Psyllid ID: psy15129


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MRYEESRGQYEDSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQVPGSDRSTQSSLPHNQYHSGTRQDWINEDARMRYEESRGQYEDSRNYEDGRGNYEDGRGKYEDGRNKYEDGRTFGAAIKERGTRIMR
ccccccccccccccccccEEEEcccccccccccEEEEEEEEEEEcccccEEEEcccccEEEEEcccccEEEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEcccccccccEEEEEEEEEEEEccccccEEEEEEEccccEEEEcccccccEEEEEEEEEcccccccccccEEEEEccccccccccccEEEEEEEEEEEcccccccccEEEEEEcccccccccEEEEEccccccHHHHHHcccccccEEEEEEEEEcccccccccccccccccEEEcccHHcccccccc
ccccccccccEccccccccccccccccEEEEEccccccccEEEEEccccccEcccEEEEEEEcccccEEEEEEEEEEEccccccccccccEEEEccccccccccccEEEEEccccEEEEEEccccccccccEEEEEEEEEEEccccccEEEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccccEEEEEEEEcccccEEEEEEEEEEEEccccccccEEEEHHHccccccccccccccccccccccccccHHHHHHHcccEccc
mryeesrgqyedsrnyedgrgnyedsrgnyedgrgkyedgrnkyedgrskyednrscsgmrmgeintkmgeVNTRIIEVVVGVirqpsnsmlvqsledvpsaapeaMSAGVLNLTSafvkwsppppqhhngillGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRaglgpysapvtlvmdphapphalpsdilITHLVlihspiqvpgsdrstqsslphnqyhsgtrqdwinEDARMRYEesrgqyedsrnyedgrgnyedgrgkyedgrnkyedgrTFGAAIKERGTRIMR
mryeesrgqyedsrnyedgrgnyedsrgnyedgrgkyedgrnkyedgrskyednrscsgmrmgeintkmgevnTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQVPGSdrstqsslphnqyhsgtrqdwineDARMRYEEsrgqyedsrnyedgrgnyedgrgkyedgrnkyedgrtfgaaikergtrimr
MRYEESRGQYEDSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQVPGSDRSTQSSLPHNQYHSGTRQDWINEDARMRYEESRGQYEDSRNYEDGRGNYEDGRGKYEDGRNKYEDGRTFGAAIKERGTRIMR
*******************************************************************KMGEVNTRIIEVVVGVIRQ************************VLNLTSAF************GILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPI****************************************************************************************
***********************EDSRGNYEDGRGKYEDGRNKYEDG*********CSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTK****MSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLV************DILITHLVLIHSPIQVPGSDRSTQSSLPH*****************MRYEESRGQYEDSRNYEDGRGNYEDGRGKYEDGRNKYEDGRTFGAAIKERGTRI**
***************YEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQV****************HSGTRQDWINEDARMRY************YEDGRGNYEDGRGKYEDGRNKYEDGRTFGAAIKERGTRIMR
**********EDSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQVPGSDRSTQSSLPHNQYHSGTRQDWINEDARMRYEESRGQYEDSRNYEDGRGNYEDGRGKYEDG******GRTFGAAIKER*T*I**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYEESRGQYEDSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALPSDILITHLVLIHSPIQVPGSDRSTQSSLPHNQYHSGTRQDWINEDARMRYEESRGQYEDSRNYEDGRGNYEDGRGKYEDGRNKYEDGRTFGAAIKERGTRIMR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
B0V2N1 1907 Receptor-type tyrosine-pr yes N/A 0.392 0.063 0.338 3e-12
Q64605 1907 Receptor-type tyrosine-pr yes N/A 0.392 0.063 0.338 3e-12
Q9HCK4 1378 Roundabout homolog 2 OS=H yes N/A 0.347 0.077 0.369 1e-11
Q13332 1948 Receptor-type tyrosine-pr no N/A 0.389 0.061 0.325 3e-11
Q7TPD3 1470 Roundabout homolog 2 OS=M no N/A 0.347 0.072 0.360 2e-10
Q92859 1461 Neogenin OS=Homo sapiens no N/A 0.305 0.064 0.372 2e-09
Q8AV58 2169 Protein sidekick-1 OS=Gal no N/A 0.340 0.048 0.392 2e-09
O89026 1612 Roundabout homolog 1 OS=M no N/A 0.353 0.067 0.339 1e-08
P97603 1377 Neogenin (Fragment) OS=Ra no N/A 0.305 0.068 0.361 2e-08
Q7Z5N4 2213 Protein sidekick-1 OS=Hom no N/A 0.314 0.043 0.377 2e-08
>sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 82  GVIRQPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVK 141
            V+RQ       ++L+  PSA P+ +    L  T+  V W PPPP+ HNG L+GY ++ +
Sbjct: 594 AVVRQ-------RTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYR 646

Query: 142 AYNSTKILAQM--SLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMD--- 196
              S     +   ++  +TT +LL  L     Y    VAYT  G GP S+PV +  D   
Sbjct: 647 PLGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDV 706

Query: 197 PHAPPHALPSDIL 209
           P APP  + ++ L
Sbjct: 707 PSAPPRKVEAEAL 719




Interacts with LAR-interacting protein LIP.1.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 Back     alignment and function description
>sp|Q9HCK4|ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens GN=ROBO2 PE=1 SV=2 Back     alignment and function description
>sp|Q13332|PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens GN=PTPRS PE=1 SV=3 Back     alignment and function description
>sp|Q7TPD3|ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus GN=Robo2 PE=2 SV=2 Back     alignment and function description
>sp|Q92859|NEO1_HUMAN Neogenin OS=Homo sapiens GN=NEO1 PE=1 SV=2 Back     alignment and function description
>sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus GN=SDK1 PE=2 SV=1 Back     alignment and function description
>sp|O89026|ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus GN=Robo1 PE=1 SV=1 Back     alignment and function description
>sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus GN=Neo1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z5N4|SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens GN=SDK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
242012205 999 predicted protein [Pediculus humanus cor 0.386 0.119 0.652 3e-37
157108296 1231 roundabout 1 [Aedes aegypti] gi|10887933 0.383 0.095 0.628 1e-36
170046674 991 roundabout 1 [Culex quinquefasciatus] gi 0.383 0.119 0.619 1e-35
328712717 1397 PREDICTED: roundabout homolog 2-like [Ac 0.389 0.085 0.644 4e-35
195383052 1390 GJ20309 [Drosophila virilis] gi|19414503 0.392 0.087 0.612 8e-35
307176930 1311 Roundabout-like protein 2 [Camponotus fl 0.392 0.092 0.6 2e-34
195121258 1401 GI19234 [Drosophila mojavensis] gi|19391 0.392 0.086 0.612 2e-34
328775940 1505 PREDICTED: roundabout homolog 2 [Apis me 0.392 0.080 0.592 2e-34
380014261 1429 PREDICTED: roundabout homolog 2-like [Ap 0.392 0.084 0.592 2e-34
195430564 1406 GK21847 [Drosophila willistoni] gi|19415 0.444 0.097 0.559 2e-34
>gi|242012205|ref|XP_002426824.1| predicted protein [Pediculus humanus corporis] gi|212511037|gb|EEB14086.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (80%), Gaps = 2/121 (1%)

Query: 86  QPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNS 145
           QPSNS  VQ+LEDVPSA P+ +  G+LN TSA+V WSPPPPQHHNG++LGY+IQ+K  NS
Sbjct: 577 QPSNSQSVQTLEDVPSAPPDNIQIGMLNRTSAYVHWSPPPPQHHNGVILGYRIQIKG-NS 635

Query: 146 TKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPPHALP 205
           +KILAQMSLN+  TSV+LNNLT+G+ Y ARVVA+T+ G GPYS   TL+MDP+   H+ P
Sbjct: 636 SKILAQMSLNSPKTSVILNNLTTGSTYHARVVAFTKIGAGPYSQSHTLIMDPNF-IHSYP 694

Query: 206 S 206
           S
Sbjct: 695 S 695




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157108296|ref|XP_001650163.1| roundabout 1 [Aedes aegypti] gi|108879336|gb|EAT43561.1| AAEL005011-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170046674|ref|XP_001850879.1| roundabout 1 [Culex quinquefasciatus] gi|167869375|gb|EDS32758.1| roundabout 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328712717|ref|XP_001952693.2| PREDICTED: roundabout homolog 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195383052|ref|XP_002050240.1| GJ20309 [Drosophila virilis] gi|194145037|gb|EDW61433.1| GJ20309 [Drosophila virilis] Back     alignment and taxonomy information
>gi|307176930|gb|EFN66247.1| Roundabout-like protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195121258|ref|XP_002005137.1| GI19234 [Drosophila mojavensis] gi|193910205|gb|EDW09072.1| GI19234 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|328775940|ref|XP_396192.4| PREDICTED: roundabout homolog 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380014261|ref|XP_003691158.1| PREDICTED: roundabout homolog 2-like [Apis florea] Back     alignment and taxonomy information
>gi|195430564|ref|XP_002063324.1| GK21847 [Drosophila willistoni] gi|194159409|gb|EDW74310.1| GK21847 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
FB|FBgn0005631 1429 robo "roundabout" [Drosophila 0.545 0.117 0.472 6.7e-34
FB|FBgn0002543 1463 lea "leak" [Drosophila melanog 0.396 0.083 0.404 4.5e-22
FB|FBgn0041097 1342 robo3 "robo3" [Drosophila mela 0.370 0.084 0.449 1e-20
MGI|MGI:97815 1907 Ptprs "protein tyrosine phosph 0.418 0.067 0.362 1.3e-11
RGD|3452 1907 Ptprs "protein tyrosine phosph 0.418 0.067 0.362 1.3e-11
UNIPROTKB|F1N888 1897 PTPRS "Uncharacterized protein 0.415 0.067 0.318 2.3e-11
UNIPROTKB|F1NWE4 1904 PTPRS "Uncharacterized protein 0.415 0.067 0.318 2.3e-11
UNIPROTKB|Q9HCK4 1378 ROBO2 "Roundabout homolog 2" [ 0.347 0.077 0.369 4.6e-11
UNIPROTKB|F1N199 1343 Bt.110263 "Uncharacterized pro 0.347 0.079 0.369 7.7e-11
UNIPROTKB|G8JL96 1928 PTPRS "Receptor-type tyrosine- 0.418 0.066 0.340 1.2e-10
FB|FBgn0005631 robo "roundabout" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 6.7e-34, P = 6.7e-34
 Identities = 87/184 (47%), Positives = 116/184 (63%)

