Psyllid ID: psy14926

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLATGRSNFADSLHNL
cHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHcccccccEEEEccccccccEEcccccccHHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHcccHHHHHHHcccccccEEEcccccccHHHHHHccccccccc
ccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEEccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHEEccccccccEHccccHHHHHHHHHHHHHcc
MFTADFFLIYLQVIARRQDLKLIVTSAtmdadkfsnffgnvptfhipgrtfpvdvffaknpvedYVDSAVKQALQIhlipnpdqkypwpcfqkvrfgrysgpklryLGLCIEKAQKELALFttlplatgrsnfadSLHNL
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHlipnpdqkypwPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTtlplatgrsnfadslhnl
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLATGRSNFADSLHNL
**TADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLAT************
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSG*********IEKAQKELALFTTLPLATGRSNFAD*L***
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLATGRSNFADSLHNL
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLATGRSNFADSLHNL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPNPDQKYPWPCFQKVRFGRYSGPKLRYLGLCIEKAQKELALFTTLPLATGRSNFADSLHNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q17R09 1227 Pre-mRNA-splicing factor yes N/A 0.55 0.062 0.688 9e-28
Q92620 1227 Pre-mRNA-splicing factor yes N/A 0.55 0.062 0.688 2e-27
P34498 1131 Probable pre-mRNA-splicin yes N/A 0.521 0.064 0.716 3e-25
Q9P774 1173 Pre-mRNA-splicing factor yes N/A 0.478 0.057 0.641 3e-22
P15938 1071 Pre-mRNA-splicing factor yes N/A 0.55 0.071 0.589 4e-21
O45244 1008 Probable pre-mRNA-splicin no N/A 0.528 0.073 0.52 6e-18
A2A4P0 1244 ATP-dependent RNA helicas no N/A 0.55 0.061 0.480 1e-16
Q14562 1220 ATP-dependent RNA helicas no N/A 0.585 0.067 0.463 1e-16
Q38953 1168 Probable pre-mRNA-splicin no N/A 0.521 0.062 0.534 2e-16
O42643 1168 Pre-mRNA-splicing factor no N/A 0.55 0.065 0.467 4e-16
>sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 Back     alignment and function desciption
 Score =  122 bits (305), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 53/77 (68%), Positives = 65/77 (84%)

Query: 6   FFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDY 65
            F +  +V+ARR DLKLIVTSATMDA+KF++FFGNVP FHIPGRTFPVD+ F+K P EDY
Sbjct: 664 LFGLLREVVARRSDLKLIVTSATMDAEKFASFFGNVPIFHIPGRTFPVDILFSKTPQEDY 723

Query: 66  VDSAVKQALQIHLIPNP 82
           V++AVKQ+LQ+HL   P
Sbjct: 724 VEAAVKQSLQVHLSGAP 740
Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 Back     alignment and function description
>sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 Back     alignment and function description
>sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 Back     alignment and function description
>sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
242012723 1186 pre-mRNA-splicing factor ATP-dependent R 0.55 0.064 0.753 3e-28
260798618 1218 hypothetical protein BRAFLDRAFT_117669 [ 0.535 0.061 0.773 1e-27
291239426 1227 PREDICTED: DEAH (Asp-Glu-Ala-His) box po 0.55 0.062 0.753 2e-27
427793631 1217 Putative mrna splicing factor atp-depend 0.557 0.064 0.743 2e-27
189235866 1186 PREDICTED: similar to pre-mRNA splicing 0.535 0.063 0.746 4e-27
195402095 1231 GJ14882 [Drosophila virilis] gi|19414735 0.542 0.061 0.723 1e-26
18859729 1222 lethal (1) G0007, isoform A [Drosophila 0.542 0.062 0.723 1e-26
195478521 1223 GE17127 [Drosophila yakuba] gi|194188071 0.542 0.062 0.723 1e-26
195352542 771 GM17663 [Drosophila sechellia] gi|194126 0.542 0.098 0.723 1e-26
194895146 1220 GG17834 [Drosophila erecta] gi|190649841 0.542 0.062 0.723 1e-26
>gi|242012723|ref|XP_002427077.1| pre-mRNA-splicing factor ATP-dependent RNA helicase prp16, putative [Pediculus humanus corporis] gi|212511335|gb|EEB14339.1| pre-mRNA-splicing factor ATP-dependent RNA helicase prp16, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 66/77 (85%)

Query: 6   FFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDY 65
            F +  ++IARR DLKLIVTSATMDA KFS FFGNVP+F IPGRTFPV++FF+KNPVEDY
Sbjct: 627 LFGLLREIIARRHDLKLIVTSATMDAGKFSTFFGNVPSFTIPGRTFPVELFFSKNPVEDY 686

Query: 66  VDSAVKQALQIHLIPNP 82
           VD+AVKQ LQIHL P P
Sbjct: 687 VDAAVKQTLQIHLQPTP 703

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|260798618|ref|XP_002594297.1| hypothetical protein BRAFLDRAFT_117669 [Branchiostoma floridae] gi|229279530|gb|EEN50308.1| hypothetical protein BRAFLDRAFT_117669 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|291239426|ref|XP_002739624.1| PREDICTED: DEAH (Asp-Glu-Ala-His) box polypeptide 38-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|427793631|gb|JAA62267.1| Putative mrna splicing factor atp-dependent rna helicase, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|189235866|ref|XP_969616.2| PREDICTED: similar to pre-mRNA splicing factor ATP-dependent RNA helicase PRP16 [Tribolium castaneum] gi|270004535|gb|EFA00983.1| hypothetical protein TcasGA2_TC003896 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195402095|ref|XP_002059645.1| GJ14882 [Drosophila virilis] gi|194147352|gb|EDW63067.1| GJ14882 [Drosophila virilis] Back     alignment and taxonomy information
>gi|18859729|ref|NP_572947.1| lethal (1) G0007, isoform A [Drosophila melanogaster] gi|16184298|gb|AAL13782.1| LD24737p [Drosophila melanogaster] gi|22832718|gb|AAF48351.2| lethal (1) G0007, isoform A [Drosophila melanogaster] gi|220947064|gb|ACL86075.1| l(1)G0007-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195478521|ref|XP_002100547.1| GE17127 [Drosophila yakuba] gi|194188071|gb|EDX01655.1| GE17127 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195352542|ref|XP_002042771.1| GM17663 [Drosophila sechellia] gi|194126802|gb|EDW48845.1| GM17663 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194895146|ref|XP_001978192.1| GG17834 [Drosophila erecta] gi|190649841|gb|EDV47119.1| GG17834 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
UNIPROTKB|I3LU50265 I3LU50 "Uncharacterized protei 0.542 0.286 0.697 3.6e-25
UNIPROTKB|E1C094 1164 E1C094 "Uncharacterized protei 0.542 0.065 0.710 1.9e-24
UNIPROTKB|F1NY80 1170 F1NY80 "Uncharacterized protei 0.542 0.064 0.710 2e-24
FB|FBgn0026713 1222 l(1)G0007 "lethal (1) G0007" [ 0.535 0.061 0.733 2.1e-24
UNIPROTKB|F1S3A8 766 DHX38 "Uncharacterized protein 0.542 0.099 0.697 4.1e-24
RGD|1310345 1228 Dhx38 "DEAH (Asp-Glu-Ala-His) 0.542 0.061 0.710 7.2e-24
ZFIN|ZDB-GENE-040426-1144 1258 dhx38 "DEAH (Asp-Glu-Ala-His) 0.514 0.057 0.736 7.4e-24
UNIPROTKB|F1MVJ1 1226 DHX38 "Pre-mRNA-splicing facto 0.542 0.061 0.697 9.1e-24
UNIPROTKB|Q17R09 1227 DHX38 "Pre-mRNA-splicing facto 0.542 0.061 0.697 9.2e-24
UNIPROTKB|E2RC56 1226 DHX38 "Uncharacterized protein 0.542 0.061 0.697 1.9e-23
UNIPROTKB|I3LU50 I3LU50 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 3.6e-25, P = 3.6e-25
 Identities = 53/76 (69%), Positives = 65/76 (85%)

Query:     7 FLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYV 66
             F +  +V+ARR DLKLIVTSATMDA+KF++FFGNVP FHIPGRTFPVD+ F+K P EDYV
Sbjct:    75 FGLLREVVARRSDLKLIVTSATMDAEKFASFFGNVPIFHIPGRTFPVDILFSKTPQEDYV 134

Query:    67 DSAVKQALQIHLIPNP 82
             ++AVKQ+LQ+HL   P
Sbjct:   135 EAAVKQSLQVHLSGAP 150
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|E1C094 E1C094 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY80 F1NY80 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0026713 l(1)G0007 "lethal (1) G0007" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3A8 DHX38 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310345 Dhx38 "DEAH (Asp-Glu-Ala-His) box polypeptide 38" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1144 dhx38 "DEAH (Asp-Glu-Ala-His) box polypeptide 38" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVJ1 DHX38 "Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R09 DHX38 "Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC56 DHX38 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q17R09PRP16_BOVIN3, ., 6, ., 4, ., 1, 30.68830.550.0627yesN/A
P34498MOG1_CAEEL3, ., 6, ., 4, ., 1, 30.71620.52140.0645yesN/A
P15938PRP16_YEAST3, ., 6, ., 4, ., 1, 30.58970.550.0718yesN/A
Q92620PRP16_HUMAN3, ., 6, ., 4, ., 1, 30.68830.550.0627yesN/A
Q9P774PRP16_SCHPO3, ., 6, ., 4, ., 1, 30.64170.47850.0571yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-26
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 8e-15
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-14
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 6e-08
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-05
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  103 bits (258), Expect = 1e-26
 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 3/78 (3%)

Query: 4   ADFFLIYL-QVIA-RRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNP 61
            D  L  L  ++A RR DLKLI+ SAT+DA++FS +FGN P   I GRT+PV++ +    
Sbjct: 178 TDILLGLLKDLLARRRDDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIRYLPEA 237

Query: 62  VEDY-VDSAVKQALQIHL 78
             DY +  A+  A+ IHL
Sbjct: 238 EADYILLDAIVAAVDIHL 255

Length = 845
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
KOG0922|consensus 674 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0923|consensus 902 100.0
KOG0924|consensus 1042 100.0
KOG0925|consensus 699 99.98
KOG0920|consensus 924 99.93
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.88
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.86
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.85
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.84
KOG0926|consensus 1172 99.79
KOG0921|consensus 1282 99.63
PHA02653 675 RNA helicase NPH-II; Provisional 99.58
PRK01172 674 ski2-like helicase; Provisional 98.02
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.48
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.76
PRK02362 737 ski2-like helicase; Provisional 96.42
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.28
PRK00254 720 ski2-like helicase; Provisional 96.04
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 95.82
PTZ00424401 helicase 45; Provisional 95.64
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 94.68
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 94.51
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 94.32
KOG0921|consensus 1282 94.21
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 94.15
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 94.12
PRK10689 1147 transcription-repair coupling factor; Provisional 93.95
COG1202 830 Superfamily II helicase, archaea-specific [General 93.84
PRK13767 876 ATP-dependent helicase; Provisional 93.66
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 93.55
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 93.35
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 93.12
PTZ00110 545 helicase; Provisional 93.1
PRK09694 878 helicase Cas3; Provisional 92.95
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 91.96
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 91.69
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 90.95
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.61
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 90.61
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 90.39
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 90.05
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 87.98
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 87.3
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 87.01
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 85.09
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 83.92
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 82.75
>KOG0922|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-39  Score=280.45  Aligned_cols=133  Identities=35%  Similarity=0.586  Sum_probs=114.1

Q ss_pred             ChhHHHHHHHHHHHHhCCCceEEEecCCCChHHHHhhhCCCCEEEecCCccccceeecCCCccchHHHHHHHHHHHhcCC
Q psy14926          1 MFTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIP   80 (140)
Q Consensus         1 l~tDllL~llk~~~~~r~dLklVlMSATld~~~f~~yf~~~pvi~i~G~~~pV~~~y~~~~~~d~v~~~~~~v~~i~~~~   80 (140)
                      ++||+|||+||+++++|+|||||+||||+|+++|++||++||++.||||+|||+++|++.+..||+++++.++++||.++
T Consensus       177 l~TDiLlGlLKki~~~R~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E  256 (674)
T KOG0922|consen  177 LHTDILLGLLKKILKKRPDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTE  256 (674)
T ss_pred             hHHHHHHHHHHHHHhcCCCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEeeCCCc-eeeccccCCchhhHHHHHHHhh--hhhhccCCCCCHHHHhhhcccc
Q psy14926         81 NPDQKYPWPCFQ-KVRFGRYSGPKLRYLGLCIEKA--QKELALFTTLPLATGRSNFADS  136 (140)
Q Consensus        81 ~~GdILVFl~~~-ei~~~~~~~~~~~~i~~~~~~~--~~~lpLh~~lp~~eQ~~~f~~~  136 (140)
                      ++|||||||||| ||+.+   +..+.+........  ..++|+||+||.++|.+||++.
T Consensus       257 ~~GDILvFLtGqeEIe~~---~~~l~e~~~~~~~~~~~~~lply~aL~~e~Q~rvF~p~  312 (674)
T KOG0922|consen  257 PPGDILVFLTGQEEIEAA---CELLRERAKSLPEDCPELILPLYGALPSEEQSRVFDPA  312 (674)
T ss_pred             CCCCEEEEeCCHHHHHHH---HHHHHHHhhhccccCcceeeeecccCCHHHhhccccCC
Confidence            999999999998 55432   12222221111000  1358999999999999999985

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-15
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-15
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (72%)
Query: 12  QVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVK 71
           QV+ RR DLK+I+ SAT+DA+KF  +F + P   +PGRT+PV++++      DY+DSA++
Sbjct: 233 QVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIR 292
Query: 72  QALQIH 77
             LQIH
Sbjct: 293 TVLQIH 298
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 6e-37
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 5e-17
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-06
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  132 bits (333), Expect = 6e-37
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 5   DFFLIYL-QVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVE 63
           D  +  L QV+ RR DLK+I+ SAT+DA+KF  +F + P   +PGRT+PV++++      
Sbjct: 225 DILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQR 284

Query: 64  DYVDSAVKQALQIHL 78
           DY+DSA++  LQIH 
Sbjct: 285 DYLDSAIRTVLQIHA 299
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.73
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.89
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.8
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.5
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.7
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.65
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.53
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.09
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.08
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.01
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.92
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 96.84
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.73
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 96.45
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 96.27
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.2
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 96.07
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 95.87
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 95.81
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 95.74
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 95.67
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 95.63
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.61
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 95.38
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 95.14
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.06
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.05
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.04
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 94.94
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 94.44
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 93.84
1yks_A 440 Genome polyprotein [contains: flavivirin protease 93.73
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 93.47
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 93.47
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 93.31
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 92.91
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 92.52
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 90.54
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 89.45
4gl2_A 699 Interferon-induced helicase C domain-containing P; 88.32
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 87.87
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 87.74
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 86.48
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 86.16
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 85.73
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 84.86
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 83.43
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 83.28
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 80.37
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=99.73  E-value=1.7e-17  Score=147.65  Aligned_cols=129  Identities=30%  Similarity=0.530  Sum_probs=107.4

Q ss_pred             hhHHHHHHHHHHHHhCCCceEEEecCCCChHHHHhhhCCCCEEEecCCccccceeecCCCccchHHHHHHHHHHHhcCCC
Q psy14926          2 FTADFFLIYLQVIARRQDLKLIVTSATMDADKFSNFFGNVPTFHIPGRTFPVDVFFAKNPVEDYVDSAVKQALQIHLIPN   81 (140)
Q Consensus         2 ~tDllL~llk~~~~~r~dLklVlMSATld~~~f~~yf~~~pvi~i~G~~~pV~~~y~~~~~~d~v~~~~~~v~~i~~~~~   81 (140)
                      ++|.++++++++...++++++|+||||+|.+.|++||++++++.++|+.|||+++|.+.+..+++..++..+.+++....
T Consensus       223 d~d~~~~~l~~l~~~~~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~  302 (773)
T 2xau_A          223 ATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEE  302 (773)
T ss_dssp             HHHHHHHHHHHHHHHCTTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSC
T ss_pred             chHHHHHHHHHHHHhCCCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcC
Confidence            67899999999999999999999999999999999999999999999999999999998889999999999999988777


Q ss_pred             CCcEEeeCCCc-eeeccccCCchhhHHHHHHH--------hhhhhhccCCCCCHHHHhhhcccc
Q psy14926         82 PDQKYPWPCFQ-KVRFGRYSGPKLRYLGLCIE--------KAQKELALFTTLPLATGRSNFADS  136 (140)
Q Consensus        82 ~GdILVFl~~~-ei~~~~~~~~~~~~i~~~~~--------~~~~~lpLh~~lp~~eQ~~~f~~~  136 (140)
                      +|++|||.+++ +++..      ...+.....        ....+.++||.+|.++|+++|.+-
T Consensus       303 ~g~iLVF~~~~~~i~~l------~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f  360 (773)
T 2xau_A          303 AGDILLFLTGEDEIEDA------VRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPA  360 (773)
T ss_dssp             SCEEEEECSCHHHHHHH------HHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCC
T ss_pred             CCCEEEECCCHHHHHHH------HHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhc
Confidence            89999997654 55332      111221110        123367899999999999999763
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.55
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 93.15
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 90.47
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 84.51
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 84.32
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=96.55  E-value=0.0015  Score=46.20  Aligned_cols=37  Identities=14%  Similarity=0.232  Sum_probs=28.3

Q ss_pred             HHHHHHHhCCCceEEEecCCC-ChHHHHhhhCCCCEEEe
Q psy14926          9 IYLQVIARRQDLKLIVTSATM-DADKFSNFFGNVPTFHI   46 (140)
Q Consensus         9 llk~~~~~r~dLklVlMSATl-d~~~f~~yf~~~pvi~i   46 (140)
                      ++..+....++.++|+||||+ |.+.|++|++ ++.+..
T Consensus       162 ~l~~i~~~~~~~~~l~lSATl~n~~~~~~~l~-~~~~~s  199 (202)
T d2p6ra3         162 LVTKMRRMNKALRVIGLSATAPNVTEIAEWLD-ADYYVS  199 (202)
T ss_dssp             HHHHHHHHCTTCEEEEEECCCTTHHHHHHHTT-CEEEEC
T ss_pred             HHHHHHhcCCCCcEEEEcCCCCcHHHHHHHcC-CCeeeC
Confidence            445555567899999999997 8999999997 444433
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure