Psyllid ID: psy15107

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYIPSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKINLPESTF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHccc
mwtnsltagcnadgelafpsfgtscggggAAMASYlksapygvngiGLSMDSLhsslgyipsgnhrkqrrerttFTRAQLDVLESlfgktrypdifMREEVALKinlpesrvqgypdiFMREEVALKINLPESTF
MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYIpsgnhrkqrrerttftraqldvleslfgktrypdIFMREEVALKINLPESRVQGYPDIFMREEVALkinlpestf
MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYIPSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKINLPESTF
********GCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYI*************TFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKI*******
*************************************************************************TFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDI*****************
MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYIPSG********RTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKINLPESTF
**************************GGGAA***********V***GLSMDS*HSS*************RERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKINLP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLSMDSLHSSLGYIPSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKINLPESTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
P32242 354 Homeobox protein OTX1 OS= no N/A 0.592 0.225 0.752 7e-30
P80205 355 Homeobox protein OTX1 OS= yes N/A 0.607 0.230 0.735 9e-30
Q63410 355 Homeobox protein OTX1 OS= yes N/A 0.592 0.225 0.752 2e-29
Q28FN6 289 Homeobox protein OTX2 OS= no N/A 0.607 0.283 0.735 2e-29
Q91994 323 Homeobox protein OTX1 B O yes N/A 0.592 0.247 0.741 2e-29
P80206 289 Homeobox protein OTX2 OS= no N/A 0.607 0.283 0.735 2e-29
P32243 289 Homeobox protein OTX2 OS= yes N/A 0.607 0.283 0.735 2e-29
Q91813 288 Homeobox protein OTX2-A O N/A N/A 0.607 0.284 0.724 3e-29
Q6DKN2 289 Homeobox protein OTX2-B O N/A N/A 0.607 0.283 0.724 3e-29
Q91981 289 Homeobox protein OTX2 OS= no N/A 0.607 0.283 0.735 4e-29
>sp|P32242|OTX1_HUMAN Homeobox protein OTX1 OS=Homo sapiens GN=OTX1 PE=1 SV=1 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 70/85 (82%), Gaps = 5/85 (5%)

Query: 32  MASYLKSAPYGVNGIGLS---MDSLHSSLGYIPSGNHRKQRRERTTFTRAQLDVLESLFG 88
           M SYLK  PYG+NG+GL+   MD LH S+GY      RKQRRERTTFTR+QLDVLE+LF 
Sbjct: 1   MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGY--PATPRKQRRERTTFTRSQLDVLEALFA 58

Query: 89  KTRYPDIFMREEVALKINLPESRVQ 113
           KTRYPDIFMREEVALKINLPESRVQ
Sbjct: 59  KTRYPDIFMREEVALKINLPESRVQ 83
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Homo sapiens (taxid: 9606)
>sp|P80205|OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus GN=Otx1 PE=2 SV=1 Back     alignment and function description
>sp|Q63410|OTX1_RAT Homeobox protein OTX1 OS=Rattus norvegicus GN=Otx1 PE=2 SV=1 Back     alignment and function description
>sp|Q28FN6|OTX2_XENTR Homeobox protein OTX2 OS=Xenopus tropicalis GN=otx2 PE=2 SV=1 Back     alignment and function description
>sp|Q91994|OTX1B_DANRE Homeobox protein OTX1 B OS=Danio rerio GN=otx1b PE=2 SV=1 Back     alignment and function description
>sp|P80206|OTX2_MOUSE Homeobox protein OTX2 OS=Mus musculus GN=Otx2 PE=1 SV=1 Back     alignment and function description
>sp|P32243|OTX2_HUMAN Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1 SV=1 Back     alignment and function description
>sp|Q91813|OTX2A_XENLA Homeobox protein OTX2-A OS=Xenopus laevis GN=otx2-a PE=1 SV=1 Back     alignment and function description
>sp|Q6DKN2|OTX2B_XENLA Homeobox protein OTX2-B OS=Xenopus laevis GN=otx2-b PE=2 SV=1 Back     alignment and function description
>sp|Q91981|OTX2_DANRE Homeobox protein OTX2 OS=Danio rerio GN=otx2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
86515406 301 orthodenticle-2 [Tribolium castaneum] gi 0.837 0.375 0.754 3e-38
242014875 291 Homeobox protein OTX1, putative [Pedicul 0.6 0.278 0.833 1e-31
410900744 332 PREDICTED: homeobox protein OTX1 B-like 0.592 0.240 0.776 1e-28
47224717 333 unnamed protein product [Tetraodon nigro 0.592 0.240 0.776 1e-28
15004980 326 transcriptional factor [Leucopsarion pet 0.592 0.245 0.776 1e-28
348501648 332 PREDICTED: homeobox protein OTX1 B-like 0.592 0.240 0.776 2e-28
410917546 327 PREDICTED: homeobox protein OTX1 B-like 0.607 0.250 0.747 2e-28
432904340 256 PREDICTED: homeobox protein OTX1 B-like 0.592 0.312 0.776 2e-28
332226885 481 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.592 0.166 0.752 3e-28
147903012 339 orthodenticle homeobox 1 [Xenopus laevis 0.592 0.235 0.764 3e-28
>gi|86515406|ref|NP_001034526.1| orthodenticle-2 [Tribolium castaneum] gi|2815307|emb|CAA11490.1| orthodenticle-2 protein [Tribolium castaneum] gi|270004873|gb|EFA01321.1| orthodenticle-2 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 100/118 (84%), Gaps = 5/118 (4%)

Query: 1   MWTNSLTAGCNADGELAFPSFGTSCGGGGAAMASYLKSAPYGVNGIGLS---MDSLHSSL 57
           MW+NSLTAGCN D EL FP FG++CGG  ++MA YLKSAPY V G+GL    +DSLHSS+
Sbjct: 1   MWSNSLTAGCNPDSEL-FPGFGSTCGGSSSSMA-YLKSAPYPVPGLGLHGLPVDSLHSSM 58

Query: 58  GYIPSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGY 115
              P+GN RKQRRERTTFTRAQLDVLE+LFGKTRYPDIFMREEVALKINLPESRVQ +
Sbjct: 59  AGYPAGNQRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVW 116

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242014875|ref|XP_002428108.1| Homeobox protein OTX1, putative [Pediculus humanus corporis] gi|212512639|gb|EEB15370.1| Homeobox protein OTX1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|410900744|ref|XP_003963856.1| PREDICTED: homeobox protein OTX1 B-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47224717|emb|CAG00311.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|15004980|dbj|BAB62171.1| transcriptional factor [Leucopsarion petersii] Back     alignment and taxonomy information
>gi|348501648|ref|XP_003438381.1| PREDICTED: homeobox protein OTX1 B-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410917546|ref|XP_003972247.1| PREDICTED: homeobox protein OTX1 B-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|432904340|ref|XP_004077282.1| PREDICTED: homeobox protein OTX1 B-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|332226885|ref|XP_003262622.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein OTX1 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|147903012|ref|NP_001081009.1| orthodenticle homeobox 1 [Xenopus laevis] gi|13641479|gb|AAK31735.1| transcription factor Otx1 [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
ZFIN|ZDB-GENE-980526-27 338 otx1a "orthodenticle homolog 1 0.592 0.236 0.776 3.1e-28
UNIPROTKB|E1BL43 355 OTX1 "Uncharacterized protein" 0.592 0.225 0.764 1.3e-27
UNIPROTKB|J9P273 355 OTX1 "Uncharacterized protein" 0.592 0.225 0.764 1.3e-27
UNIPROTKB|P32242 354 OTX1 "Homeobox protein OTX1" [ 0.592 0.225 0.764 1.3e-27
UNIPROTKB|F1SIW9 356 OTX1 "Uncharacterized protein" 0.592 0.224 0.764 1.3e-27
MGI|MGI:97450 355 Otx1 "orthodenticle homolog 1 0.592 0.225 0.764 1.3e-27
RGD|3237 355 Otx1 "orthodenticle homeobox 1 0.592 0.225 0.764 1.3e-27
UNIPROTKB|Q63410 355 Otx1 "Homeobox protein OTX1" [ 0.592 0.225 0.764 1.3e-27
ZFIN|ZDB-GENE-980526-400 323 otx1b "orthodenticle homolog 1 0.592 0.247 0.752 3.5e-27
UNIPROTKB|Q91813 288 otx2-a "Homeobox protein OTX2- 0.592 0.277 0.752 5.7e-27
ZFIN|ZDB-GENE-980526-27 otx1a "orthodenticle homolog 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 315 (115.9 bits), Expect = 3.1e-28, P = 3.1e-28
 Identities = 66/85 (77%), Positives = 72/85 (84%)