Query:    36 KYEDG-RNKYEDGR---SKYED----NRSCSGMRMGEIN--TKMGEVNTRIIEVVVGVIR 85
             KY +G R  Y+D     ++Y      + S     +G +   TK     T   E + G   
Sbjct:   730 KYVEGLRIHYKDASVPSAQYHSITVMDASAESFVVGNLKKYTKYEFFLTPFFETIEG--- 786

Query:    86 QPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNS 145
             QPSNS    + EDVPSA P+ +  G+ N T+ +V+W+PPP QHHNG L GYKI+V A N+
Sbjct:   787 QPSNSKTALTYEDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNT 846

Query:   146 TKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDP--HA-PPH 202
              K+LA M+LNA+TTSVLLNNLT+GAVY+ R+ ++T+AG GPYS P++L MDP  H  PP 
Sbjct:   847 MKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPR 906

Query:   203 ALPS 206
             A PS
Sbjct:   907 AHPS 910




GO:0007411 "axon guidance" evidence=IMP;TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0035385 "Roundabout signaling pathway" evidence=IGI
GO:0044295 "axonal growth cone" evidence=IDA
GO:0016199 "axon midline choice point recognition" evidence=IMP;TAS
GO:0031982 "vesicle" evidence=IDA
GO:2000274 "regulation of epithelial cell migration, open tracheal system" evidence=IMP
GO:0008038 "neuron recognition" evidence=IMP
GO:0070983 "dendrite guidance" evidence=IMP
GO:0043025 "neuronal cell body" evidence=IDA
GO:0030424 "axon" evidence=IDA
GO:0030425 "dendrite" evidence=IDA
GO:0048813 "dendrite morphogenesis" evidence=IMP;TAS
GO:0004872 "receptor activity" evidence=TAS
GO:0007427 "epithelial cell migration, open tracheal system" evidence=TAS
GO:0007432 "salivary gland boundary specification" evidence=IMP
GO:0035050 "embryonic heart tube development" evidence=IMP
GO:0022409 "positive regulation of cell-cell adhesion" evidence=IMP
GO:0071666 "Slit-Robo signaling complex" evidence=IDA
GO:0008201 "heparin binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009649 "entrainment of circadian clock" evidence=IDA
GO:0003151 "outflow tract morphogenesis" evidence=IGI
GO:0001964 "startle response" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IGI
GO:0043234 "protein complex" evidence=IPI
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0046716 "muscle cell homeostasis" evidence=IGI
GO:0072499 "photoreceptor cell axon guidance" evidence=IMP
FB|FBgn0002543 lea "leak" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041097 robo3 "robo3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:97815 Ptprs "protein tyrosine phosphatase, receptor type, S" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3452 Ptprs "protein tyrosine phosphatase, receptor type, S" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N888 PTPRS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWE4 PTPRS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCK4 ROBO2 "Roundabout homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N199 Bt.110263 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G8JL96 PTPRS "Receptor-type tyrosine-protein phosphatase S" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 3e-13
pfam0004184 pfam00041, fn3, Fibronectin type III domain 6e-13
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-09
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 64.1 bits (156), Expect = 3e-13
 Identities = 25/90 (27%), Positives = 33/90 (36%), Gaps = 2/90 (2%)

Query: 103 APEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVL 162
            P  +    +  TS  + W+PP      G + GY ++ +   S           S TS  
Sbjct: 3   PPTNLRVTDVTSTSVTLSWTPPE--DDGGPITGYVVEYREKGSGDWKEVEVTPGSETSYT 60

Query: 163 LNNLTSGAVYTARVVAYTRAGLGPYSAPVT 192
           L  L  G  Y  RV A    G  P S  VT
Sbjct: 61  LTGLKPGTEYEFRVRAVNGGGESPPSESVT 90


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG4221|consensus 1381 99.93
KOG3513|consensus1051 99.92
KOG4221|consensus 1381 99.87
KOG3513|consensus1051 99.85
KOG0196|consensus 996 99.63
KOG0196|consensus 996 99.53
KOG4222|consensus 1281 99.47
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.43
KOG4222|consensus 1281 98.88
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.84
KOG4802|consensus516 98.65
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.42
KOG4258|consensus1025 98.28
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.28
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.72
KOG4367|consensus699 97.71
KOG4258|consensus 1025 97.55
KOG4152|consensus830 97.49
KOG4802|consensus 516 97.08
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.03
KOG3632|consensus 1335 97.02
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 96.91
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.88
cd0006393 FN3 Fibronectin type 3 domain; One of three types 96.79
KOG4152|consensus830 96.55
COG4733952 Phage-related protein, tail component [Function un 95.57
smart0006083 FN3 Fibronectin type 3 domain. One of three types 95.21
KOG4367|consensus699 94.66
KOG3632|consensus 1335 92.91
PLN02533 427 probable purple acid phosphatase 92.2
COG3401343 Fibronectin type 3 domain-containing protein [Gene 91.63
COG3401343 Fibronectin type 3 domain-containing protein [Gene 91.6
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 91.57
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 90.46
KOG4228|consensus 1087 85.75
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 81.83
>KOG4221|consensus Back     alignment and domain information
Probab=99.93  E-value=5.2e-25  Score=219.09  Aligned_cols=230  Identities=23%  Similarity=0.266  Sum_probs=184.3

Q ss_pred             ccccccccCCCCCCCcceeEEeeeeeccCCCCeeEeCCCCcccceEecCcccCccCCCCeEEEEEEEEEECcccCCCCCc
Q psy15129         11 EDSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNKYEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPSNS   90 (308)
Q Consensus        11 ~~~~~~~~~~~~~~~i~gy~i~wr~~~~~~~~~~~~~~~~~~~~~~~~~L~pg~~~~p~T~Y~~~V~a~n~~G~g~~S~~   90 (308)
                      .--+.|+.+.-+...|.+|++-+...   ....++. .+.....+.++||.+      +|+|.|+|.|+|..|.|..|..
T Consensus       536 ti~v~WepP~~~n~~I~~yk~~ys~~---~~~~~~~-~~~n~~e~ti~gL~k------~TeY~~~vvA~N~~G~g~sS~~  605 (1381)
T KOG4221|consen  536 TILVTWEPPPFGNGPITGYKLFYSED---DTGKELR-VENNATEYTINGLEK------YTEYSIRVVAYNSAGSGVSSAD  605 (1381)
T ss_pred             eEEEEecCCCCCCCCceEEEEEEEcC---CCCceEE-EecCccEEEeecCCC------ccceEEEEEEecCCCCCCCCCc
Confidence            34468999997778899999998754   1112222 334556778889988      9999999999999999999999


Q ss_pred             EEEeccCCCCCCCCcceEEEEecCcEEEEEEeCCCCCCCCceeeEEEEEEEEcCCCceEEEEEecCcccEEEEccCCCCC
Q psy15129         91 MLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGA  170 (308)
Q Consensus        91 v~~~T~~~~P~~~P~~l~v~~~~~tsv~VsW~pP~~~~~~g~I~~Y~V~~~~~~~~~~~~~~~~~~~~t~~~l~~L~p~t  170 (308)
                      +.+.|..+.|++||.||++...++++|+|+|.+|+....||.|.+|.|+|+.........+..+.++.+.+.+.+|+|++
T Consensus       606 i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~~~t~v~~n~~~~l~~~Lep~T  685 (1381)
T KOG4221|consen  606 ITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEVNETVVKGNTTQYLFNGLEPNT  685 (1381)
T ss_pred             eEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCcccccceeecccchhhhHhhcCCCCc
Confidence            99999999999999999999999999999999999999999999999999976555444555667788999999999999


Q ss_pred             eEEEEEEEEeCCCCCCCCccEEEeeCCCC-----CCCcc--ceeeecCEEEEEecCCCcCC-------------------
Q psy15129        171 VYTARVVAYTRAGLGPYSAPVTLVMDPHA-----PPHAL--PSDILITHLVLIHSPIQVPG-------------------  224 (308)
Q Consensus       171 ~Y~v~V~A~n~~G~G~~S~~v~~~T~p~~-----P~~~~--~~~~~~tsv~vsW~pP~~~~-------------------  224 (308)
                      .|.|+|.|.|..|.|++|+++.+.|....     |....  ......++|.|+|.||..+.                   
T Consensus       686 ~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~l~~~~g~~si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~~  765 (1381)
T KOG4221|consen  686 QYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSELHVHPGSNSIVVSWTPPPHPNIVVRGYKIGYRPGSGIPDT  765 (1381)
T ss_pred             eEEEEEEEeccCCCCCcccceeccCccccccccCCCCCceeeeccCceeEEEEeCCCCChhhhhcceEEeeecccCCCCC
Confidence            99999999999999999999999887322     22222  12234679999999995441                   


Q ss_pred             -------CCCe-eecCC-CCcEE----EeccCCCCccCC
Q psy15129        225 -------SDRS-TQSSL-PHNQY----HSGTRQDWINED  250 (308)
Q Consensus       225 -------~~~~-~vt~L-p~~~Y----~a~t~~g~g~~s  250 (308)
                             ..+. .+..| |...|    +|-+..|||...
T Consensus       766 ~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~gdG~p~  804 (1381)
T KOG4221|consen  766 GTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNHGDGNPI  804 (1381)
T ss_pred             ccEEecceeeEEEEEecccCceEEEEEEEeccCCCCcce
Confidence                   1222 67777 88888    677788887654



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 4e-11
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 2e-08
2dbj_A124 Solution Structures Of The Fn3 Domain Of Human Prot 9e-08
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 4e-06
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 7e-05
1wfn_A119 The Fourth Fn3 Domain Of Human Sidekick-2 Length = 2e-04
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 36/99 (36%), Positives = 52/99 (52%) Query: 88 SNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTK 147 S + V++L DVPSAAP+ +S V N S + W PP P NG + GYKI+ + + Sbjct: 6 SGDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKS 65 Query: 148 ILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGP 186 + + ++ + S L+ L G Y RV A T G GP Sbjct: 66 DVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGP 104
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|2DBJ|A Chain A, Solution Structures Of The Fn3 Domain Of Human Proto- Oncogene Tyrosine-Protein Kinase Mer Precursor Length = 124 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|1WFN|A Chain A, The Fourth Fn3 Domain Of Human Sidekick-2 Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-37
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-35
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-35
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 6e-34
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 9e-34
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-32
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 8e-32
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 4e-31
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-30
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 5e-29
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 4e-27
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 3e-25
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-25
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 8e-25
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-19
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 9e-25
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 5e-24
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 5e-15
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 4e-11
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 6e-24
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 6e-24
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-19
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-23
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 5e-23
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 8e-23
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-22
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 6e-22
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-22
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-16
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-11
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-08
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-21
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 4e-21
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-21
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-20
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 9e-11
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-19
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 3e-19
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-19
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-13
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-13
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 9e-11
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-08
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 6e-18
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 5e-17
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 8e-13
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-16
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-14
3t04_D103 Monobody 7C12; engineered binding protein, antibod 7e-16
1x4x_A106 Fibronectin type-III domain containing protein 3A; 7e-16
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 7e-16
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 9e-16
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 3e-15
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-15
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 6e-11
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 5e-15
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 8e-15
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-11
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-10
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 8e-15
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-08
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-06
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-14
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-14
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-14
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-08
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 6e-14
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 7e-14
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 9e-14
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-13
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-13
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 6e-13
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 3e-10
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-12
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-09
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-13
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-12
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-13
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-13
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-13
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 5e-13
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 5e-13
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-12
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 1e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-12
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 4e-12
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 3e-11
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-10
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 3e-06
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-12
2crz_A110 Fibronectin type-III domain containing protein 3A; 5e-12
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 5e-12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-11
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-11
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 2e-11
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-11
1x3d_A118 Fibronectin type-III domain containing protein 3A; 4e-11
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 5e-11
1x5x_A109 Fibronectin type-III domain containing protein 3A; 5e-11
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 6e-11
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 6e-11
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 7e-11
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 7e-08
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 7e-11
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-10
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 3e-10
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 4e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 7e-10
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-09
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 1e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-09
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-09
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-09
2crm_A120 Fibronectin type-III domain containing protein 3A; 4e-09
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-09
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 5e-09
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 1e-08
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-08
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-08
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 4e-04
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 2e-08
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-08
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 6e-08
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-04
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 9e-08
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 1e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-07
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 2e-07
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 2e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 3e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-04
1eer_B227 Epobp, erythropoietin receptor; signal transductio 5e-07
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 5e-07
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 6e-07
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 2e-06
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 2e-06
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 5e-06
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 7e-06
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-05
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 5e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-04
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 6e-05
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 6e-04
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 6e-05
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 8e-05
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 1e-04
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 2e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 3e-04
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 6e-04
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 8e-04
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 8e-04
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
 Score =  129 bits (326), Expect = 1e-37
 Identities = 38/119 (31%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 86  QPSNSMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNS 145
             S  + V++L DVPSAAP+ +S  V N  S  + W PP P   NG + GYKI+ +  + 
Sbjct: 4   GSSGDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASR 63

Query: 146 TKILAQMSLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPV---TLVMDPHAPP 201
              + +  ++ +  S L+  L  G  Y  RV A T  G GP +  +   T   D     
Sbjct: 64  KSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETR 122


>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.92
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.92
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.91
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.91
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.9
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.9
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.9
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.89
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.89
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.89
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.89
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.89
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.88
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.88
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.88
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.87
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.85
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.84
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.83
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.83
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.83
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.83
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.82
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.82
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.82
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.82
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.82
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.81
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.81
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.81
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.8
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.8
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.8
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.8
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.79
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.78
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.78
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.77
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.77
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.77
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.76
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.76
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.76
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.76
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.76
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.76
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.75
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.74
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.73
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.73
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.73
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.73
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.73
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.72
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.72
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.72
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.71
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.71
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.7
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.7
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.7
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.7
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.69
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.69
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.69
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.69
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.69
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.69
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.69
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.68
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.68
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.67
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.67
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.66
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.66
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.66
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.65
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.65
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.65
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.65
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.64
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.64
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.63
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.62
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.62
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.62
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.61
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.61
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.61
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.6
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.6
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.59
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.58
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.57
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.57
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.56
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.55
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.55
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.54
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.54
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.54
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.53
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.53
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.52
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.52
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.52
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.52
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.51
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.5
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.5
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.5
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.5
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.49
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.49
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.49
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.49
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.49
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.47
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.47
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.46
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.46
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.45
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.44
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.44
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.44
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.42
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.42
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.42
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.41
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.41
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.41
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.4
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.4
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.4
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.4
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.39
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.37
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.37
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.36
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.34
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.33
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.32
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.29
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.29
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.26
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.26
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.22
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.21
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.2
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.15
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.14
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.12
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.12
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.11
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.08
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.07
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.05
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.04
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.01
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 98.98
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.97
1x4x_A106 Fibronectin type-III domain containing protein 3A; 98.96
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 98.95
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.95
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 98.95
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.93
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.89
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.88
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.88
1x3d_A118 Fibronectin type-III domain containing protein 3A; 98.86
1x5x_A109 Fibronectin type-III domain containing protein 3A; 98.86
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.86
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 98.85
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 98.84
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 98.84
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.83
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 98.83
2crz_A110 Fibronectin type-III domain containing protein 3A; 98.81
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.79
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 98.79
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 98.78
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 98.78
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.78
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.78
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 98.77
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 98.77
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 98.76
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 98.76
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 98.76
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 98.76
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.75
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.75
2crm_A120 Fibronectin type-III domain containing protein 3A; 98.74
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 98.74
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 98.73
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 98.73
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 98.7
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.69
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.68
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 98.67
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 98.67
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.67
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.67
1eer_B227 Epobp, erythropoietin receptor; signal transductio 98.67
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 98.65
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 98.65
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 98.65
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 98.64
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 98.64
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.62
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 98.62
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 98.61
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 98.61
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.58
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 98.56
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.56
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 98.54
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 98.54
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 98.49
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.48
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.47
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.46
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.45
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.45
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.4
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.35
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 98.34
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 98.34
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.32
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.32
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.31
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.29
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.28
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.2
3t04_D103 Monobody 7C12; engineered binding protein, antibod 98.19
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.16
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.13
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.13
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.03
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 97.99
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 97.99
3k2m_C101 Monobody HA4; engineered binding protein, antibody 97.97
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 97.95
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 97.92
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 97.92
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 97.91
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.9
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 97.89
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 97.88
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 97.86
2erj_C247 Cytokine receptor common gamma chain; immune syste 97.81
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.81
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 97.78
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 97.76
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 97.72
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 97.69
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.67
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 97.63
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.54
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 97.39
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 97.34
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.34
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 97.33
1oww_A98 FN, fibronectin first type III module, CIG; fibron 97.27
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.1
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 97.04
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 97.02
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 96.95
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 96.81
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 96.64
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 96.42
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 96.41
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 96.28
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 96.19
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 96.16
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 96.08
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 95.92
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 95.92
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 95.85
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 95.6
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 95.56
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 94.81
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 94.18
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 94.11
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 93.24
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 92.0
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 91.97
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 90.95
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 86.52
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 83.89
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 83.18
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 81.7
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 81.69
4a2l_A795 BT_4663, two-component system sensor histidine kin 80.9
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
Probab=99.92  E-value=2.8e-24  Score=182.53  Aligned_cols=180  Identities=14%  Similarity=0.123  Sum_probs=143.6

Q ss_pred             cccccccCCCCCCCcceeEEeeeeeccCCCCe-eEeCCCCcccceEecCcccCccCCCCeEEEEEEEEEECcccCCCC-C
Q psy15129         12 DSRNYEDGRGNYEDSRGNYEDGRGKYEDGRNK-YEDGRSKYEDNRSCSGMRMGEINTKMGEVNTRIIEVVVGVIRQPS-N   89 (308)
Q Consensus        12 ~~~~~~~~~~~~~~i~gy~i~wr~~~~~~~~~-~~~~~~~~~~~~~~~~L~pg~~~~p~T~Y~~~V~a~n~~G~g~~S-~   89 (308)
                      -.+.|+.+.++...|.+|.|.|+.....+... ...........+.+ +|+|      ++.|.|+|.|+|..|.|.+| .
T Consensus        21 v~l~W~~p~~~~~~i~~Y~v~~~~~~~~~~w~~~~~~~~~~~~~~~~-~L~p------~t~Y~~~V~A~n~~G~~~~s~~   93 (205)
T 1cfb_A           21 AEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVV-QMSP------WANYTFRVIAFNKIGASPPSAH   93 (205)
T ss_dssp             EEEEEECCCCTTSCCCEEEEEEEESSSTTCCEEEEEEEETTCSEEEE-ECCS------SEEEEEEEEEEETTEECCCCCC
T ss_pred             EEEEEECcccCCCceEEEEEEEecCCCCCCceeeeeccCCCceEEEE-eCCC------CCEEEEEEEEEECCccCCCCCC
Confidence            45889988878889999999998654333221 11222233344555 7887      88999999999999999998 5


Q ss_pred             cEEEeccCCCCCCCCcceEEEEecCcEEEEEEeCCCCCCCCceeeEEEEEEEEcCCCceEEEEEe-cCcccEEEEccCCC
Q psy15129         90 SMLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSL-NASTTSVLLNNLTS  168 (308)
Q Consensus        90 ~v~~~T~~~~P~~~P~~l~v~~~~~tsv~VsW~pP~~~~~~g~I~~Y~V~~~~~~~~~~~~~~~~-~~~~t~~~l~~L~p  168 (308)
                      .+.++|.+.+|..+|.++.+...+.++|.|+|++|+....+|.|.+|.|.|+..+....+....+ ....+.+.|.+|.|
T Consensus        94 ~~~~~T~~~~P~~~P~~~~~~~~~~~sv~l~W~~p~~~~~ng~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p  173 (205)
T 1cfb_A           94 SDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPT  173 (205)
T ss_dssp             CCCEEECCCCCSCCCSCCEEECSSTTCEEEECCCCCGGGTCSSSCEEEEEEEESSTTCCCEEEEECCTTCCEEEECSCCS
T ss_pred             ceeEEcCCcCCCCCCeeeEeecCCCCeEEEEEECCCccccCCCceEEEEEEEECCCCCCcEEEEecCCCccEEEEcCCCC
Confidence            68889999999888999999888999999999999544789999999999998665443444444 34678999999999


Q ss_pred             CCeEEEEEEEEeCCCCCCC-CccEEEeeCCC
Q psy15129        169 GAVYTARVVAYTRAGLGPY-SAPVTLVMDPH  198 (308)
Q Consensus       169 ~t~Y~v~V~A~n~~G~G~~-S~~v~~~T~p~  198 (308)
                      ++.|.|+|+|+|..|.|++ |.++.++|.++
T Consensus       174 ~t~Y~~~V~A~n~~G~g~~ss~~v~~~T~e~  204 (205)
T 1cfb_A          174 FVKYLIKVVAINDRGESNVAAEEVVGYSGED  204 (205)
T ss_dssp             SCEEEEEEEEEETTEECSSCCCCEEEESSSC
T ss_pred             CcEEEEEEEEEcCCCcCCCCCCcEEEecCCC
Confidence            9999999999999999995 78888888765



>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 2e-20
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 6e-19
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 7e-19
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-15
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 8e-15
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 4e-13
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 4e-13
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 7e-13
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 8e-13
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 9e-13
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-12
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 5e-12
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 2e-11
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-11
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 2e-10
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-10
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-10
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 7e-10
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 1e-09
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 1e-09
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-09
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 2e-09
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 3e-09
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 6e-09
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 8e-09
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 8e-09
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 2e-08
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 2e-08
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 2e-08
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 4e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-07
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 1e-07
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-07
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 4e-07
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 5e-07
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 6e-07
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 8e-07
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 8e-07
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 1e-06
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 2e-06
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 5e-06
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 8e-06
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 1e-05
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 1e-05
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 5e-05
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 6e-05
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 9e-05
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-04
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 3e-04
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 0.001
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 0.002
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.002
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 0.004
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.6 bits (203), Expect = 2e-20
 Identities = 35/109 (32%), Positives = 53/109 (48%)

Query: 93  VQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQM 152
           V++L DVPSAAP+ +S  V N  S  + W PP P   NG + GYKI+ +  +    + + 
Sbjct: 4   VRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTET 63

Query: 153 SLNASTTSVLLNNLTSGAVYTARVVAYTRAGLGPYSAPVTLVMDPHAPP 201
            ++ +  S L+  L  G  Y  RV A T  G GP +  ++         
Sbjct: 64  LVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLD 112


>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.7
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.69
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.68
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.68
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.64
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.63
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.62
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.61
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.61
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.6
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.6
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.59
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.59
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.59
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.58
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.56
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.55
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.55
d2crza197 Fibronectin type-III domain containing protein 3a, 99.53
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.52
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.52
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.52
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.51
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.51
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.5
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.5
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.49
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.48
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.47
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.45
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.43
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.42
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.42
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.42
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.42
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.41
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.4
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.4
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.4
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.39
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.38
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.38
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.38
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.38
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.34
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.32
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.32
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.32
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.31
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.3
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.3
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.29
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.29
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.19
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.17
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.1
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.05
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.04
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.02
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.89
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.84
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.83
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.78
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.76
d2crza197 Fibronectin type-III domain containing protein 3a, 98.76
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.74
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.74
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.71
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.71
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.69
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 98.66
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.65
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.65
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.65
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.64
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.64
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.64
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.61
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.61
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.6
d1x3da1105 Fibronectin type-III domain containing protein 3a, 98.59
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.56
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 98.56
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.54
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.54
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.54
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.51
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.51
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.5
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.48
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.46
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.44
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.42
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 98.4
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.38
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.38
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.36
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.34
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.32
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.28
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.27
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.25
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.23
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.23
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.23
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.21
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.14
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.1
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.09
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.05
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.03
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.03
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.01
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.01
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.0
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 97.98
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.95
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.95
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.94
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 97.93
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 97.88
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 97.88
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.84
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 97.83
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.79
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.72
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.5
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 97.49
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 97.3
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.12
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.11
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 97.09
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 97.01
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 96.79
d2c4fu1116 Extracellular region of human tissue factor {Human 96.77
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.73
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 96.47
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.16
d2hfta1106 Extracellular region of human tissue factor {Human 95.39
d1a21a1103 Extracellular region of human tissue factor {Rabbi 95.16
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 94.52
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 93.34
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=1.3e-19  Score=139.24  Aligned_cols=112  Identities=31%  Similarity=0.498  Sum_probs=95.5

Q ss_pred             EEEeccCCCCCCCCcceEEEEecCcEEEEEEeCCCCCCCCceeeEEEEEEEEcCCCceEEEEEecCcccEEEEccCCCCC
Q psy15129         91 MLVQSLEDVPSAAPEAMSAGVLNLTSAFVKWSPPPPQHHNGILLGYKIQVKAYNSTKILAQMSLNASTTSVLLNNLTSGA  170 (308)
Q Consensus        91 v~~~T~~~~P~~~P~~l~v~~~~~tsv~VsW~pP~~~~~~g~I~~Y~V~~~~~~~~~~~~~~~~~~~~t~~~l~~L~p~t  170 (308)
                      +.++|.+++|..+|.++++...+.++|.|+|++|+....+|.|.+|.|.|+..+.........+....+++.|.+|+|++
T Consensus         2 v~v~T~~~~P~~~P~~v~~~~~~~~si~v~W~~p~~~~~ng~i~~Y~v~y~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t   81 (119)
T d1x5ha1           2 VAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGT   81 (119)
T ss_dssp             CCCCCCCSSCCCCCEEEEEECCSSSEEEEEEECCCTTTCCSCEEEEBCEEEETTEEEEEECCBCCTTCCEEEEECCCSSC
T ss_pred             EEEEcCCCCCCCCCcCeEEEEecCcEEEEEEEcccccCCCCCEEEEEEEEeecccccceeeeecCCCccEEEeCCCCCCC
Confidence            45789999999889999999999999999999997778889999999999875543333333456778899999999999


Q ss_pred             eEEEEEEEEeCCCCCCCCccEEEeeCCCCCCC
Q psy15129        171 VYTARVVAYTRAGLGPYSAPVTLVMDPHAPPH  202 (308)
Q Consensus       171 ~Y~v~V~A~n~~G~G~~S~~v~~~T~p~~P~~  202 (308)
                      .|.|+|+|+|..|.|++|..+.++|.+..|..
T Consensus        82 ~Y~~~V~A~n~~G~G~~S~~~~~~T~~~~~~~  113 (119)
T d1x5ha1          82 EYNFRVAALTINGTGPATDWLSAETFESDLDE  113 (119)
T ss_dssp             EEEEECEEEETTEEEEECCCEEEECCSSCCCC
T ss_pred             EEEEEEEEEcCCcCCCCCCCEEEEeCCCCCCC
Confidence            99999999999999999999999998665543



>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure