Psyllid ID: psy15119
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 156544915 | 136 | PREDICTED: histone H2A type 1 [Nasonia v | 1.0 | 0.705 | 0.989 | 3e-47 | |
| 122008 | 124 | RecName: Full=Histone H2A gi|9820|emb|CA | 1.0 | 0.774 | 0.989 | 8e-47 | |
| 405975240 | 133 | Histone H2A [Crassostrea gigas] | 1.0 | 0.721 | 0.947 | 2e-45 | |
| 157137737 | 124 | histone h2a [Aedes aegypti] gi|108880814 | 1.0 | 0.774 | 0.958 | 2e-45 | |
| 358255301 | 215 | histone H2A [Clonorchis sinensis] | 1.0 | 0.446 | 0.937 | 2e-45 | |
| 162319741 | 123 | histone H2A [Penaeus monodon] | 1.0 | 0.780 | 0.958 | 3e-45 | |
| 358255296 | 125 | histone H2A [Clonorchis sinensis] gi|358 | 1.0 | 0.768 | 0.937 | 6e-45 | |
| 256087701 | 125 | histone H2A [Schistosoma mansoni] gi|353 | 1.0 | 0.768 | 0.937 | 7e-45 | |
| 256070862 | 125 | histone H2A [Schistosoma mansoni] gi|360 | 1.0 | 0.768 | 0.927 | 2e-44 | |
| 226479254 | 125 | Histone H2A [Schistosoma japonicum] | 1.0 | 0.768 | 0.927 | 2e-44 |
| >gi|156544915|ref|XP_001600014.1| PREDICTED: histone H2A type 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 192 bits (487), Expect = 3e-47, Method: Compositional matrix adjust.
Identities = 95/96 (98%), Positives = 96/96 (100%)
Query: 1 MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA 60
MSGRGKGGKAKAKSKTRS+RAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct: 1 MSGRGKGGKAKAKSKTRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA 60
Query: 61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 96
EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL
Sbjct: 61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 96
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|122008|sp|P19178.2|H2A_PLADU RecName: Full=Histone H2A gi|9820|emb|CAA37416.1| unnamed protein product [Platynereis dumerilii] | Back alignment and taxonomy information |
|---|
| >gi|405975240|gb|EKC39821.1| Histone H2A [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|157137737|ref|XP_001657157.1| histone h2a [Aedes aegypti] gi|108880814|gb|EAT45039.1| AAEL003669-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|358255301|dbj|GAA57014.1| histone H2A [Clonorchis sinensis] | Back alignment and taxonomy information |
|---|
| >gi|162319741|gb|ABX84387.1| histone H2A [Penaeus monodon] | Back alignment and taxonomy information |
|---|
| >gi|358255296|dbj|GAA57009.1| histone H2A [Clonorchis sinensis] gi|358337597|dbj|GAA39720.2| histone H2A [Clonorchis sinensis] | Back alignment and taxonomy information |
|---|
| >gi|256087701|ref|XP_002580003.1| histone H2A [Schistosoma mansoni] gi|353231318|emb|CCD77736.1| putative histone H2A [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|256070862|ref|XP_002571761.1| histone H2A [Schistosoma mansoni] gi|360043244|emb|CCD78657.1| putative histone H2A [Schistosoma mansoni] | Back alignment and taxonomy information |
|---|
| >gi|226479254|emb|CAX73122.1| Histone H2A [Schistosoma japonicum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| FB|FBgn0051618 | 124 | His2A:CG31618 "His2A:CG31618" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053808 | 124 | His2A:CG33808 "His2A:CG33808" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053814 | 124 | His2A:CG33814 "His2A:CG33814" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053817 | 124 | His2A:CG33817 "His2A:CG33817" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053820 | 124 | His2A:CG33820 "His2A:CG33820" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053823 | 124 | His2A:CG33823 "His2A:CG33823" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053826 | 124 | His2A:CG33826 "His2A:CG33826" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053829 | 124 | His2A:CG33829 "His2A:CG33829" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053832 | 124 | His2A:CG33832 "His2A:CG33832" | 0.770 | 0.596 | 1.0 | 4.6e-34 | |
| FB|FBgn0053835 | 124 | His2A:CG33835 "His2A:CG33835" | 0.770 | 0.596 | 1.0 | 4.6e-34 |
| FB|FBgn0051618 His2A:CG31618 "His2A:CG31618" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 370 (135.3 bits), Expect = 4.6e-34, P = 4.6e-34
Identities = 74/74 (100%), Positives = 74/74 (100%)
Query: 23 LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82
LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH
Sbjct: 23 LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRH 82
Query: 83 LQLAIRNDEELNKL 96
LQLAIRNDEELNKL
Sbjct: 83 LQLAIRNDEELNKL 96
|
|
| FB|FBgn0053808 His2A:CG33808 "His2A:CG33808" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053814 His2A:CG33814 "His2A:CG33814" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053817 His2A:CG33817 "His2A:CG33817" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053820 His2A:CG33820 "His2A:CG33820" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053823 His2A:CG33823 "His2A:CG33823" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053826 His2A:CG33826 "His2A:CG33826" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053829 His2A:CG33829 "His2A:CG33829" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053832 His2A:CG33832 "His2A:CG33832" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053835 His2A:CG33835 "His2A:CG33835" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| PTZ00017 | 134 | PTZ00017, PTZ00017, histone H2A; Provisional | 1e-53 | |
| cd00074 | 115 | cd00074, H2A, Histone 2A; H2A is a subunit of the | 9e-52 | |
| PLN00157 | 132 | PLN00157, PLN00157, histone H2A; Provisional | 3e-50 | |
| smart00414 | 106 | smart00414, H2A, Histone 2A | 1e-48 | |
| PLN00156 | 139 | PLN00156, PLN00156, histone H2AX; Provisional | 1e-44 | |
| COG5262 | 132 | COG5262, HTA1, Histone H2A [Chromatin structure an | 6e-43 | |
| PLN00153 | 129 | PLN00153, PLN00153, histone H2A; Provisional | 2e-40 | |
| PLN00154 | 136 | PLN00154, PLN00154, histone H2A; Provisional | 3e-33 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 1e-23 | |
| PTZ00252 | 134 | PTZ00252, PTZ00252, histone H2A; Provisional | 1e-21 | |
| PLN00155 | 58 | PLN00155, PLN00155, histone H2A; Provisional | 5e-18 | |
| COG5247 | 113 | COG5247, BUR6, Class 2 transcription repressor NC2 | 8e-06 | |
| pfam00808 | 65 | pfam00808, CBFD_NFYB_HMF, Histone-like transcripti | 0.001 |
| >gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional | Back alignment and domain information |
|---|
Score = 162 bits (413), Expect = 1e-53
Identities = 74/99 (74%), Positives = 84/99 (84%), Gaps = 3/99 (3%)
Query: 1 MSGRGKGGKAKAKSK---TRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEY 57
G+GK G KA K +RS++AGLQFPVGR+HR L+KG YA+RVGAGAPVYLAAV+EY
Sbjct: 1 KGGKGKTGGGKAGKKKPVSRSAKAGLQFPVGRVHRYLKKGRYAKRVGAGAPVYLAAVLEY 60
Query: 58 LAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 96
L AEVLELAGNAA+DNKK RI PRH+QLAIRNDEELNKL
Sbjct: 61 LTAEVLELAGNAAKDNKKKRITPRHIQLAIRNDEELNKL 99
|
Length = 134 |
| >gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197711 smart00414, H2A, Histone 2A | Back alignment and domain information |
|---|
| >gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| PLN00153 | 129 | histone H2A; Provisional | 100.0 | |
| PLN00157 | 132 | histone H2A; Provisional | 100.0 | |
| PTZ00017 | 134 | histone H2A; Provisional | 100.0 | |
| PLN00156 | 139 | histone H2AX; Provisional | 100.0 | |
| PLN00154 | 136 | histone H2A; Provisional | 100.0 | |
| PTZ00252 | 134 | histone H2A; Provisional | 100.0 | |
| KOG1756|consensus | 131 | 100.0 | ||
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 100.0 | |
| smart00414 | 106 | H2A Histone 2A. | 100.0 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 100.0 | |
| KOG1757|consensus | 131 | 99.97 | ||
| PLN00155 | 58 | histone H2A; Provisional | 99.92 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 99.69 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.69 | |
| PLN00035 | 103 | histone H4; Provisional | 99.66 | |
| PTZ00015 | 102 | histone H4; Provisional | 99.56 | |
| KOG1659|consensus | 224 | 99.55 | ||
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 99.45 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.38 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 99.37 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 99.32 | |
| smart00417 | 74 | H4 Histone H4. | 99.3 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 98.99 | |
| KOG1657|consensus | 236 | 98.96 | ||
| KOG3467|consensus | 103 | 98.82 | ||
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 98.66 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.55 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 98.22 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 98.19 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 98.12 | |
| smart00428 | 105 | H3 Histone H3. | 98.01 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 97.86 | |
| PTZ00463 | 117 | histone H2B; Provisional | 97.73 | |
| KOG0869|consensus | 168 | 97.68 | ||
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 97.65 | |
| smart00427 | 89 | H2B Histone H2B. | 97.62 | |
| PLN00158 | 116 | histone H2B; Provisional | 97.52 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 97.45 | |
| KOG3219|consensus | 195 | 97.44 | ||
| KOG0871|consensus | 156 | 97.31 | ||
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 97.21 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 97.11 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 96.96 | |
| KOG0870|consensus | 172 | 96.86 | ||
| PLN00163 | 59 | histone H4; Provisional | 96.86 | |