Query:    32 MASYLKSAPYGVNGIGL---SMDSLHSSLGYIPSGNHRKQRRERTTFTRAQLDVLESLFG 88
             M SYLK APY +NG+GL   +MD LH S+GY P+ N RKQRRERTTFTR QLD+LESLF 
Sbjct:     1 MMSYLKQAPYAMNGLGLGGATMDLLHPSVGY-PT-NPRKQRRERTTFTRTQLDILESLFA 58

Query:    89 KTRYPDIFMREEVALKINLPESRVQ 113
             KTRYPDIFMREEVALKINLPESRVQ
Sbjct:    59 KTRYPDIFMREEVALKINLPESRVQ 83
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0030917 "midbrain-hindbrain boundary development" evidence=IGI
GO:0030901 "midbrain development" evidence=IGI
GO:0030902 "hindbrain development" evidence=IGI
GO:0003406 "retinal pigment epithelium development" evidence=IGI
UNIPROTKB|E1BL43 OTX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P273 OTX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P32242 OTX1 "Homeobox protein OTX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIW9 OTX1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97450 Otx1 "orthodenticle homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3237 Otx1 "orthodenticle homeobox 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63410 Otx1 "Homeobox protein OTX1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-400 otx1b "orthodenticle homolog 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q91813 otx2-a "Homeobox protein OTX2-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P22810HMOC_DROMENo assigned EC number0.70270.48880.1217yesN/A
Q63410OTX1_RATNo assigned EC number0.75290.59250.2253yesN/A
P80205OTX1_MOUSENo assigned EC number0.73560.60740.2309yesN/A
P32243OTX2_HUMANNo assigned EC number0.73560.60740.2837yesN/A
Q91994OTX1B_DANRENo assigned EC number0.74110.59250.2476yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-14
smart0038957 smart00389, HOX, Homeodomain 5e-14
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-08
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 71.0 bits (175), Expect = 1e-17
 Identities = 24/45 (53%), Positives = 30/45 (66%)

Query: 69  RRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQ 113
           RR+RTTFT  QL+ LE  F K RYP    REE+A K+ L E +V+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0842|consensus307 99.85
KOG0488|consensus309 99.84
KOG0484|consensus125 99.84
KOG0850|consensus245 99.84
KOG2251|consensus 228 99.84
KOG0489|consensus261 99.84
KOG0843|consensus197 99.82
KOG0487|consensus308 99.82
KOG0485|consensus268 99.82
KOG0492|consensus246 99.8
KOG0494|consensus 332 99.79
KOG0848|consensus317 99.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.76
KOG0844|consensus 408 99.73
KOG0493|consensus342 99.68
KOG0491|consensus194 99.67
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.66
KOG3802|consensus398 99.65
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.65
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.64
KOG0486|consensus 351 99.63
COG5576156 Homeodomain-containing transcription factor [Trans 99.63
KOG4577|consensus 383 99.59
KOG0483|consensus198 99.56
KOG0847|consensus288 99.48
KOG0490|consensus 235 99.46
KOG1168|consensus385 99.31
KOG0849|consensus 354 99.27
KOG0775|consensus304 99.05
KOG2252|consensus558 98.68
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.58
KOG0774|consensus334 98.57
KOG0490|consensus235 98.49
KOG1146|consensus 1406 98.07
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.37
KOG0773|consensus342 96.97
KOG3623|consensus 1007 96.0
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.08
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 85.02
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 84.74
>KOG0842|consensus Back     alignment and domain information 
Probab=99.85  E-value=2.1e-21  Score=151.37  Aligned_cols=66  Identities=26%  Similarity=0.315  Sum_probs=62.3

Q ss_pred             CCCCCCCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHcCCCcCCccccchhhhHHHHHHhcC
Q psy15107         64 NHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKIN  129 (135)
Q Consensus        64 ~~~k~rr~Rt~~t~~ql~~Le~~F~~~~~p~~~~r~~La~~l~l~~~~V~vWFqNRR~k~k~~~~~  129 (135)
                      ..+++||.|..|+..|+.+||+.|.+++|++..+|++||..|.|+++||||||||||-|.||.+..
T Consensus       149 ~~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKIWFQNrRYK~KR~~~d  214 (307)
T KOG0842|consen  149 GKRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKIWFQNRRYKTKRQQKD  214 (307)
T ss_pred             ccccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheeeeeecchhhhhhhhhh
Confidence            466788888999999999999999999999999999999999999999999999999999998874

