEecCCCCHHHHHHHHHHHHhccccCCcceEEeeC
Confidence 5799999999999999988899999876 899999999999999999999999999999999999999999997
Q ss_pred -------ceeCCCcceeeeeEEEeecCCeEEEEEeeeeeEEEEeceEeeeeeEEEEeeeccccccCchhHHHHHHHhhhc
Q psy14920 134 -------ALQAPGWCKEWHCGVRVSKSNVLVAFISAIPATLSIYGVSQKMVEINFLCVHKKLRSKRVAPVLIREITRRVN 206 (586)
Q Consensus 134 -------al~~pg~~~~w~~gvr~~~~~klv~fi~~~p~~~~v~~~~~~~~~inflcvhkklR~krlap~li~Eitrr~~ 206 (586)
||+||||.++||||||++++|||||||||||++|||++++++|+|||||||||||||||||||||||||||||
T Consensus 80 S~efL~WaL~pPg~~~~whvGVR~~~s~kLVgfIsaiP~~irv~~~~~~~~eINFLCVhKkLRsKrLAPvLIkEITRRvn 159 (383)
T 3iu1_A 80 SPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVH 159 (383)
T ss_dssp CHHHHHHHHSSTTCCGGGEEEEEETTTCCEEEEEEEEEEEEEETTEEEEEEEEEEEEECGGGTTSSHHHHHHHHHHHHHH
T ss_pred CHHHHHHhccCCCCCcceEEEEEEccCCeEEEEEecceEEEEEcceEeeeeEEEEEEEcHhHHhCCCcHHHHHHHHHHhh
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCceeeehhcCccCCCccccccccccCCCccccccccCCCCCccchHHHHHHhcCCCCCCCcCCCcccccCChhHHHHH
Q psy14920 207 LKGLFQAVYTAGVVLPKPVGTCRYWHRSLNPKKLIEVKFSHLSRNMTMKRTLKLYGLPETTKVFGFRPLQEADIPKAHKV 286 (586)
Q Consensus 207 ~~~i~qa~yt~g~~lp~p~~~~~y~hr~ln~~kL~~~~fs~~~~~~t~~~~~~~~~lp~~~~~~glR~m~~~Dv~~v~~L 286 (586)
++|||||+||||++||+|||+||||||+|||+||+++|||+++++|||+|++|+|+||+.|+++|+|+|+++|+|+|++|
T Consensus 160 ~~gI~qAvYTag~vLP~PvstcrY~HR~LN~kKL~evgFs~l~~~~t~~r~ik~y~lP~~~~t~glR~m~~~Dv~~v~~L 239 (383)
T 3iu1_A 160 LEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQL 239 (383)
T ss_dssp TTTCCCEEEEESSCCSCCSEEEEEEEEESSHHHHHHTTSSCC--CCCHHHHHHHHCCCSSCCSTTEEECCGGGHHHHHHH
T ss_pred hcchhhheeecceecCCCceeeeeeeeECCHHHHhhcCCCcCCCCCCHHHHHHhccCCCCCCCCCcccCchhhHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhhcCCCcccChhhhhcccCCCCCceeEEEeec-cchhhhhcccCCceeeeccceEEecC-CCC
Q psy14920 287 LCEFFLRFDLAPIFSEEEFKHWFLPRDGIVYTFVVEN-DGEITEILAKESNVQEVKCPVTVCGD-VHG 352 (586)
Q Consensus 287 l~~yl~~f~l~p~fs~eev~Hwflp~~~Vv~syVve~-~~~itd~~s~ep~ll~~~~p~~v~gd-iHG 352 (586)
|++|+++|+++|.||+||++|||+|+++|+||||+|+ .++||||+|+ +.+|++|+|. -|.
T Consensus 240 l~~yl~~f~l~~~ft~eev~Hw~lp~~~Vi~syVve~~~g~ITDf~SF------Y~Lpstvl~~~~~~ 301 (383)
T 3iu1_A 240 LTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSF------YTLPSTIMNHPTHK 301 (383)
T ss_dssp HHHHGGGSSEEEECCHHHHHHHHSCC-CCEEEEEEECTTSCEEEEEEE------EECCEEETTCSSCC
T ss_pred HHHHHHhCCCeeeCCHHHhhhhcccCCCeEEEEEEECCCCcEeeEEEE------EEccceecCCCCcc
Confidence 9999999999999999999999999999999999997 4899999998 9999999986 344
|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* | Back alignment and structure |
|---|
| >1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A | Back alignment and structure |
|---|
| >1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A | Back alignment and structure |
|---|
| >1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 | Back alignment and structure |
|---|
| >2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A | Back alignment and structure |
|---|
| >3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A | Back alignment and structure |
|---|
| >2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* | Back alignment and structure |
|---|
| >1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A | Back alignment and structure |
|---|
| >2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* | Back alignment and structure |
|---|
| >3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 586 | ||||
| d3c5wc1 | 288 | d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt | 1e-121 | |
| d3c5wc1 | 288 | d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt | 2e-06 | |
| d1auia_ | 473 | d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc | 1e-111 | |
| d1jk7a_ | 294 | d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human | 1e-109 | |
| d1s95a_ | 324 | d.159.1.3 (A:) Serine/threonine protein phosphatas | 1e-107 | |
| d1iica1 | 185 | d.108.1.2 (A:34-218) N-myristoyl transferase, NMT | 4e-88 | |
| d1iyka1 | 165 | d.108.1.2 (A:60-224) N-myristoyl transferase, NMT | 1e-78 | |
| d1rxta1 | 141 | d.108.1.2 (A:78-218) N-myristoyl transferase, NMT | 2e-68 | |
| d1rxta2 | 201 | d.108.1.2 (A:219-455) N-myristoyl transferase, NMT | 7e-46 | |
| d1iyka2 | 227 | d.108.1.2 (A:225-451) N-myristoyl transferase, NMT | 3e-45 | |
| d1iica2 | 237 | d.108.1.2 (A:219-455) N-myristoyl transferase, NMT | 3e-44 | |
| d1nnwa_ | 251 | d.159.1.5 (A:) Hypothetical protein PF1291 {Archae | 8e-14 | |
| d1g5ba_ | 219 | d.159.1.3 (A:) lambda ser/thr protein phosphatase | 4e-13 | |
| d2i00a2 | 291 | d.108.1.10 (A:10-300) Putative acetyltransferase E | 9e-09 | |
| d1su1a_ | 184 | d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia | 2e-06 |
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 357 bits (918), Expect = e-121
Identities = 243/252 (96%), Positives = 248/252 (98%)
Query: 326 EITEILAKESNVQEVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYS 385
+ EIL KESNVQEV+CPVTVCGDVHGQFHDLMELF+IGGKSPDTNYLFMGDYVDRGYYS
Sbjct: 29 KAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYS 88
Query: 386 VETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYL 445
VETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWK+FTDLFDYL
Sbjct: 89 VETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 148
Query: 446 PLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISP 505
PLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISP
Sbjct: 149 PLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISP 208
Query: 506 RGAGYTFGQDISETFNHSNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQA 565
RGAGYTFGQDISETFNH+NGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQA
Sbjct: 209 RGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQA 268
Query: 566 AIMELDDGLKYS 577
AIMELDD LKYS
Sbjct: 269 AIMELDDTLKYS 280
|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Length = 165 | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Length = 201 | Back information, alignment and structure |
|---|
| >d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Length = 227 | Back information, alignment and structure |
|---|
| >d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291 | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 586 | |||
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 100.0 | |
| d1jk7a_ | 294 | Protein phosphatase-1 (PP-1) {Human (Homo sapiens) | 100.0 | |
| d3c5wc1 | 288 | Protein phosphatase 2A catalytic subunit alpha iso | 100.0 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 100.0 | |
| d1s95a_ | 324 | Serine/threonine protein phosphatase 5, PP5 {Human | 100.0 | |
| d1auia_ | 473 | Protein phosphatase-2B (PP-2B, calcineurin A subun | 100.0 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 100.0 | |
| d1rxta2 | 201 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 100.0 | |
| d1iica2 | 237 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 100.0 | |
| d1iyka2 | 227 | N-myristoyl transferase, NMT {Yeast (Candida albic | 100.0 | |
| d1g5ba_ | 219 | lambda ser/thr protein phosphatase {Bacteriophage | 99.83 | |
| d1nnwa_ | 251 | Hypothetical protein PF1291 {Archaeon Pyrococcus f | 99.68 | |
| d1uf3a_ | 228 | Hypothetical protein TT1561 {Thermus thermophilus | 99.29 | |
| d1s3la_ | 165 | Putative phosphodiesterase MJ0936 {Methanococcus j | 98.87 | |
| d1su1a_ | 184 | Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 | 98.74 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.7 | |
| d2a22a1 | 193 | Vacuolar protein sorting 29, VPS29 {Cryptosporidiu | 98.62 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.57 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.54 | |
| d1z2wa1 | 182 | Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus | 98.52 | |
| d2yvta1 | 257 | Uncharacterized protein Aq_1956 {Aquifex aeolicus | 98.47 | |
| d3ck2a1 | 173 | Uncharacterized protein SP1879 {Streptococcus pneu | 98.45 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 97.69 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 97.52 | |
| d1ii7a_ | 333 | Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.36 | |
| d3d03a1 | 271 | Glycerophosphodiesterase GpdQ {Enterobacter aeroge | 97.13 | |
| d2hy1a1 | 256 | Rv0805 cyclic nucleotide phosphodiesterase {Mycoba | 97.07 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 96.98 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 96.97 | |
| d1xm7a_ | 188 | Hypothetical protein aq_1666 {Aquifex aeolicus [Ta | 96.93 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 96.82 | |
| d3c5wc1 | 288 | Protein phosphatase 2A catalytic subunit alpha iso | 96.48 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 96.05 | |
| d2nxfa1 | 320 | Uncharacterized C17orf48 homolog zgc:64213 {Zebraf | 95.88 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 95.48 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 95.46 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 95.15 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 95.14 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 95.02 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 94.85 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 94.57 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 94.53 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 94.37 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 94.37 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 94.27 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 93.98 | |
| d1utea_ | 302 | Mammalian purple acid phosphatase {Pig (Sus scrofa | 93.84 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 93.39 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 93.23 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 93.22 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 93.09 | |
| d1jk7a_ | 294 | Protein phosphatase-1 (PP-1) {Human (Homo sapiens) | 92.9 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 92.73 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 92.6 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 92.55 | |
| d2qfra2 | 312 | Plant purple acid phosphatase, catalytic domain {K | 92.46 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 92.17 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 91.82 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 91.15 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 91.03 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 90.91 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 90.86 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 90.72 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 89.76 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 89.61 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 88.76 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 88.38 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 87.43 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 86.97 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 86.37 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 86.27 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 85.25 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 83.22 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 82.37 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 81.95 |
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-myristoyl transferase, NMT domain: N-myristoyl transferase, NMT species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=2.3e-72 Score=534.93 Aligned_cols=172 Identities=56% Similarity=0.994 Sum_probs=168.6
Q ss_pred hccccccccccCCCCCCCcCcCCCccCCCCCCccCCCCCCCCCCceEEeCCCCChhHHHHHHHhhhcccccCCCcc----
Q psy14920 58 QKQYQFWSTQPVPKIDEKITTNGPIELDKSPSEIRAEPYSLPPGFQWDTLNLDDPLVLEELYKLLNENYVEDEDSM---- 133 (586)
Q Consensus 58 ~~~~~fw~tqpv~~~~~~~~~~g~i~~~~~~~~~~~~p~~lp~~f~w~~~d~~~~~~~~~~~~ll~~~yved~~~~---- 133 (586)
+++|+||+||||+++++...++|||++++++++++++||+||+||+|++||++|+++++|||+||++|||||||+|
T Consensus 2 ~~~hkFW~tQPV~~~~~~~~~~G~I~~~~~~~~v~~~p~~Lp~~f~w~~~d~~d~~~l~el~~lL~~nYved~d~~frf~ 81 (185)
T d1iica1 2 MKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFN 81 (185)
T ss_dssp CSCCTTGGGSSCCCTTCCCSSCEESSCCCCGGGSCSSCCCCCTTEEEEECCTTCHHHHHHHHHHHHHHSSSCGGGCEEEC
T ss_pred CccCCCcCcCCcCCCCcccCCCCccCCCCCHHHcccCCCcCCCCceEEeeccCCHHHHHHHHHHHHhhccccccceEEee
Confidence 4689999999999999988889999999999999999999999999999999999999999999999999999985
Q ss_pred --------ceeCCCcceeeeeEEEeecCCeEEEEEeeeeeEEEEeceEeeeeeEEEEeeeccccccCchhHHHHHHHhhh
Q psy14920 134 --------ALQAPGWCKEWHCGVRVSKSNVLVAFISAIPATLSIYGVSQKMVEINFLCVHKKLRSKRVAPVLIREITRRV 205 (586)
Q Consensus 134 --------al~~pg~~~~w~~gvr~~~~~klv~fi~~~p~~~~v~~~~~~~~~inflcvhkklR~krlap~li~Eitrr~ 205 (586)
||.+|||.++||+|||++++|||||||||+|++|+|++++++|+||||||||||+|+|||||+||+|||||+
T Consensus 82 Ys~~~l~w~l~~Pg~~~~~~igvr~~~~~KLvg~Is~~P~~i~i~~~~~~~~~VnFLCVhkk~R~K~lAPvLI~EitRr~ 161 (185)
T d1iica1 82 YTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRV 161 (185)
T ss_dssp CCHHHHHHHHCSTTCCGGGEEEEEETTTCCEEEEEEEEEEEEEETTEEEEEEEEEEEEECGGGTTSSCHHHHHHHHHHHH
T ss_pred cCHHHheeeecCCCCCcCCEEEEEEccCCcEEEEEeeeEEEEEEcCeEEEEEEEEEEEEchhHhhcCCcHHHHHHHHHHh
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCceeeehhcCccCCCcccccc
Q psy14920 206 NLKGLFQAVYTAGVVLPKPVGTCR 229 (586)
Q Consensus 206 ~~~~i~qa~yt~g~~lp~p~~~~~ 229 (586)
|++|||||+||||++||+|||+||
T Consensus 162 n~~~i~qavyt~~~~lp~p~~~~r 185 (185)
T d1iica1 162 NKCDIWHALYTAGIVLPAPVSTCR 185 (185)
T ss_dssp HTTTCCCEEEEESSCCSCCSEEEE
T ss_pred cccCeEEEEEecCcccCCcccccC
Confidence 999999999999999999999997
|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} | Back information, alignment and structure |
|---|
| >d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|