| PLN00160 | 97 | histone H3; Provisional | 96.82 | |
| KOG1658|consensus | 162 | 96.76 | ||
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 96.72 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 96.72 | |
| PTZ00018 | 136 | histone H3; Provisional | 96.69 | |
| PLN00161 | 135 | histone H3; Provisional | 96.64 | |
| PLN00121 | 136 | histone H3; Provisional | 96.59 | |
| KOG1744|consensus | 127 | 96.45 | ||
| KOG1142|consensus | 258 | 95.47 | ||
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 95.3 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 95.21 | |
| KOG1745|consensus | 137 | 95.12 | ||
| PF15510 | 102 | CENP-W: Centromere kinetochore component W | 92.39 | |
| COG5094 | 145 | TAF9 Transcription initiation factor TFIID, subuni | 92.12 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 91.46 | |
| KOG3334|consensus | 148 | 90.85 | ||
| KOG2549|consensus | 576 | 88.97 | ||
| COG5251 | 199 | TAF40 Transcription initiation factor TFIID, subun | 87.08 | |
| PF02861 | 53 | Clp_N: Clp amino terminal domain; InterPro: IPR004 | 84.01 | |
| COG5095 | 450 | TAF6 Transcription initiation factor TFIID, subuni | 83.97 | |
| PF13335 | 96 | Mg_chelatase_2: Magnesium chelatase, subunit ChlI | 80.99 |
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-42 Score=229.44 Aligned_cols=96 Identities=77% Similarity=1.189 Sum_probs=91.7
Q ss_pred CCCCCCCCCCCccccCcccccCcccchhhhhhhhhcCCcccccCCChHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcccH
Q psy15119 1 MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP 80 (96)
Q Consensus 1 m~~~~~~~~~~~~~~s~s~ra~l~fpv~ri~r~lk~~~~~~ris~~A~v~laavLEyl~~eIlela~~~a~~~~~k~Itp 80 (96)
|||+|++++.+++..|+|+|+||+|||+||+|+|++++++.||+++|||||+||||||++||||+|+|.|+++++++|+|
T Consensus 1 m~g~~~~~~~~~k~~srS~ragL~FpVgRi~R~Lr~g~~a~Rvga~A~VYLAAVLEYLtaEVLELAgnaa~d~kk~RItP 80 (129)
T PLN00153 1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 (129)
T ss_pred CCCCCCCCccccCccCcccccCcccchHHHHHHHhcCchhhccCCCchHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCh
Confidence 99998866656678999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcchhcCCC
Q psy15119 81 RHLQLAIRNDEELNKL 96 (96)
Q Consensus 81 ~~i~~ai~~d~eL~~L 96 (96)
+||++||+||+||++|
T Consensus 81 rHi~lAI~nDeEL~~L 96 (129)
T PLN00153 81 RHIQLAIRNDEELGKL 96 (129)
T ss_pred HHHHhhccCcHHHHHH
Confidence 9999999999999875
|
|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >KOG1756|consensus | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1757|consensus | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >KOG1659|consensus | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >KOG1657|consensus | Back alignment and domain information |
|---|
| >KOG3467|consensus | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG0869|consensus | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >KOG3219|consensus | Back alignment and domain information |
|---|
| >KOG0871|consensus | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >KOG0870|consensus | Back alignment and domain information |
|---|
| >PLN00163 histone H4; Provisional | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1658|consensus | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1744|consensus | Back alignment and domain information |
|---|
| >KOG1142|consensus | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1745|consensus | Back alignment and domain information |
|---|
| >PF15510 CENP-W: Centromere kinetochore component W | Back alignment and domain information |
|---|
| >COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >KOG3334|consensus | Back alignment and domain information |
|---|
| >KOG2549|consensus | Back alignment and domain information |
|---|
| >COG5251 TAF40 Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 2nqb_C | 123 | Drosophila Nucleosome Structure Length = 123 | 2e-37 | ||
| 2pyo_C | 120 | Drosophila Nucleosome Core Length = 120 | 2e-37 | ||
| 3c1b_C | 129 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 2e-36 | ||
| 1zbb_C | 129 | Structure Of The 4_601_167 Tetranucleosome Length = | 2e-36 | ||
| 1m18_C | 129 | Ligand Binding Alters The Structure And Dynamics Of | 2e-36 | ||
| 1eqz_A | 129 | X-Ray Structure Of The Nucleosome Core Particle At | 2e-36 | ||
| 2hio_A | 128 | Histone Octamer (Chicken), Chromosomal Protein Leng | 3e-36 | ||
| 3a6n_C | 133 | The Nucleosome Containing A Testis-Specific Histone | 5e-36 | ||
| 1s32_C | 119 | Molecular Recognition Of The Nucleosomal 'supergroo | 5e-36 | ||
| 2xql_A | 91 | Fitting Of The H2a-H2b Histones In The Electron Mic | 5e-36 | ||
| 2f8n_K | 149 | 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc | 5e-36 | ||
| 2cv5_C | 130 | Crystal Structure Of Human Nucleosome Core Particle | 5e-36 | ||
| 1kx3_C | 128 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 6e-36 | ||
| 1aoi_C | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 6e-36 | ||
| 1hio_A | 95 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 7e-36 | ||
| 3kwq_C | 107 | Structural Characterization Of H3k56q Nucleosomes A | 8e-36 | ||
| 1zla_C | 129 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 3e-35 | ||
| 1id3_C | 131 | Crystal Structure Of The Yeast Nucleosome Core Part | 5e-34 | ||
| 1u35_C | 120 | Crystal Structure Of The Nucleosome Core Particle C | 4e-23 | ||
| 1f66_C | 128 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 3e-22 | ||
| 2jss_A | 192 | Nmr Structure Of Chaperone Chz1 Complexed With Hist | 5e-21 | ||
| 1q9c_A | 191 | Crystal Structure Of The Histone Domain Of Son Of S | 2e-05 | ||
| 3ksy_A | 1049 | Crystal Structure Of The Histone Domain, Dh-Ph Unit | 4e-05 |
| >pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 | Back alignment and structure |
|
| >pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 | Back alignment and structure |
| >pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 | Back alignment and structure |
| >pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 | Back alignment and structure |
| >pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 | Back alignment and structure |
| >pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 | Back alignment and structure |
| >pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 | Back alignment and structure |
| >pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 | Back alignment and structure |
| >pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 | Back alignment and structure |
| >pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 | Back alignment and structure |
| >pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 | Back alignment and structure |
| >pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 | Back alignment and structure |
| >pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 | Back alignment and structure |
| >pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 | Back alignment and structure |
| >pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 | Back alignment and structure |
| >pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 | Back alignment and structure |
| >pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 | Back alignment and structure |
| >pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 | Back alignment and structure |
| >pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 | Back alignment and structure |
| >pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 | Back alignment and structure |
| >pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 | Back alignment and structure |
| >pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 1e-37 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 7e-37 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 4e-36 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 2e-34 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 6e-32 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 3e-29 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 1e-22 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 1e-19 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 1e-10 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 2e-10 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 1e-05 |
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 | Back alignment and structure |
|---|
Score = 121 bits (305), Expect = 1e-37
Identities = 90/95 (94%), Positives = 93/95 (97%)
Query: 2 SGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE 61
SGRGKGGK K K+K+RS+RAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE
Sbjct: 1 SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE 60
Query: 62 VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 96
VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL
Sbjct: 61 VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL 95
|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 100.0 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 100.0 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 100.0 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 100.0 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 100.0 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 100.0 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 99.97 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.94 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.92 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.89 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.87 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.87 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.87 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.82 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.67 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 99.63 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.53 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.53 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.41 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 99.36 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 99.3 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 99.27 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.24 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 99.21 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 99.12 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.98 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.91 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 98.72 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 98.66 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 98.64 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 98.63 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.57 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.51 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 98.5 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.47 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 98.45 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 98.45 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 98.42 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 98.28 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 98.27 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 98.22 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 97.88 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 97.56 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 97.42 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 97.39 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 96.84 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 95.91 | |
| 1wwi_A | 148 | Hypothetical protein TTHA1479; structural genomics | 92.75 | |
| 1r4v_A | 171 | Hypothetical protein AQ_328; structural genomics, | 92.06 | |
| 1khy_A | 148 | CLPB protein; alpha helix, chaperone; 1.95A {Esche | 90.8 | |
| 3fes_A | 145 | ATP-dependent CLP endopeptidase; alpha-helical bun | 90.61 | |
| 3fh2_A | 146 | Probable ATP-dependent protease (heat shock prote; | 90.22 | |
| 2y1q_A | 150 | CLPC N-domain, negative regulator of genetic compe | 88.99 | |
| 3fes_A | 145 | ATP-dependent CLP endopeptidase; alpha-helical bun | 88.38 | |
| 3fh2_A | 146 | Probable ATP-dependent protease (heat shock prote; | 87.93 | |
| 1k6k_A | 143 | ATP-dependent CLP protease ATP-binding subunit CLP | 87.84 | |
| 3zri_A | 171 | CLPB protein, CLPV; chaperone, HSP100 proteins, AA | 87.3 | |
| 1k6k_A | 143 | ATP-dependent CLP protease ATP-binding subunit CLP | 85.63 | |
| 3v9r_B | 88 | MHF2, uncharacterized protein YDL160C-A; histone f | 84.02 | |
| 2y1q_A | 150 | CLPC N-domain, negative regulator of genetic compe | 83.6 | |
| 3zri_A | 171 | CLPB protein, CLPV; chaperone, HSP100 proteins, AA | 83.36 |
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
Probab=100.00 E-value=7.1e-41 Score=222.50 Aligned_cols=96 Identities=93% Similarity=1.362 Sum_probs=82.2
Q ss_pred CCCCCC-CCCCCccccCcccccCcccchhhhhhhhhcCCcccccCCChHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccc
Q psy15119 1 MSGRGK-GGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRII 79 (96)
Q Consensus 1 m~~~~~-~~~~~~~~~s~s~ra~l~fpv~ri~r~lk~~~~~~ris~~A~v~laavLEyl~~eIlela~~~a~~~~~k~It 79 (96)
|||+|+ +++++++.+|+|+|+||+|||+||+|||+++++++||+++|+|||+||||||++||+|+|+|.|+++++++|+
T Consensus 1 m~~~~~~~~~~~~~~~srS~ragLqfPV~rI~R~Lk~~~~a~RVs~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~krIt 80 (129)
T 1tzy_A 1 MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII 80 (129)
T ss_dssp -------------CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred CCCCCCCCCCCCCCCCCccccCceeccHHHHHHHHHccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCCeEc
Confidence 899987 6677778899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcchhcCCC
Q psy15119 80 PRHLQLAIRNDEELNKL 96 (96)
Q Consensus 80 p~~i~~ai~~d~eL~~L 96 (96)
|+||++||+||+||++|
T Consensus 81 p~hi~lAI~nDeEL~~L 97 (129)
T 1tzy_A 81 PRHLQLAIRNDEELNKL 97 (129)
T ss_dssp HHHHHHHHHTSHHHHHH
T ss_pred HHHHHHHHhccHHHHHH
Confidence 99999999999999875
|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A | Back alignment and structure |
|---|
| >1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 | Back alignment and structure |
|---|
| >1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 | Back alignment and structure |
|---|
| >3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} | Back alignment and structure |
|---|
| >3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A | Back alignment and structure |
|---|
| >3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} | Back alignment and structure |
|---|
| >3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* | Back alignment and structure |
|---|
| >3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A | Back alignment and structure |
|---|
| >1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* | Back alignment and structure |
|---|
| >3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A | Back alignment and structure |
|---|
| >3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d1tzya_ | 106 | a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) | 3e-46 | |
| d1u35c1 | 106 | a.22.1.1 (C:814-919) macro-H2A.1, histone domain { | 5e-45 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 3e-44 | |
| d1f66c_ | 103 | a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v | 1e-39 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 2e-23 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 5e-21 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 6e-14 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 5e-11 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Score = 141 bits (358), Expect = 3e-46
Identities = 78/84 (92%), Positives = 83/84 (98%)
Query: 13 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARD 72
K+K+RSSRAGLQFPVGR+HRLLRKGNYAERVGAGAPVYLAAV+EYL AE+LELAGNAARD
Sbjct: 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD 60
Query: 73 NKKTRIIPRHLQLAIRNDEELNKL 96
NKKTRIIPRHLQLAIRNDEELNKL
Sbjct: 61 NKKTRIIPRHLQLAIRNDEELNKL 84
|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 100.0 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 100.0 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.97 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.8 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.75 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.61 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.51 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.5 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 99.42 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 99.26 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.23 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 99.2 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 99.16 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 99.1 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 97.93 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 97.86 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 97.84 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 97.67 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 97.19 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 96.73 | |
| d1k6ka_ | 142 | N-terminal, ClpS-binding domain of ClpA, an Hsp100 | 92.89 | |
| d1wwia1 | 148 | Hypothetical protein TTHA1479 {Thermus thermophilu | 92.84 | |
| d1khya_ | 139 | N-terminal domain of ClpB (heat shock protein F84. | 92.75 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 91.81 | |
| d1qvra1 | 145 | N-terminal domain of ClpB (heat shock protein F84. | 90.39 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 88.5 | |
| d1k6ka_ | 142 | N-terminal, ClpS-binding domain of ClpA, an Hsp100 | 87.13 | |
| d1qvra1 | 145 | N-terminal domain of ClpB (heat shock protein F84. | 85.54 | |
| d1khya_ | 139 | N-terminal domain of ClpB (heat shock protein F84. | 83.34 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=1.9e-38 Score=202.68 Aligned_cols=84 Identities=93% Similarity=1.353 Sum_probs=80.9
Q ss_pred cccCcccccCcccchhhhhhhhhcCCcccccCCChHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHhcchh
Q psy15119 13 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEE 92 (96)
Q Consensus 13 ~~~s~s~ra~l~fpv~ri~r~lk~~~~~~ris~~A~v~laavLEyl~~eIlela~~~a~~~~~k~Itp~~i~~ai~~d~e 92 (96)
|.+|+|+||||+|||+||+|+|+++.+++||+++|||||+||||||++||||+|+|+|+++++++|+|+||++||+||+|
T Consensus 1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDee 80 (106)
T d1tzya_ 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE 80 (106)
T ss_dssp CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHH
T ss_pred CCccccccCCccCChHHHHHHHHcCccccccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHH
Confidence 46799999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCC
Q psy15119 93 LNKL 96 (96)
Q Consensus 93 L~~L 96 (96)
|++|
T Consensus 81 L~~L 84 (106)
T d1tzya_ 81 LNKL 84 (106)
T ss_dssp HHHH
T ss_pred HHHH
Confidence 9754
|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|