>KOG0488|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 1e-19
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 1e-11
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-11
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 2e-10
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 7e-10
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-09
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-09
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-08
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-08
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 4e-08
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 8e-08
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 2e-05
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (95%)
Query: 69  RRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGY 115
           RRERTTFTRAQLDVLE+LF KTRYPDIFMREEVALKINLPESRVQ +
Sbjct: 8   RRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVW 54
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-31
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-30
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 4e-30
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 8e-30
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-29
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-27
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 6e-26
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-25
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 5e-24
3a02_A60 Homeobox protein aristaless; homeodomain, developm 7e-24
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-22
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-20
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-19
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-19
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-19
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-18
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-16
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 8e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-14
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-13
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 9e-11
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 5e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 7e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-08
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-08
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 7e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 8e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 9e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 1e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-05
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 8e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 9e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 5e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  106 bits (266), Expect = 2e-31
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 61  PSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQ 113
                RKQRR RTTF+ +QLD LE  F +T+YPDI+ REE+A + NL E+R+Q
Sbjct: 11  GIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.88
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.87
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.87
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.87
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.86
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.86
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.86
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.86
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.86
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.86
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.86
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.86
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.86
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.86
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.86
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.86
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.86
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.86
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.85
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.85
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.85
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.85
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.85
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.85
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.85
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.85
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.85
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.85
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.85
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.84
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.84
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.84
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.84
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.84
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.84
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.83
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.83
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.83
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.83
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.83
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.83
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.82
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.82
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.82
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.82
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.81
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.81
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.81
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.81
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.81
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.8
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.79
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.79
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.79
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.79
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.79
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.78
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.78
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.78
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.78
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.78
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.78
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.78
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.78
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.77
2e19_A64 Transcription factor 8; homeobox domain, structura 99.77
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.77
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.77
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.76
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.76
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.73
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.68
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.64
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.63
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.58
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.54
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.45
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.79
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.39
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 89.15
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 87.84
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 81.4
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=4.6e-23  Score=131.96  Aligned_cols=65  Identities=28%  Similarity=0.244  Sum_probs=61.0

Q ss_pred             CCCCCCCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHcCCCcCCccccchhhhHHHHHHhc
Q psy15107         64 NHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVALKI  128 (135)
Q Consensus        64 ~~~k~rr~Rt~~t~~ql~~Le~~F~~~~~p~~~~r~~La~~l~l~~~~V~vWFqNRR~k~k~~~~  128 (135)
                      ..++.++.|+.|+..|+.+||..|..++||+..++++||..|+|++.+|+|||||||+|+|+...
T Consensus        13 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~~   77 (80)
T 2dmt_A           13 KAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGP   77 (80)
T ss_dssp             CCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCCS
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcccC
Confidence            45678899999999999999999999999999999999999999999999999999999987654
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 5e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-13
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 1e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-12
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-12
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 9e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 4e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-10
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 6e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 6e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-05
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 69.1 bits (169), Expect = 2e-17
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 61  PSGNHRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQ 113
              + R  R++R  +T+ Q   LE  F    Y     R EVA  +NL E +V+
Sbjct: 6   NWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVK 58
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.9
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.89
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.89
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.88
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.88
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.88
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.88
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.88
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.87
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.87
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.87
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.86
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.86
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.85
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.85
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.84
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.84
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.83
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.82
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.82
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.8
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.8
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.78
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.76
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.74
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.74
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.73
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.71
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.67
d1hlva166 DNA-binding domain of centromere binding protein B 91.21
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 86.58
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 80.05
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Msx-1 homeodomain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.90  E-value=1.5e-24  Score=129.71  Aligned_cols=58  Identities=33%  Similarity=0.386  Sum_probs=55.9

Q ss_pred             CCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHcCCCcCCccccchhhhHHHHHH
Q psy15107         69 RRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQGYPDIFMREEVAL  126 (135)
Q Consensus        69 rr~Rt~~t~~ql~~Le~~F~~~~~p~~~~r~~La~~l~l~~~~V~vWFqNRR~k~k~~  126 (135)
                      ||.|+.||++|+.+||..|+.++||+..++++||..|||++.+|+|||||||+|+||+
T Consensus         1 rr~Rt~ft~~Ql~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~WFqNrR~k~kr~   58 (58)
T d1ig7a_           1 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL   58 (58)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhheeecCcchHhHhccC
Confidence            5689999999999999999999999999999999999999999999999999999985
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure