Psyllid ID: psy15093
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 195167158 | 263 | GL15013 [Drosophila persimilis] gi|19846 | 0.927 | 0.631 | 0.813 | 9e-78 | |
| 195478444 | 261 | GE16136 [Drosophila yakuba] gi|194188044 | 0.927 | 0.636 | 0.813 | 2e-77 | |
| 195352478 | 261 | GM17583 [Drosophila sechellia] gi|195566 | 0.927 | 0.636 | 0.813 | 2e-77 | |
| 194895286 | 261 | GG19483 [Drosophila erecta] gi|190649870 | 0.927 | 0.636 | 0.813 | 2e-77 | |
| 18859677 | 260 | chloride intracellular channel, isoform | 0.927 | 0.638 | 0.813 | 2e-77 | |
| 195059275 | 263 | GH17841 [Drosophila grimshawi] gi|193896 | 0.927 | 0.631 | 0.807 | 3e-77 | |
| 195392712 | 263 | GJ19132 [Drosophila virilis] gi|19414951 | 0.927 | 0.631 | 0.801 | 3e-77 | |
| 195448352 | 262 | GK25045 [Drosophila willistoni] gi|19416 | 0.927 | 0.633 | 0.807 | 4e-77 | |
| 194769412 | 261 | GF19090 [Drosophila ananassae] gi|190618 | 0.927 | 0.636 | 0.807 | 7e-77 | |
| 442616297 | 261 | chloride intracellular channel, isoform | 0.927 | 0.636 | 0.813 | 2e-76 |
| >gi|195167158|ref|XP_002024401.1| GL15013 [Drosophila persimilis] gi|198469067|ref|XP_001354897.2| GA10697 [Drosophila pseudoobscura pseudoobscura] gi|194107774|gb|EDW29817.1| GL15013 [Drosophila persimilis] gi|198146701|gb|EAL31953.2| GA10697 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Score = 294 bits (753), Expect = 9e-78, Method: Compositional matrix adjust.
Identities = 135/166 (81%), Positives = 149/166 (89%)
Query: 10 RTNFEATPPPILIDNGLAVLENEKIERHIMKNVPGGHNLFVQDKEVATLIENLYSKLKLM 69
RTNFEAT PPILIDNGLA+LENEKIERHIMKN+PGG+NLFVQDKEVATLIENLY KLKLM
Sbjct: 79 RTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLM 138
Query: 70 LLKKDDVSINALMSHLRKINDHLGRKETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQF 129
L+KKDD NAL+SHL+KINDHL + TRFLTGDTMCCFDCELMPRLQHIRVAG YF+ F
Sbjct: 139 LVKKDDAKNNALLSHLKKINDHLANRNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDF 198
Query: 130 EIPTYMKHLWHYMKHMYELEAFTQSCPADQDIINHYKLQQVWLMRR 175
EIPT++ LW YM HMY+L+AFTQSCPADQDIINHYKLQQ M++
Sbjct: 199 EIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSLKMKK 244
|
Source: Drosophila persimilis Species: Drosophila persimilis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195478444|ref|XP_002100520.1| GE16136 [Drosophila yakuba] gi|194188044|gb|EDX01628.1| GE16136 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195352478|ref|XP_002042739.1| GM17583 [Drosophila sechellia] gi|195566648|ref|XP_002106891.1| GD15871 [Drosophila simulans] gi|194126770|gb|EDW48813.1| GM17583 [Drosophila sechellia] gi|194204284|gb|EDX17860.1| GD15871 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|194895286|ref|XP_001978221.1| GG19483 [Drosophila erecta] gi|190649870|gb|EDV47148.1| GG19483 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|18859677|ref|NP_572928.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|168177177|pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster gi|7292935|gb|AAF48326.1| chloride intracellular channel, isoform A [Drosophila melanogaster] gi|16185715|gb|AAL13950.1| LD46306p [Drosophila melanogaster] gi|220946362|gb|ACL85724.1| Clic-PA [synthetic construct] gi|220956060|gb|ACL90573.1| Clic-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195059275|ref|XP_001995601.1| GH17841 [Drosophila grimshawi] gi|193896387|gb|EDV95253.1| GH17841 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195392712|ref|XP_002055001.1| GJ19132 [Drosophila virilis] gi|194149511|gb|EDW65202.1| GJ19132 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195448352|ref|XP_002071620.1| GK25045 [Drosophila willistoni] gi|194167705|gb|EDW82606.1| GK25045 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|194769412|ref|XP_001966798.1| GF19090 [Drosophila ananassae] gi|190618319|gb|EDV33843.1| GF19090 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|442616297|ref|NP_001259537.1| chloride intracellular channel, isoform B [Drosophila melanogaster] gi|440216756|gb|AGB95379.1| chloride intracellular channel, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| FB|FBgn0030529 | 260 | Clic "Chloride intracellular c | 0.927 | 0.638 | 0.765 | 9.2e-68 | |
| WB|WBGene00001365 | 290 | exc-4 [Caenorhabditis elegans | 0.519 | 0.320 | 0.473 | 1e-25 | |
| UNIPROTKB|E1C136 | 208 | CLIC5 "Uncharacterized protein | 0.379 | 0.326 | 0.382 | 2.2e-15 | |
| RGD|620659 | 251 | Clic5 "chloride intracellular | 0.407 | 0.290 | 0.346 | 1.4e-13 | |
| UNIPROTKB|E2RKS6 | 252 | CLIC5 "Uncharacterized protein | 0.402 | 0.285 | 0.333 | 4.5e-13 | |
| UNIPROTKB|F1P9H6 | 254 | CLIC5 "Uncharacterized protein | 0.402 | 0.283 | 0.333 | 4.9e-13 | |
| RGD|1306580 | 245 | Clic2 "chloride intracellular | 0.374 | 0.273 | 0.388 | 5.5e-13 | |
| UNIPROTKB|F1NYZ7 | 232 | CLIC4 "Uncharacterized protein | 0.357 | 0.275 | 0.375 | 6.8e-13 | |
| ZFIN|ZDB-GENE-030326-3 | 252 | clic4 "chloride intracellular | 0.379 | 0.269 | 0.376 | 7.6e-13 | |
| ZFIN|ZDB-GENE-041114-84 | 246 | zgc:101827 "zgc:101827" [Danio | 0.357 | 0.260 | 0.328 | 8.2e-13 |
| FB|FBgn0030529 Clic "Chloride intracellular channel" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 688 (247.2 bits), Expect = 9.2e-68, P = 9.2e-68
Identities = 127/166 (76%), Positives = 140/166 (84%)
Query: 10 RTNFEATPPPILIDNGLAVLENEKIERHIMKNVPGGHNLFVQDKEVATLIENLYSXXXXX 69
RTNFEAT PPILIDNGLA+LENEKIERHIMKN+PGG+NLFVQDKEVATLIENLY
Sbjct: 76 RTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLM 135
Query: 70 XXXXDDVSINALMSHLRKINDHLGRKETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQF 129
D+ NAL+SHLRKINDHL + TRFLTGDTMCCFDCELMPRLQHIRVAG YF+ F
Sbjct: 136 LVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDF 195
Query: 130 EIPTYMKHLWHYMKHMYELEAFTQSCPADQDIINHYKLQQVWLMRR 175
EIPT++ LW YM HMY+L+AFTQSCPADQDIINHYKLQQ M++
Sbjct: 196 EIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSLKMKK 241
|
|
| WB|WBGene00001365 exc-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C136 CLIC5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|620659 Clic5 "chloride intracellular channel 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKS6 CLIC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P9H6 CLIC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1306580 Clic2 "chloride intracellular channel 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYZ7 CLIC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030326-3 clic4 "chloride intracellular channel 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041114-84 zgc:101827 "zgc:101827" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| cd03198 | 119 | cd03198, GST_C_CLIC, C-terminal, alpha helical dom | 8e-54 | |
| cd10298 | 138 | cd10298, GST_C_CLIC2, C-terminal, alpha helical do | 3e-17 | |
| cd10299 | 133 | cd10299, GST_C_CLIC3, C-terminal, alpha helical do | 4e-15 | |
| cd10301 | 140 | cd10301, GST_C_CLIC6, C-terminal, alpha helical do | 9e-15 | |
| TIGR00862 | 236 | TIGR00862, O-ClC, intracellular chloride channel p | 2e-13 | |
| cd03201 | 121 | cd03201, GST_C_DHAR, C-terminal, alpha helical dom | 5e-13 | |
| cd10296 | 141 | cd10296, GST_C_CLIC4, C-terminal, alpha helical do | 7e-13 | |
| cd10297 | 141 | cd10297, GST_C_CLIC5, C-terminal, alpha helical do | 7e-13 | |
| PLN02378 | 213 | PLN02378, PLN02378, glutathione S-transferase DHAR | 9e-12 | |
| cd10300 | 139 | cd10300, GST_C_CLIC1, C-terminal, alpha helical do | 3e-11 | |
| PLN02817 | 265 | PLN02817, PLN02817, glutathione dehydrogenase (asc | 7e-09 | |
| cd03061 | 91 | cd03061, GST_N_CLIC, GST_N family, Chloride Intrac | 1e-06 |
| >gnl|CDD|198307 cd03198, GST_C_CLIC, C-terminal, alpha helical domain of Chloride Intracellular Channels | Back alignment and domain information |
|---|
Score = 166 bits (423), Expect = 8e-54
Identities = 49/119 (41%), Positives = 71/119 (59%), Gaps = 4/119 (3%)
Query: 52 DKEVATLIENLYSKLKLMLLKKDDVSI----NALMSHLRKINDHLGRKETRFLTGDTMCC 107
+ E T E+L++K + KD + AL+ L K++ +L +FL GDT+
Sbjct: 1 NPEANTAGEDLFAKFSAYIKNKDPAADEALRKALLKELSKLDAYLSSSSRKFLDGDTLTL 60
Query: 108 FDCELMPRLQHIRVAGSYFMQFEIPTYMKHLWHYMKHMYELEAFTQSCPADQDIINHYK 166
DC L+P+L HIRVAG + F+IP LW Y+K+ YE + FT++CPADQ+II HYK
Sbjct: 61 ADCNLLPKLHHIRVAGKAYKDFDIPDDFTGLWRYLKNAYETDEFTKTCPADQEIILHYK 119
|
Glutathione S-transferase (GST) C-terminal domain family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLICs (CLIC1-6 in vertebrates), p64, parchorin, and similar proteins. They are auto-inserting, self-assembling intracellular anion channels involved in a wide variety of functions including regulated secretion, cell division, and apoptosis. They can exist in both water-soluble and membrane-bound states and are found in various vesicles and membranes, and they may play roles in the maintenance of these intracellular membranes. Biochemical studies of the Caenorhabditis elegans homolog, EXC-4, show that the membrane localization domain is present in the N-terminal part of the protein. CLICs display structural plasticity, with CLIC1 adopting two soluble conformations. The structure of soluble human CLIC1 reveals that it is monomeric and adopts a fold similar to GSTs, containing an N-terminal domain with a thioredoxin fold and a C-terminal alpha helical domain. Upon oxidation, the N-terminal domain of CLIC1 undergoes a structural change to form a non-covalent dimer stabilized by the formation of an intramolecular disulfide bond between two cysteines that are far apart in the reduced form. The CLIC1 dimer bears no similarity to GST dimers. The redox-controlled structural rearrangement exposes a large hydrophobic surface, which is masked by dimerization in vitro. In vivo, this surface may represent the docking interface of CLIC1 in its membrane-bound state. The two cysteines in CLIC1 that form the disulfide bond in oxidizing conditions are essential for dimerization and chloride channel activity, however, in other subfamily members, the second cysteine is not conserved. Length = 119 |
| >gnl|CDD|198331 cd10298, GST_C_CLIC2, C-terminal, alpha helical domain of Chloride Intracellular Channel 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198332 cd10299, GST_C_CLIC3, C-terminal, alpha helical domain of Chloride Intracellular Channel 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198334 cd10301, GST_C_CLIC6, C-terminal, alpha helical domain of Chloride Intracellular Channel 6 | Back alignment and domain information |
|---|
| >gnl|CDD|129941 TIGR00862, O-ClC, intracellular chloride channel protein | Back alignment and domain information |
|---|
| >gnl|CDD|198310 cd03201, GST_C_DHAR, C-terminal, alpha helical domain of Dehydroascorbate Reductase | Back alignment and domain information |
|---|
| >gnl|CDD|198329 cd10296, GST_C_CLIC4, C-terminal, alpha helical domain of Chloride Intracellular Channel 4 | Back alignment and domain information |
|---|
| >gnl|CDD|198330 cd10297, GST_C_CLIC5, C-terminal, alpha helical domain of Chloride Intracellular Channel 5 | Back alignment and domain information |
|---|
| >gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >gnl|CDD|198333 cd10300, GST_C_CLIC1, C-terminal, alpha helical domain of Chloride Intracellular Channel 1 | Back alignment and domain information |
|---|
| >gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >gnl|CDD|239359 cd03061, GST_N_CLIC, GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 100.0 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.97 | |
| KOG1422|consensus | 221 | 99.97 | ||
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.97 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.97 | |
| KOG0406|consensus | 231 | 99.96 | ||
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.95 | |
| PLN02473 | 214 | glutathione S-transferase | 99.95 | |
| PLN02395 | 215 | glutathione S-transferase | 99.95 | |
| KOG0868|consensus | 217 | 99.95 | ||
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.94 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.94 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.94 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.94 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.93 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.93 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.92 | |
| KOG0867|consensus | 226 | 99.91 | ||
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.88 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.87 | |
| KOG4420|consensus | 325 | 99.85 | ||
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.84 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.83 | |
| KOG1695|consensus | 206 | 99.79 | ||
| PLN02907 | 722 | glutamate-tRNA ligase | 99.79 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.6 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.57 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.56 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.52 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.52 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 99.5 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.47 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.46 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.44 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.43 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.43 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.42 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.42 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.41 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.4 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.4 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.39 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.38 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.38 | |
| KOG2903|consensus | 319 | 99.37 | ||
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.35 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.35 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.34 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.34 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.33 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.32 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.3 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.3 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.3 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.28 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.28 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.27 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.26 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.26 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.26 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.24 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.24 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.23 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.23 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.22 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.18 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.18 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.18 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.18 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.15 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.13 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.13 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.12 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.11 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.1 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.09 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.08 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.06 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.06 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.05 | |
| KOG4244|consensus | 281 | 99.04 | ||
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.02 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.02 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.0 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.0 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.0 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 98.99 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.95 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 98.94 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 98.86 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 98.81 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.78 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 98.77 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 98.76 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.74 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 98.74 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 98.62 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.62 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.51 | |
| KOG3027|consensus | 257 | 98.34 | ||
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 98.3 | |
| KOG3029|consensus | 370 | 98.12 | ||
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 98.11 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 97.92 | |
| KOG3028|consensus | 313 | 97.86 | ||
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 97.21 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 97.08 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 96.8 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 95.35 | |
| KOG1147|consensus | 712 | 94.32 | ||
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 93.85 | |
| PF09635 | 122 | MetRS-N: MetRS-N binding domain; InterPro: IPR0182 | 92.64 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 92.52 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 91.05 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 90.59 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 90.13 | |
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 89.84 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 86.0 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 82.56 |
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-34 Score=224.15 Aligned_cols=168 Identities=25% Similarity=0.456 Sum_probs=140.7
Q ss_pred CCchhHhhhCCCCCCCeEEeCCeeeecHHHHHHHHHhhCCC--CCCCCCCchHHHHHHHHHHHHHHHHHcCCC----hHH
Q psy15093 4 TRDKKARTNFEATPPPILIDNGLAVLENEKIERHIMKNVPG--GHNLFVQDKEVATLIENLYSKLKLMLLKKD----DVS 77 (179)
Q Consensus 4 ~~~~~~~~~nP~g~vPvL~~~g~~l~ES~aI~~YL~~~~p~--~~~L~p~~~~~~~~~~~~~~~~~~~~~~~~----~~~ 77 (179)
.++++|+++||.|+||||+++|.+|+||.||++||+++|+. .|.+.|.++.......+++..+..++.+.. +..
T Consensus 45 ~~~~~fl~inP~g~vPvL~~~g~~l~ES~aI~eYL~e~~~~~~~p~l~p~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~ 124 (236)
T TIGR00862 45 RKPEDLQNLAPGTHPPFLTYNTEVKTDVNKIEEFLEETLCPPRYPKLSPKHPESNTAGLDIFAKFSAYIKNSNPEANDNL 124 (236)
T ss_pred CCCHHHHHHCcCCCCCEEEECCEEeecHHHHHHHHHHHcCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHcCCHHHHHHH
Confidence 45799999999999999999999999999999999999974 245667676655555567777766654432 223
Q ss_pred HHHHHHHHHHHHHHHcc----------------CCCceecCCCCChhhhhHhhHHHHHHHhhhcccCcccccccHHHHHH
Q psy15093 78 INALMSHLRKINDHLGR----------------KETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQFEIPTYMKHLWHY 141 (179)
Q Consensus 78 ~~~l~~~l~~le~~L~~----------------~~~~fl~Gd~~TlAD~~~~~~l~~~~~~~~~~~~~~~~~~~p~l~~w 141 (179)
.+++.+.++.||++|.+ .+++|++||++|+|||+++|++.++..+...+.+++++++||+|.+|
T Consensus 125 ~~~l~~~l~~Le~~L~~~~~~~~~~~~~~~~~~~~~~f~~Gd~~tlaD~~l~p~l~~l~~~~~~~~~~~i~~~~p~l~~w 204 (236)
T TIGR00862 125 EKGLLKALKKLDDYLNSPLPEEIDEDSAEDEKVSRRKFLDGDELTLADCNLLPKLHIVKVVAKKYRNFDIPAEFTGVWRY 204 (236)
T ss_pred HHHHHHHHHHHHHHHhccccccccccccccccccCCCcccCCccchhhHHHHHHHHHHHHHHHHHhCcCccccCchHHHH
Confidence 45688999999999973 14789999999999999999999998765666788888999999999
Q ss_pred HHHHhccccccccCCChHHHHHHHHhhhcc
Q psy15093 142 MKHMYELEAFTQSCPADQDIINHYKLQQVW 171 (179)
Q Consensus 142 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~ 171 (179)
+++|.+||+|+.+++..++|+.+|.++.++
T Consensus 205 ~~~~~~~~sf~~t~p~~~~i~~~~~~~~~~ 234 (236)
T TIGR00862 205 LSNAYAREEFTNTCPDDKEIELAYADVAKR 234 (236)
T ss_pred HHHHhccchHHhhCCChHHHHHHHHHHhhc
Confidence 999999999999999999999999988543
|
These proteins are thought to function in the regulation of the membrane potential and in transepithelial ion absorption and secretion in the kidney. |
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 179 | ||||
| 2yv7_A | 260 | Crystal Structure Of The Clic Homolog From Drosophi | 9e-75 | ||
| 2yv9_A | 291 | Crystal Structure Of The Clic Homologue Exc-4 From | 7e-24 | ||
| 2r4v_A | 247 | Structure Of Human Clic2, Crystal Form A Length = 2 | 8e-12 | ||
| 2per_A | 267 | Crystal Structure Of Human Chloride Intracellular C | 8e-12 | ||
| 2d2z_A | 261 | Crystal Structure Of Soluble Form Of Clic4 Length = | 6e-11 | ||
| 2ahe_A | 267 | Crystal Structure Of A Soluble Form Of Clic4. Inter | 8e-11 | ||
| 3tgz_A | 241 | Crystal Structure Analysis Of W35fH207W MUTANT OF H | 2e-09 | ||
| 3p90_A | 241 | Crystal Structure Analysis Of H207f Mutant Of Human | 3e-08 | ||
| 3swl_A | 236 | Crystal Structure Analysis Of H74a Mutant Of Human | 1e-07 | ||
| 3o3t_A | 241 | Crystal Structure Analysis Of M32a Mutant Of Human | 1e-07 | ||
| 1rk4_A | 243 | Crystal Structure Of A Soluble Dimeric Form Of Oxid | 1e-07 | ||
| 1k0o_A | 241 | Crystal Structure Of A Soluble Form Of Clic1. An In | 1e-07 | ||
| 3uvh_A | 241 | Crystal Structure Analysis Of E81m Mutant Of Human | 1e-07 | ||
| 3p8w_A | 241 | Crystal Structure Analysis Of R29mE81M DOUBLE MUTAN | 1e-07 | ||
| 3qr6_A | 241 | Crystal Structure Analysis Of H185f Mutant Of Human | 2e-07 | ||
| 4iqa_A | 236 | Crystal Structure Analysis Of The E228l Mutant Of H | 5e-07 | ||
| 3fy7_A | 250 | Crystal Structure Of Homo Sapiens Clic3 Length = 25 | 7e-07 |
| >pdb|2YV7|A Chain A, Crystal Structure Of The Clic Homolog From Drosophila Melanogaster Length = 260 | Back alignment and structure |
|
| >pdb|2YV9|A Chain A, Crystal Structure Of The Clic Homologue Exc-4 From C. Elegans Length = 291 | Back alignment and structure |
| >pdb|2R4V|A Chain A, Structure Of Human Clic2, Crystal Form A Length = 247 | Back alignment and structure |
| >pdb|2PER|A Chain A, Crystal Structure Of Human Chloride Intracellular Channel Protein 2 Length = 267 | Back alignment and structure |
| >pdb|2D2Z|A Chain A, Crystal Structure Of Soluble Form Of Clic4 Length = 261 | Back alignment and structure |
| >pdb|2AHE|A Chain A, Crystal Structure Of A Soluble Form Of Clic4. Intercellular Chloride Ion Channel Length = 267 | Back alignment and structure |
| >pdb|3TGZ|A Chain A, Crystal Structure Analysis Of W35fH207W MUTANT OF HUMAN CLIC1 Length = 241 | Back alignment and structure |
| >pdb|3P90|A Chain A, Crystal Structure Analysis Of H207f Mutant Of Human Clic1 Length = 241 | Back alignment and structure |
| >pdb|3SWL|A Chain A, Crystal Structure Analysis Of H74a Mutant Of Human Clic1 Length = 236 | Back alignment and structure |
| >pdb|1RK4|A Chain A, Crystal Structure Of A Soluble Dimeric Form Of Oxidised Clic1 Length = 243 | Back alignment and structure |
| >pdb|1K0O|A Chain A, Crystal Structure Of A Soluble Form Of Clic1. An Intracellular Chloride Ion Channel Length = 241 | Back alignment and structure |
| >pdb|3UVH|A Chain A, Crystal Structure Analysis Of E81m Mutant Of Human Clic1 Length = 241 | Back alignment and structure |
| >pdb|3P8W|A Chain A, Crystal Structure Analysis Of R29mE81M DOUBLE MUTANT OF HUMAN CLIC1 Length = 241 | Back alignment and structure |
| >pdb|3QR6|A Chain A, Crystal Structure Analysis Of H185f Mutant Of Human Clic1 Length = 241 | Back alignment and structure |
| >pdb|4IQA|A Chain A, Crystal Structure Analysis Of The E228l Mutant Of Human Clic1 Length = 236 | Back alignment and structure |
| >pdb|3FY7|A Chain A, Crystal Structure Of Homo Sapiens Clic3 Length = 250 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 6e-45 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 6e-39 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 4e-31 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 6e-30 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 2e-28 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 4e-26 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 4e-08 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 4e-07 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 6e-06 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 1e-04 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 1e-05 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 1e-05 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 1e-05 | |
| 3r3e_A | 328 | Uncharacterized protein YQJG; thioredoxin domain, | 2e-05 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 5e-05 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 7e-05 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 1e-04 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 1e-04 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 9e-04 |
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
Score = 147 bits (373), Expect = 6e-45
Identities = 128/160 (80%), Positives = 142/160 (88%)
Query: 18 PPILIDNGLAVLENEKIERHIMKNVPGGHNLFVQDKEVATLIENLYSKLKLMLLKKDDVS 77
PPILIDNGLA+LENEKIERHIMKN+PGG+NLFVQDKEVATLIENLY KLKLML+KKD+
Sbjct: 84 PPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAK 143
Query: 78 INALMSHLRKINDHLGRKETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQFEIPTYMKH 137
NAL+SHLRKINDHL + TRFLTGDTMCCFDCELMPRLQHIRVAG YF+ FEIPT++
Sbjct: 144 NNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTA 203
Query: 138 LWHYMKHMYELEAFTQSCPADQDIINHYKLQQVWLMRRSP 177
LW YM HMY+L+AFTQSCPADQDIINHYKLQQ M++
Sbjct: 204 LWRYMYHMYQLDAFTQSCPADQDIINHYKLQQSLKMKKHE 243
|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Length = 362 | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 100.0 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 100.0 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.98 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.97 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.97 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.97 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.97 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.97 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.97 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 99.97 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.97 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.97 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.97 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.97 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.97 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.96 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.96 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.96 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.96 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.96 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.96 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.96 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.96 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.96 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.96 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.96 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.96 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.96 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.96 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.96 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 99.96 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.95 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.95 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.95 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.95 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.95 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.95 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.95 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.95 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.95 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.95 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.95 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.95 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.95 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.95 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.95 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.95 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.95 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.95 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.95 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.95 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.95 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.95 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.95 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.95 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 99.95 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.95 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 99.95 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.94 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.94 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.94 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.94 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.94 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.94 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.94 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.94 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.94 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.94 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.94 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.94 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.94 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.94 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.94 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.94 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.94 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.94 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.94 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.94 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.94 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.94 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.94 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.94 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.94 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.94 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.94 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.94 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.93 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.93 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.93 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.93 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.93 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.93 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.93 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.93 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.93 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.93 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.93 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.93 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.93 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.92 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.92 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.92 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.91 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.91 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.91 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.91 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.91 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.9 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.87 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.87 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.86 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.78 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.74 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.7 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 98.93 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 97.16 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 96.46 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 95.96 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 95.88 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 91.9 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 88.29 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 87.07 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 83.57 |
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.4e-34 Score=222.60 Aligned_cols=170 Identities=79% Similarity=1.249 Sum_probs=132.7
Q ss_pred CCchhHhhhCCCCCCCeEEeCCeeeecHHHHHHHHHhhCCCCCCCCCCchHHHHHHHHHHHHHHHHHcCCChHHHHHHHH
Q psy15093 4 TRDKKARTNFEATPPPILIDNGLAVLENEKIERHIMKNVPGGHNLFVQDKEVATLIENLYSKLKLMLLKKDDVSINALMS 83 (179)
Q Consensus 4 ~~~~~~~~~nP~g~vPvL~~~g~~l~ES~aI~~YL~~~~p~~~~L~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 83 (179)
.+++||+++||.|+||||++||.+|+||.||++||+++||+.+.|.|.+++...+...++..+..++....+...+.+.+
T Consensus 70 ~~~~~~~~~nP~gkVPvL~d~g~~l~ES~aI~~YL~~~~~~~~~L~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 149 (260)
T 2yv7_A 70 KPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNALLS 149 (260)
T ss_dssp SCC-----CCTTCCSCEEEETTEEECSHHHHHHHHHHHSTTHHHHSCCCHHHHHHHTTHHHHHHHHHTSCCHHHHHHHHH
T ss_pred cCCHHHHhhCCCCCCCEEEECCEEEeCHHHHHHHHHHhCCCCcccCCCCHHHHHHHHHHHHHHHHHHhcCchHHHHHHHH
Confidence 45789999999999999999999999999999999999985345778776555555556666666655444445678899
Q ss_pred HHHHHHHHHccCCCceecCCCCChhhhhHhhHHHHHHHhhhcccCcccccccHHHHHHHHHHhccccccccCCChHHHHH
Q psy15093 84 HLRKINDHLGRKETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQFEIPTYMKHLWHYMKHMYELEAFTQSCPADQDIIN 163 (179)
Q Consensus 84 ~l~~le~~L~~~~~~fl~Gd~~TlAD~~~~~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~ 163 (179)
.|+.||++|+.++++||+|+++|+|||++++.+.++..+...+.+++++.+||+|.+|+++|.+||+|+++++..+++..
T Consensus 150 ~L~~Le~~L~~~~~~fl~Gd~~T~ADi~l~~~l~~l~~~~~~~~~~~~~~~~P~l~~w~~ri~~rP~~~~~~~~~~~~~~ 229 (260)
T 2yv7_A 150 HLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIIN 229 (260)
T ss_dssp HHHHHHHHHHHHTCSSSSSSSCCHHHHHHHHHHHHHHHHHHHHHCCCCCTTCHHHHHHHHHHHTCHHHHHHCCCHHHHHH
T ss_pred HHHHHHHHHHhCCCCcccCCCCcHHHHHHHHHHHHHHHHHHHhcCCCccccCHHHHHHHHHHhcCHHHHHhCCCHHHHHH
Confidence 99999999985347899999999999999999988765433334556667899999999999999999999999888988
Q ss_pred HHHhhhcccc
Q psy15093 164 HYKLQQVWLM 173 (179)
Q Consensus 164 ~~~~~~~~~~ 173 (179)
+|.....-.+
T Consensus 230 ~~~~~~~~~~ 239 (260)
T 2yv7_A 230 HYKLQQSLKM 239 (260)
T ss_dssp HHHHHHTCC-
T ss_pred HHHHHccccc
Confidence 9877664433
|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 179 | ||||
| d1k0ma1 | 149 | a.45.1.1 (A:92-240) Chloride intracellular channel | 3e-21 | |
| d1oyja1 | 145 | a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat | 3e-05 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 6e-05 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 1e-04 |
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Chloride intracellular channel 1 (clic1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 82.5 bits (203), Expect = 3e-21
Identities = 28/139 (20%), Positives = 58/139 (41%), Gaps = 20/139 (14%)
Query: 48 LFVQDKEVATLIENLYSKLKLMLLKKDD----VSINALMSHLRKINDHLGRK-------- 95
L + E T ++++K + + L+ L+ ++++L
Sbjct: 5 LAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDET 64
Query: 96 --------ETRFLTGDTMCCFDCELMPRLQHIRVAGSYFMQFEIPTYMKHLWHYMKHMYE 147
+ +FL G+ + DC L+P+L ++V + F IP + + Y+ + Y
Sbjct: 65 SAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYA 124
Query: 148 LEAFTQSCPADQDIINHYK 166
E F +CP D++I Y+
Sbjct: 125 REEFASTCPDDEEIELAYE 143
|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 99.87 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.74 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.73 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.66 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.62 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.62 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.61 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.61 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.61 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.6 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.59 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.58 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.57 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.56 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.56 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.56 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.55 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.55 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.55 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.55 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.55 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.54 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.53 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.53 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.53 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.52 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.52 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.52 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.51 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.51 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.51 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.51 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.51 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.5 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.49 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.48 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.47 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.46 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.45 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.45 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.45 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.44 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.43 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.41 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.39 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.39 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.38 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.37 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.34 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.32 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.3 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.26 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.26 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.26 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.24 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.22 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.22 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.18 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.18 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.16 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.12 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.11 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.09 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.02 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.97 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.7 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.62 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.51 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 96.8 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 91.56 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 80.5 |
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Chloride intracellular channel 1 (clic1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=2.1e-22 Score=143.22 Aligned_cols=122 Identities=24% Similarity=0.503 Sum_probs=101.8
Q ss_pred CCCCCCchHHHHHHHHHHHHHHHHHcCCC----hHHHHHHHHHHHHHHHHHcc----------------CCCceecCCCC
Q psy15093 46 HNLFVQDKEVATLIENLYSKLKLMLLKKD----DVSINALMSHLRKINDHLGR----------------KETRFLTGDTM 105 (179)
Q Consensus 46 ~~L~p~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~l~~~l~~le~~L~~----------------~~~~fl~Gd~~ 105 (179)
|.|.|.+++.+.++..+++.|..++...+ +...+.+.+.+..+++.|.+ .+++||+||++
T Consensus 3 P~L~p~~pE~~~i~~~l~~~f~~~l~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~l~~~~~~l~~~~fl~Gd~~ 82 (149)
T d1k0ma1 3 PKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNEL 82 (149)
T ss_dssp CCCSCSSGGGGTTTTTHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHSCCCCCTTCCHHHHHSCCCCSSSSSSSC
T ss_pred CCCCCCChHHHHHHHHHHHHHHHHHhCcChhhhHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhhcCCcccCCCCC
Confidence 45888888888888888999988887765 23445666777766665542 15799999999
Q ss_pred ChhhhhHhhHHHHHHHhhhcccCcccccccHHHHHHHHHHhccccccccCCChHHHHHHHHh
Q psy15093 106 CCFDCELMPRLQHIRVAGSYFMQFEIPTYMKHLWHYMKHMYELEAFTQSCPADQDIINHYKL 167 (179)
Q Consensus 106 TlAD~~~~~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~ 167 (179)
|+|||+++|+|.++..+...+.+++++.+||+|.+|+++|.+||+|++|+++.++|+.+|.+
T Consensus 83 t~aDi~l~p~l~r~~~~~~~~~~~~~~~~~p~l~~w~~~l~~rpsf~~T~~~~e~i~~~y~~ 144 (149)
T d1k0ma1 83 TLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQ 144 (149)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHCCCCCTTCHHHHHHHHHHHTSHHHHTTSCCHHHHHHHTTT
T ss_pred cHHHHHHHHHHHHHHhhhcccccchhhhcChHHHHHHHHHHCChHHHHhCCCHHHHHHHHHH
Confidence 99999999999999887777778888899999999999999999999999999999999854
|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|