Psyllid ID: psy15208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------103
MISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYDSGNGETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY
ccccccEEEEcccEEEEEEEEcccccccEEEEccEEEEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHccccEEEEEEEEEEcEEEEEccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEcccEEccHHHHHHHHHccccccccccccccccEEEEEEcccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccEEEEEEEEEcccccccccHHHHHHHHHHHcccccccccccccccEEEcccccEEEccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccccHHHcccccHHHcccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccHHHHccccEEEEEccccccHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEHHHHcccccEEEEcccccccccHHHHHHccccEEEEccccccHHHccHHHcccccccccccccEEEcccccEEEEEEccccccccccccccccccccccHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHcccccccccHHHHHHcccccccccccccccc
cccccEEEEEcccHHHEEEEEccccHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHccHHHEEEEcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEccccHHHHHHHHHHHHHcccccccccccccHHEEEEEEccccccHHccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccEEEEEEEEEccccccccHHHHHHHHHHHHHccHccHHHHHHccEEEcccccEEEEcccccccccccEEEEEcccccccccccccccccccHccHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHHccccccEEEEEEcccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHHcccEEEcccccccccEEEEccccccccccccccEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHcccHHccccccccccccHHHHHHHHHHHHHHHHcccHcHHHHHHccEEEEccHHHHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHHHccEEEEccEEEEEcccccEEEEEHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHHcHHHcccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccc
MISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVliahphplfggtmdNKVVQTLVRVMLSLGYISIRmnfrgvgassgtydsgngetdDMEILLRYIQkkypylpiilagFSFGTFVQAKLQKRLDKEISIKILILISVAVKKwlipevpkntiiihgeldeiiplkdvflwanpldipvvvipesvseghpdkiADQISDAILDEIFLKDLKARVAAETLCnnnlivlsgeittdaniDYVNIVRKTIKdigynnidygidyKSCAVLLIYNKQSLdiaqgvnegeglnfdqgagdqglmfgyacdetpelmpsaiYYSHLIVKRQSElrkngnlpwlrpdaksqvtlrydngkpvaiDTIVlstqhdpeipyrsIKEAAIEEIirpiipknllkntrylinptgrfviggpkgdcgltgrKIIVdtyggaaphgggafsgkdpskidrsAAYVGRYIAKNIVAANLAKRCQIQISYAigvakptsimvtsfgsgkisdeKLTMLVKKHFDLRPKNIIKMLNLLRPiykktsvyghfgrkepeftwelTDKAEVLKNSADFVIADinlsqwgrKEIEIAETEMFSLISIREEFvkskplkgarisgsiHMTIQTAVLIETLKCLgaevrwsscniystqDHAAAAIASkgipvfafkgesisdywefnhrifdwpgnsnteqanmilddggdATFLLHLGAQaennisilsnpcseeEVCLFKSIKNKLKIDSKWYSSRLKQIkgvteettTGVYRLRRMfkegklsfpainvndsvtkskfdnlyGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKykwenikpqvdhiifpdGKKIILLAEGrlvnlgcgtghpsyvmsssfANQTLAQIELfnntsnypigiytlpKILDEKVARLQLKKLNVQLSKLTDQQAKyigvskngpykldnyry
MISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHplfggtmdnKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYDSGNGETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNnnlivlsgeittdaniDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSElrkngnlpwlrpDAKSQVTLRYDNGKPVAIDTIvlstqhdpeipyRSIKEAAIEEiirpiipknllkNTRYLINptgrfviggpkgDCGLTGRKIIVDTYGGaaphgggafsgkdpskIDRSAAYVGRYIAKNIVAANLAKRCQIQISYaigvakptSIMVTSFgsgkisdeKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIAdinlsqwgrKEIEIAETEMFSLISIREEFVKSkplkgarisgsihMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKnklkidskwyssrlkqikgvteetttgvyRLRRMfkegklsfpainvndsvtkskfdnLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQlskltdqqakyigvskngpykldnyry
MISNTKFFNINGSVGILHCAINFPSSIkllklkGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYDSGNGETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEisikililisvavkKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSikeaaieeiirpiipkNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY
*****KFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYD****ETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGG*********IDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGV*************
***NTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGA*********GETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNS**FVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYK***YRY
MISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYDSGNGETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY
*ISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGAS**T*****GETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGA*******FSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLD*Y**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISNTKFFNINGSVGILHCAINFPSSIKLLKLKGVVLIAHPHPLFGGTMDNKVVQTLVRVMLSLGYISIRMNFRGVGASSGTYDSGNGETDDMEILLRYIQKKYPYLPIILAGFSFGTFVQAKLQKRLDKEISIKILILISVAVKKWLIPEVPKNTIIIHGELDEIIPLKDVFLWANPLDIPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNIDYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPWLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLLKNTRYLINPTGRFVIGGPKGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSGKISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLPKILDxxxxxxxxxxxxxxxxxxxxxQAKYIGVSKNGPYKLDNYRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1027 2.2.26 [Sep-21-2011]
A4G975479 Adenosylhomocysteinase OS yes N/A 0.454 0.974 0.782 0.0
A6T2Y9479 Adenosylhomocysteinase OS yes N/A 0.454 0.974 0.778 0.0
B2U774474 Adenosylhomocysteinase OS yes N/A 0.448 0.972 0.745 0.0
B2AGG2472 Adenosylhomocysteinase OS yes N/A 0.448 0.976 0.742 0.0
Q8Y387474 Adenosylhomocysteinase OS yes N/A 0.448 0.972 0.743 0.0
Q1LS20472 Adenosylhomocysteinase OS yes N/A 0.448 0.976 0.740 0.0
Q5P6B7470 Adenosylhomocysteinase OS yes N/A 0.454 0.993 0.734 0.0
Q476T8472 Adenosylhomocysteinase OS yes N/A 0.448 0.976 0.740 0.0
Q0KF25472 Adenosylhomocysteinase OS yes N/A 0.448 0.976 0.733 0.0
Q1CY84476 Adenosylhomocysteinase OS yes N/A 0.451 0.974 0.723 0.0
>sp|A4G975|SAHH_HERAR Adenosylhomocysteinase OS=Herminiimonas arsenicoxydans GN=ahcY PE=3 SV=1 Back     alignment and function desciption
 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/469 (78%), Positives = 414/469 (88%), Gaps = 2/469 (0%)

Query: 561  NSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAV 620
            N +D+VIAD++LS WG KEI IAETEM  L++IREEF  ++PLKGARI+GSIHMTIQTAV
Sbjct: 11   NFSDYVIADLSLSVWGDKEIRIAETEMPGLMAIREEFAAAQPLKGARITGSIHMTIQTAV 70

Query: 621  LIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPG 680
            LI+TL+ LGA+VRW+SCNIYSTQDHAAAAIA+ G PVFA KGE++ DYWE+ HRIF+WP 
Sbjct: 71   LIQTLEALGAKVRWASCNIYSTQDHAAAAIAAAGTPVFAVKGETLDDYWEYTHRIFEWPN 130

Query: 681  NSNTEQ--ANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSK 738
            +       +NMILDDGGDAT LLHLG +AE + S+L+NP SEEE+CLF SIK  L +D+ 
Sbjct: 131  DDKGAPVYSNMILDDGGDATLLLHLGTRAEKDASVLNNPGSEEEICLFNSIKKHLAVDAT 190

Query: 739  WYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLID 798
            WYS RL QI GVTEETTTGV+RL +M KEGKL+FPAINVNDSVTKSKFDNLYGCRESL+D
Sbjct: 191  WYSKRLPQILGVTEETTTGVHRLYQMHKEGKLAFPAINVNDSVTKSKFDNLYGCRESLVD 250

Query: 799  GIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVT 858
            GIKRATDVMIAGK+AVI GYGDVGKGSAQAMRALSAQVW+ EIDPICALQAAMEG+ VVT
Sbjct: 251  GIKRATDVMIAGKVAVIAGYGDVGKGSAQAMRALSAQVWVTEIDPICALQAAMEGYRVVT 310

Query: 859  MEYAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKP 918
            M+YA ++GDIFVTCTGNYHVITHDHM  MKDQAIVCNIGHFDNEIEV  LK+Y WENIKP
Sbjct: 311  MDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIEVAALKQYTWENIKP 370

Query: 919  QVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGI 978
            QVDHIIFPDGK+IILLAEGRLVNLGCGTGHPSYVMSSSFANQT+AQIEL+ NT NYP+G+
Sbjct: 371  QVDHIIFPDGKRIILLAEGRLVNLGCGTGHPSYVMSSSFANQTIAQIELYANTKNYPVGV 430

Query: 979  YTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027
            YTLPK LDEKVARLQLKKLN QL+ LTD+QA YIGV K GPYK ++YRY
Sbjct: 431  YTLPKHLDEKVARLQLKKLNSQLTTLTDEQANYIGVQKAGPYKPEHYRY 479
May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine.
Herminiimonas arsenicoxydans (taxid: 204773)
EC: 3EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|A6T2Y9|SAHH_JANMA Adenosylhomocysteinase OS=Janthinobacterium sp. (strain Marseille) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|B2U774|SAHH_RALPJ Adenosylhomocysteinase OS=Ralstonia pickettii (strain 12J) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|B2AGG2|SAHH_CUPTR Adenosylhomocysteinase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q8Y387|SAHH_RALSO Adenosylhomocysteinase OS=Ralstonia solanacearum (strain GMI1000) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q1LS20|SAHH_RALME Adenosylhomocysteinase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q5P6B7|SAHH_AROAE Adenosylhomocysteinase OS=Aromatoleum aromaticum (strain EbN1) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q476T8|SAHH_CUPPJ Adenosylhomocysteinase OS=Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q0KF25|SAHH_CUPNH Adenosylhomocysteinase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q1CY84|SAHH_MYXXD Adenosylhomocysteinase OS=Myxococcus xanthus (strain DK 1622) GN=ahcY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1027
399019141471 adenosylhomocysteinase [Herbaspirillum s 0.452 0.987 0.806 0.0
48428750480 S-adenosylhomocysteine hydrolase [Collim 0.448 0.960 0.797 0.0
340789208475 adenosylhomocysteinase [Collimonas fungi 0.448 0.970 0.797 0.0
427399720470 adenosylhomocysteinase [Massilia timonae 0.454 0.993 0.768 0.0
134096108479 S-adenosyl-L-homocysteine hydrolase [Her 0.454 0.974 0.782 0.0
152980530479 S-adenosyl-L-homocysteine hydrolase [Jan 0.454 0.974 0.778 0.0
329904560479 Adenosylhomocysteinase [Oxalobacteraceae 0.451 0.968 0.763 0.0
237749247470 S-adenosylhomocysteine hydrolase [Oxalob 0.454 0.993 0.759 0.0
358635592474 S-adenosyl-L-homocysteine hydrolase [Azo 0.457 0.991 0.764 0.0
302879841470 adenosylhomocysteinase [Gallionella caps 0.448 0.980 0.752 0.0
>gi|399019141|ref|ZP_10721290.1| adenosylhomocysteinase [Herbaspirillum sp. CF444] gi|398098288|gb|EJL88575.1| adenosylhomocysteinase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/466 (80%), Positives = 418/466 (89%), Gaps = 1/466 (0%)

Query: 562  SADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVL 621
            + D+VIADI L+QWG KEI+IAETEM  L++IREEF  ++PLKGARI+GSIHMTIQTAVL
Sbjct: 7    TKDYVIADIGLAQWGHKEIKIAETEMPGLMAIREEFAAAQPLKGARITGSIHMTIQTAVL 66

Query: 622  IETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGN 681
            I+TL+ LGA+VRW+SCNIYSTQDHAAAAIA KG PVFAFKGES+ DYWEF HRIF+W G 
Sbjct: 67   IQTLEALGAKVRWASCNIYSTQDHAAAAIADKGTPVFAFKGESLDDYWEFTHRIFEWQGG 126

Query: 682  SNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYS 741
             N EQANMILDDGGDAT LLHLG +AE + S+L+NP SEEE+CLF SIK +L   + WYS
Sbjct: 127  EN-EQANMILDDGGDATLLLHLGTRAEKDASVLNNPTSEEEICLFNSIKKRLASHTNWYS 185

Query: 742  SRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIK 801
            SRL QIKGVTEETTTGV+RL +M K+GKL+FPAINVNDSVTKSKFDNLYGCRESL+DGIK
Sbjct: 186  SRLAQIKGVTEETTTGVHRLYQMHKDGKLAFPAINVNDSVTKSKFDNLYGCRESLVDGIK 245

Query: 802  RATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEY 861
            RATDVMIAGK+AVI GYGDVGKGSAQAMRALSAQVW+ EIDPICALQAAMEG+ VVTM+Y
Sbjct: 246  RATDVMIAGKVAVIAGYGDVGKGSAQAMRALSAQVWVTEIDPICALQAAMEGYRVVTMDY 305

Query: 862  AKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVD 921
            A ++GDIFVTCTGNYHVITHDHM+ MKDQAIVCNIGHFDNEIEV  LK+Y WENIKPQVD
Sbjct: 306  AAEHGDIFVTCTGNYHVITHDHMKKMKDQAIVCNIGHFDNEIEVAALKQYTWENIKPQVD 365

Query: 922  HIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTL 981
            HIIFPDGK+IILLAEGRLVNLGCGTGHPSYVMSSSFANQT+AQIELF NT NYP+G+YTL
Sbjct: 366  HIIFPDGKRIILLAEGRLVNLGCGTGHPSYVMSSSFANQTIAQIELFVNTKNYPVGVYTL 425

Query: 982  PKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027
            PK LDEKVARLQLKKLN QLS LT +QA YIGV  +GPYK D+YRY
Sbjct: 426  PKHLDEKVARLQLKKLNAQLSTLTAEQASYIGVKTDGPYKPDHYRY 471

Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|48428750|gb|AAT42399.1| S-adenosylhomocysteine hydrolase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|340789208|ref|YP_004754673.1| adenosylhomocysteinase [Collimonas fungivorans Ter331] gi|340554475|gb|AEK63850.1| Adenosylhomocysteinase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|427399720|ref|ZP_18890958.1| adenosylhomocysteinase [Massilia timonae CCUG 45783] gi|425721482|gb|EKU84395.1| adenosylhomocysteinase [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|134096108|ref|YP_001101183.1| S-adenosyl-L-homocysteine hydrolase [Herminiimonas arsenicoxydans] gi|226695335|sp|A4G975.1|SAHH_HERAR RecName: Full=Adenosylhomocysteinase; AltName: Full=S-adenosyl-L-homocysteine hydrolase; Short=AdoHcyase gi|133740011|emb|CAL63062.1| Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|152980530|ref|YP_001354886.1| S-adenosyl-L-homocysteine hydrolase [Janthinobacterium sp. Marseille] gi|226695336|sp|A6T2Y9.1|SAHH_JANMA RecName: Full=Adenosylhomocysteinase; AltName: Full=S-adenosyl-L-homocysteine hydrolase; Short=AdoHcyase gi|151280607|gb|ABR89017.1| adenosylhomocysteinase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|329904560|ref|ZP_08273866.1| Adenosylhomocysteinase [Oxalobacteraceae bacterium IMCC9480] gi|327547920|gb|EGF32670.1| Adenosylhomocysteinase [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|237749247|ref|ZP_04579727.1| S-adenosylhomocysteine hydrolase [Oxalobacter formigenes OXCC13] gi|229380609|gb|EEO30700.1| S-adenosylhomocysteine hydrolase [Oxalobacter formigenes OXCC13] Back     alignment and taxonomy information
>gi|358635592|dbj|BAL22889.1| S-adenosyl-L-homocysteine hydrolase [Azoarcus sp. KH32C] Back     alignment and taxonomy information
>gi|302879841|ref|YP_003848405.1| adenosylhomocysteinase [Gallionella capsiferriformans ES-2] gi|302582630|gb|ADL56641.1| adenosylhomocysteinase [Gallionella capsiferriformans ES-2] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1027
TIGR_CMR|GSU_1875475 GSU_1875 "adenosylhomocysteina 0.449 0.972 0.726 1.6e-182
TIGR_CMR|SPO_3861462 SPO_3861 "adenosylhomocysteina 0.448 0.997 0.598 7.3e-146
TAIR|locus:2095193485 SAHH2 "S-adenosyl-l-homocystei 0.454 0.962 0.566 3.4e-132
TAIR|locus:2129256485 HOG1 "HOMOLOGY-DEPENDENT GENE 0.454 0.962 0.559 1.2e-131
UNIPROTKB|P60176495 ahcY "Adenosylhomocysteinase" 0.451 0.937 0.553 3.2e-129
TIGR_CMR|GSU_1880389 GSU_1880 "S-adenosylmethionine 0.366 0.966 0.596 3.4e-125
TIGR_CMR|SO_0929383 SO_0929 "S-adenosylmethionine 0.362 0.971 0.625 3.6e-121
TIGR_CMR|CBU_2030393 CBU_2030 "S-adenosylmethionine 0.370 0.969 0.606 4.6e-121
UNIPROTKB|P0A817384 metK "methionine adenosyltrans 0.362 0.968 0.620 7.4e-121
UNIPROTKB|P0A819384 metK "S-adenosylmethionine syn 0.362 0.968 0.620 7.4e-121
TIGR_CMR|GSU_1875 GSU_1875 "adenosylhomocysteinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 1771 (628.5 bits), Expect = 1.6e-182, P = 1.6e-182
 Identities = 338/465 (72%), Positives = 388/465 (83%)

Query:   563 ADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLI 622
             +D+ I+DI+L+ WGRKE+ IAETEM  L++IREE+  ++PL+GARI+GS+HMTIQTA+LI
Sbjct:    14 SDYCISDISLAAWGRKEMIIAETEMPGLMAIREEYAATRPLQGARIAGSLHMTIQTAMLI 73

Query:   623 ETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNS 682
             ETL  LGAEVRW+SCNI+STQDHAAAAIA+ GIPVFA+KGES+ +YWEF HRIF+W    
Sbjct:    74 ETLVALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAYKGESLEEYWEFTHRIFEWHDGG 133

Query:   683 NTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSS 742
                  NMILDDGGDAT LLHLG+ AE + S+++NP  EEE  LF SIK +L     WYS 
Sbjct:   134 TP---NMILDDGGDATLLLHLGSDAEKDPSVIANPTCEEEQYLFASIKKRLAEKPGWYSK 190

Query:   743 RLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKR 802
                 IKGVTEETTTGV+RL +M ++GKL FPAINVNDSVTKSKFDN+YGCRESL+DGIKR
Sbjct:   191 TAAAIKGVTEETTTGVHRLYQMHEKGKLKFPAINVNDSVTKSKFDNIYGCRESLVDGIKR 250

Query:   803 ATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYA 862
             ATDVMIAGK+AVI GYG+VGKG AQAMR L AQVW+ EIDPICALQAAMEG+ VVTMEYA
Sbjct:   251 ATDVMIAGKVAVICGYGEVGKGCAQAMRGLQAQVWVTEIDPICALQAAMEGYRVVTMEYA 310

Query:   863 KKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDH 922
                 DIFVT TGN +VITHDHM+ M+  AIVCNIGHFDNEIEV  LK+Y+WENIKPQVDH
Sbjct:   311 ADKADIFVTTTGNINVITHDHMKAMRHNAIVCNIGHFDNEIEVAALKQYQWENIKPQVDH 370

Query:   923 IIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLP 982
             IIFPD K+IILLAEGRLVNLGC TGHPSYVMSSSFANQTLAQIELF N   YP+G+Y LP
Sbjct:   371 IIFPDSKRIILLAEGRLVNLGCATGHPSYVMSSSFANQTLAQIELFCNPGKYPVGVYMLP 430

Query:   983 KILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027
             K LDEKVARLQLK L   L++LTD+QA YIGV KNGPYK  +YRY
Sbjct:   431 KELDEKVARLQLKTLGAMLTELTDEQAAYIGVPKNGPYKSAHYRY 475
GO:0004013 "adenosylhomocysteinase activity" evidence=ISS
GO:0006730 "one-carbon metabolic process" evidence=ISS
TIGR_CMR|SPO_3861 SPO_3861 "adenosylhomocysteinase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TAIR|locus:2095193 SAHH2 "S-adenosyl-l-homocysteine (SAH) hydrolase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129256 HOG1 "HOMOLOGY-DEPENDENT GENE SILENCING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P60176 ahcY "Adenosylhomocysteinase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1880 GSU_1880 "S-adenosylmethionine synthetase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0929 SO_0929 "S-adenosylmethionine synthetase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2030 CBU_2030 "S-adenosylmethionine synthetase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P0A817 metK "methionine adenosyltransferase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P0A819 metK "S-adenosylmethionine synthase" [Escherichia coli O157:H7 (taxid:83334)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7V9P3SAHH_PROMA3, ., 3, ., 1, ., 10.66020.44980.9705yesN/A
B2U774SAHH_RALPJ3, ., 3, ., 1, ., 10.74570.44880.9725yesN/A
B9MD45SAHH_ACIET3, ., 3, ., 1, ., 10.72090.45760.9873yesN/A
Q5P6B7SAHH_AROAE3, ., 3, ., 1, ., 10.73400.45470.9936yesN/A
Q1LS20SAHH_RALME3, ., 3, ., 1, ., 10.74030.44880.9766yesN/A
Q8Y387SAHH_RALSO3, ., 3, ., 1, ., 10.74350.44880.9725yesN/A
A4G975SAHH_HERAR3, ., 3, ., 1, ., 10.78250.45470.9749yesN/A
A1TUG3SAHH_ACIAC3, ., 3, ., 1, ., 10.69700.45760.9894yesN/A
Q62G22SAHH_BURMA3, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
B1XSH8SAHH_POLNS3, ., 3, ., 1, ., 10.72860.44590.9521yesN/A
Q3JY79SAHH_BURP13, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q63PT2SAHH_BURPS3, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q2STU0SAHH_BURTA3, ., 3, ., 1, ., 10.70520.45860.9957yesN/A
A9IGY5SAHH_BORPD3, ., 3, ., 1, ., 10.70380.44980.9788yesN/A
A6T2Y9SAHH_JANMA3, ., 3, ., 1, ., 10.77820.45470.9749yesN/A
C5CM29SAHH_VARPS3, ., 3, ., 1, ., 10.71640.45470.9749yesN/A
A1V8Z2SAHH_BURMS3, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q82WL1SAHH_NITEU3, ., 3, ., 1, ., 10.67160.45660.9811yesN/A
Q1CY84SAHH_MYXXD3, ., 3, ., 1, ., 10.72310.45180.9747yesN/A
A2S6W2SAHH_BURM93, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
A9BD69SAHH_PROM43, ., 3, ., 1, ., 10.66520.45370.9789yesN/A
Q318B6SAHH_PROM93, ., 3, ., 1, ., 10.65530.45370.9872yesN/A
A4T0E9SAHH_POLSQ3, ., 3, ., 1, ., 10.72640.44590.9521yesN/A
Q7UZN3SAHH_PROMP3, ., 3, ., 1, ., 10.65940.44790.9745yesN/A
A3MQW7SAHH_BURM73, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q7V926SAHH_PROMM3, ., 3, ., 1, ., 10.65880.45370.9789yesN/A
B2T6X2SAHH_BURPP3, ., 3, ., 1, ., 10.70720.45270.9830yesN/A
A3PFB5SAHH_PROM03, ., 3, ., 1, ., 10.66520.44690.9724yesN/A
Q13T36SAHH_BURXL3, ., 3, ., 1, ., 10.70720.45270.9830yesN/A
Q60CG8SAHH_METCA3, ., 3, ., 1, ., 10.70040.44880.9766yesN/A
A2SL00SAHH_METPP3, ., 3, ., 1, ., 10.69310.45180.9727yesN/A
Q0IDX7SAHH_SYNS33, ., 3, ., 1, ., 10.65880.45370.9789yesN/A
A8G7D1SAHH_PROM23, ., 3, ., 1, ., 10.66300.44690.9724yesN/A
B2AGG2SAHH_CUPTR3, ., 3, ., 1, ., 10.74240.44880.9766yesN/A
A2C620SAHH_PROM33, ., 3, ., 1, ., 10.65670.45370.9789yesN/A
A3NER1SAHH_BURP63, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q7W1Z7SAHH_BORPA3, ., 3, ., 1, ., 10.70780.45270.9851yesN/A
Q7NZF7SAHH_CHRVO3, ., 3, ., 1, ., 10.67800.45371.0yesN/A
B2JIP4SAHH_BURP83, ., 3, ., 1, ., 10.71150.45270.9830yesN/A
Q3ANF4SAHH_SYNSC3, ., 3, ., 1, ., 10.66310.45860.9894yesN/A
Q7WQX5SAHH_BORBR3, ., 3, ., 1, ., 10.70780.45270.9851yesN/A
Q0KF25SAHH_CUPNH3, ., 3, ., 1, ., 10.73390.44880.9766yesN/A
B1Y647SAHH_LEPCP3, ., 3, ., 1, ., 10.70380.45180.9727yesN/A
A3P0L8SAHH_BURP03, ., 3, ., 1, ., 10.71090.45180.9809yesN/A
Q476T8SAHH_CUPPJ3, ., 3, ., 1, ., 10.74030.44880.9766yesN/A
P61617SAHH_GEOSL3, ., 3, ., 1, ., 10.72680.44980.9726yesN/A
A1W3P0SAHH_ACISJ3, ., 3, ., 1, ., 10.71880.45760.9873yesN/A
Q7VUL8SAHH_BORPE3, ., 3, ., 1, ., 10.71210.45270.9851yesN/A
A9C184SAHH_DELAS3, ., 3, ., 1, ., 10.69830.45950.9915yesN/A
Q0AEV8SAHH_NITEC3, ., 3, ., 1, ., 10.67370.45660.9811yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.3.10.766
4th Layer2.5.1.60.737
3rd Layer3.3.1.10.824
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1027
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 0.0
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 0.0
PRK05250384 PRK05250, PRK05250, S-adenosylmethionine synthetas 0.0
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 0.0
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 0.0
COG0192388 COG0192, MetK, S-adenosylmethionine synthetase [Co 0.0
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 0.0
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 0.0
TIGR01034377 TIGR01034, metK, S-adenosylmethionine synthetase 0.0
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 0.0
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 0.0
PRK12459386 PRK12459, PRK12459, S-adenosylmethionine synthetas 0.0
PTZ00104398 PTZ00104, PTZ00104, S-adenosylmethionine synthase; 0.0
PLN02243386 PLN02243, PLN02243, S-adenosylmethionine synthase 1e-155
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 5e-95
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 1e-94
pfam02773138 pfam02773, S-AdoMet_synt_C, S-adenosylmethionine s 1e-78
pfam02772119 pfam02772, S-AdoMet_synt_M, S-adenosylmethionine s 4e-71
pfam00438100 pfam00438, S-AdoMet_synt_N, S-adenosylmethionine s 6e-47
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 1e-45
COG2945210 COG2945, COG2945, Predicted hydrolase of the alpha 5e-44
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 2e-10
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 6e-09
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2e-05
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 0.001
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information 
 Score =  838 bits (2167), Expect = 0.0
 Identities = 299/464 (64%), Positives = 345/464 (74%), Gaps = 41/464 (8%)

Query: 566  VIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETL 625
             +ADI+L+ WGRKEIEIAETEM  L+++REE+   KPLKGARI+G +HMTIQTAVLIETL
Sbjct: 1    KVADISLADWGRKEIEIAETEMPGLMALREEYGAEKPLKGARIAGCLHMTIQTAVLIETL 60

Query: 626  KCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGNSNTE 685
              LGAEVRW+SCNI+STQDHAAAAIA+ G+PVFA+KGE++ +YW    +   WP      
Sbjct: 61   VALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLEEYWWCIEQTLTWPDG---W 117

Query: 686  QANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYSSRLK 745
              NMILDDGGDAT L+H                                   K Y   LK
Sbjct: 118  GPNMILDDGGDATLLVH-----------------------------------KKYPRMLK 142

Query: 746  QIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIKRATD 805
            +I+GV+EETTTGV+RL +M K+GKL FPAINVNDSVTKSKFDNLYGCRESL+DGIKRATD
Sbjct: 143  KIRGVSEETTTGVHRLYQMAKKGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGIKRATD 202

Query: 806  VMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKY 865
            VMIAGK+AV+ GYGDVGKG AQ++R   A+V + EIDPICALQAAM+GF VVTME     
Sbjct: 203  VMIAGKVAVVCGYGDVGKGCAQSLRGQGARVIVTEIDPICALQAAMDGFEVVTMEEVAPQ 262

Query: 866  GDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKY---KWENIKPQVDH 922
             DIFVT TGN  VIT +HMR MKD AIVCNIGHFDNEI+V  L+     KWENIKPQVDH
Sbjct: 263  ADIFVTTTGNKDVITREHMRAMKDGAIVCNIGHFDNEIDVASLRNNPGLKWENIKPQVDH 322

Query: 923  IIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTLP 982
            I FPDGK+IILLAEGRLVNLGC TGHPS+VMS+SF NQ LAQIELF     Y  G+Y LP
Sbjct: 323  ITFPDGKRIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFTKPGKYKNGVYVLP 382

Query: 983  KILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYR 1026
            K LDEKVARL L+KL  +L+KLT +QA YIGV   GP+K D+YR
Sbjct: 383  KKLDEKVARLHLEKLGAKLTKLTKEQADYIGVPVEGPFKPDHYR 426

Length = 426
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|235374 PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223270 COG0192, MetK, S-adenosylmethionine synthetase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|233241 TIGR01034, metK, S-adenosylmethionine synthetase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|237106 PRK12459, PRK12459, S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>gnl|CDD|240268 PTZ00104, PTZ00104, S-adenosylmethionine synthase; Provisional Back     alignment and domain information
>gnl|CDD|177886 PLN02243, PLN02243, S-adenosylmethionine synthase Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|111646 pfam02773, S-AdoMet_synt_C, S-adenosylmethionine synthetase, C-terminal domain Back     alignment and domain information
>gnl|CDD|217221 pfam02772, S-AdoMet_synt_M, S-adenosylmethionine synthetase, central domain Back     alignment and domain information
>gnl|CDD|201226 pfam00438, S-AdoMet_synt_N, S-adenosylmethionine synthetase, N-terminal domain Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|225496 COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1027
COG0192388 MetK S-adenosylmethionine synthetase [Coenzyme met 100.0
TIGR01034377 metK S-adenosylmethionine synthetase. Tandem isozy 100.0
PRK05250384 S-adenosylmethionine synthetase; Validated 100.0
PRK12459386 S-adenosylmethionine synthetase; Provisional 100.0
PLN02243386 S-adenosylmethionine synthase 100.0
PTZ00104398 S-adenosylmethionine synthase; Provisional 100.0
KOG1506|consensus383 100.0
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
KOG1370|consensus434 100.0
PLN02494477 adenosylhomocysteinase 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 100.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 100.0
PF02773138 S-AdoMet_synt_C: S-adenosylmethionine synthetase, 100.0
PF02772120 S-AdoMet_synt_M: S-adenosylmethionine synthetase, 100.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 100.0
PF00438100 S-AdoMet_synt_N: S-adenosylmethionine synthetase, 99.91
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.82
PHA02857276 monoglyceride lipase; Provisional 99.78
PLN02298330 hydrolase, alpha/beta fold family protein 99.78
PLN02385349 hydrolase; alpha/beta fold family protein 99.77
KOG1455|consensus313 99.76
PRK13604307 luxD acyl transferase; Provisional 99.74
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.71
PRK10749330 lysophospholipase L2; Provisional 99.71
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.69
PLN02652395 hydrolase; alpha/beta fold family protein 99.68
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.66
PRK00870302 haloalkane dehalogenase; Provisional 99.64
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.63
PRK10673255 acyl-CoA esterase; Provisional 99.63
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.63
PLN02824294 hydrolase, alpha/beta fold family protein 99.62
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.62
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.6
PLN02965255 Probable pheophorbidase 99.59
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.59
PLN02511388 hydrolase 99.59
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.58
KOG1552|consensus258 99.56
PRK10985324 putative hydrolase; Provisional 99.56
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.56
PRK03592295 haloalkane dehalogenase; Provisional 99.55
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.55
PRK10566249 esterase; Provisional 99.53
PLN02211273 methyl indole-3-acetate methyltransferase 99.53
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.53
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.53
PLN02679360 hydrolase, alpha/beta fold family protein 99.52
PRK10349256 carboxylesterase BioH; Provisional 99.52
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.52
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.51
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.51
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.5
PLN02578354 hydrolase 99.49
KOG4391|consensus300 99.49
COG1647243 Esterase/lipase [General function prediction only] 99.49
PRK03204286 haloalkane dehalogenase; Provisional 99.49
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.47
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.47
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.46
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.44
PRK06489360 hypothetical protein; Provisional 99.44
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.44
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.44
PRK07581339 hypothetical protein; Validated 99.43
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.41
KOG1454|consensus326 99.4
PRK11071190 esterase YqiA; Provisional 99.4
KOG4178|consensus322 99.39
KOG4667|consensus269 99.39
PRK08775343 homoserine O-acetyltransferase; Provisional 99.38
PLN02894402 hydrolase, alpha/beta fold family protein 99.37
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.37
PRK05855582 short chain dehydrogenase; Validated 99.37
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.36
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.36
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.32
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.32
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.32
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.31
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.3
PRK06487317 glycerate dehydrogenase; Provisional 99.27
PLN02928347 oxidoreductase family protein 99.24
PRK11460232 putative hydrolase; Provisional 99.24
PLN02872395 triacylglycerol lipase 99.23
PRK06932314 glycerate dehydrogenase; Provisional 99.23
PLN00021313 chlorophyllase 99.2
PLN03139386 formate dehydrogenase; Provisional 99.2
PLN02306386 hydroxypyruvate reductase 99.2
PRK07574385 formate dehydrogenase; Provisional 99.2
KOG1838|consensus409 99.2
KOG0068|consensus406 99.19
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.19
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.19
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.19
PLN02442283 S-formylglutathione hydrolase 99.18
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.18
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.17
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.16
PRK13243333 glyoxylate reductase; Reviewed 99.16
PRK06436303 glycerate dehydrogenase; Provisional 99.14
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.14
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.12
TIGR00976550 /NonD putative hydrolase, CocE/NonD family. This m 99.12
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.1
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.1
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.1
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.1
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.09
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.09
PRK10162318 acetyl esterase; Provisional 99.06
KOG4409|consensus365 99.05
KOG2564|consensus343 99.04
PRK10115686 protease 2; Provisional 99.03
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.03
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.01
KOG2382|consensus315 98.99
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.99
KOG0069|consensus336 98.97
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.97
PRK12480330 D-lactate dehydrogenase; Provisional 98.95
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.93
KOG0024|consensus354 98.92
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.92
PRK13403335 ketol-acid reductoisomerase; Provisional 98.91
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.9
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 98.88
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.87
PRK07868994 acyl-CoA synthetase; Validated 98.86
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.86
PRK08605332 D-lactate dehydrogenase; Validated 98.86
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 98.78
KOG2984|consensus277 98.76
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.71
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.69
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.69
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.66
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.65
COG0400207 Predicted esterase [General function prediction on 98.65
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.65
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.63
PRK06765389 homoserine O-acetyltransferase; Provisional 98.61
PRK09880343 L-idonate 5-dehydrogenase; Provisional 98.6
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.6
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.59
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.58
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.54
COG4099387 Predicted peptidase [General function prediction o 98.53
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.52
KOG2281|consensus867 98.52
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.5
KOG3043|consensus242 98.49
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 98.48
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.47
KOG2624|consensus403 98.47
COG0657312 Aes Esterase/lipase [Lipid metabolism] 98.46
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.45
COG4757281 Predicted alpha/beta hydrolase [General function p 98.45
PRK05371767 x-prolyl-dipeptidyl aminopeptidase; Provisional 98.43
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.42
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.41
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.41
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.41
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.39
PLN02827378 Alcohol dehydrogenase-like 98.37
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.36
KOG2100|consensus755 98.35
KOG1553|consensus517 98.33
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 98.31
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 98.31
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.3
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.28
KOG4627|consensus270 98.27
PRK05225 487 ketol-acid reductoisomerase; Validated 98.26
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 98.24
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.24
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 98.23
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 98.23
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.22
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.22
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.22
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.21
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.21
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.2
PRK05479330 ketol-acid reductoisomerase; Provisional 98.2
KOG2551|consensus230 98.2
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 98.19
COG2936563 Predicted acyl esterases [General function predict 98.19
PLN02740381 Alcohol dehydrogenase-like 98.19
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.18
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 98.17
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 98.17
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.16
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 98.16
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 98.16
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.13
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.13
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.13
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.12
COG4188365 Predicted dienelactone hydrolase [General function 98.12
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 98.11
PLN02178375 cinnamyl-alcohol dehydrogenase 98.11
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 98.11
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.09
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.09
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 98.09
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 98.08
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 98.07
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.07
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.06
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.06
PLN02586360 probable cinnamyl alcohol dehydrogenase 98.06
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 98.05
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.05
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 98.04
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 98.04
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.04
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 98.04
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 98.03
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.02
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 98.02
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.02
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.0
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.98
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.98
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.98
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 97.95
KOG1515|consensus336 97.94
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.94
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.93
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.93
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.93
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 97.92
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.91
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.91
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 97.9
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.9
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.9
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 97.84
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.83
KOG0022|consensus375 97.83
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 97.83
cd00312493 Esterase_lipase Esterases and lipases (includes fu 97.81
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.8
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 97.8
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 97.8
PF11339581 DUF3141: Protein of unknown function (DUF3141); In 97.79
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 97.78
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 97.78
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.72
PLN02514357 cinnamyl-alcohol dehydrogenase 97.72
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.71
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.71
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.7
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 97.67
PLN00203519 glutamyl-tRNA reductase 97.65
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.63
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.63
KOG0023|consensus360 97.62
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.62
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 97.61
PRK04439399 S-adenosylmethionine synthetase; Provisional 97.57
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 97.56
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.55
PLN02712667 arogenate dehydrogenase 97.55
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 97.55
PF01941396 AdoMet_Synthase: S-adenosylmethionine synthetase ( 97.55
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.54
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 97.54
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.53
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.52
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.51
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.51
PRK07417279 arogenate dehydrogenase; Reviewed 97.5
KOG3847|consensus399 97.48
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.47
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.46
PRK10083339 putative oxidoreductase; Provisional 97.45
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 97.44
PRK07340304 ornithine cyclodeaminase; Validated 97.43
PRK14982340 acyl-ACP reductase; Provisional 97.42
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.41
PRK13940414 glutamyl-tRNA reductase; Provisional 97.39
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.39
PF00135535 COesterase: Carboxylesterase family The prints ent 97.38
PLN02256304 arogenate dehydrogenase 97.36
PRK08618325 ornithine cyclodeaminase; Validated 97.35
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.35
COG3319257 Thioesterase domains of type I polyketide synthase 97.34
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 97.34
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.33
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.33
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.32
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 97.31
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.31
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 97.31
KOG2112|consensus206 97.31
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 97.29
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 97.27
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.27
PRK14031444 glutamate dehydrogenase; Provisional 97.26
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.25
PRK12861 764 malic enzyme; Reviewed 97.25
KOG3975|consensus301 97.24
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 97.23
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.22
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.22
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 97.21
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 97.21
PRK12862 763 malic enzyme; Reviewed 97.2
KOG2931|consensus326 97.2
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.2
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.18
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.16
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.14
PRK09414445 glutamate dehydrogenase; Provisional 97.14
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.14
PRK06719157 precorrin-2 dehydrogenase; Validated 97.13
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.11
PRK14030445 glutamate dehydrogenase; Provisional 97.11
PLN02712 667 arogenate dehydrogenase 97.1
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 97.09
PRK06545 359 prephenate dehydrogenase; Validated 97.08
PRK00779304 ornithine carbamoyltransferase; Provisional 97.07
PRK04940180 hypothetical protein; Provisional 97.06
PRK08507275 prephenate dehydrogenase; Validated 97.06
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 97.05
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.03
PLN02527306 aspartate carbamoyltransferase 97.03
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.03
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 97.03
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.02
PRK06823315 ornithine cyclodeaminase; Validated 97.02
COG1770682 PtrB Protease II [Amino acid transport and metabol 97.01
PRK06141314 ornithine cyclodeaminase; Validated 97.01
PLN02477410 glutamate dehydrogenase 97.0
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.0
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 97.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.0
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 96.99
PRK15059292 tartronate semialdehyde reductase; Provisional 96.97
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 96.96
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.96
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.95
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.94
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.94
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.93
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 96.92
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.91
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.91
PRK06046326 alanine dehydrogenase; Validated 96.89
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 96.89
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.88
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 96.87
PRK02102331 ornithine carbamoyltransferase; Validated 96.86
PRK06407301 ornithine cyclodeaminase; Provisional 96.86
PRK08655 437 prephenate dehydrogenase; Provisional 96.85
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.85
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 96.85
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.84
KOG2565|consensus469 96.83
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 96.83
PLN02688266 pyrroline-5-carboxylate reductase 96.82
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.79
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.76
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 96.76
PRK11891429 aspartate carbamoyltransferase; Provisional 96.74
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.74
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 96.73
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 96.73
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 96.72
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.71
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.71
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.7
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 96.69
PRK01713334 ornithine carbamoyltransferase; Provisional 96.69
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 96.69
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 96.68
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.67
PLN02342348 ornithine carbamoyltransferase 96.67
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 96.67
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.66
PRK04284332 ornithine carbamoyltransferase; Provisional 96.66
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.66
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.66
PRK07589346 ornithine cyclodeaminase; Validated 96.65
KOG3101|consensus283 96.64
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 96.64
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 96.64
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.64
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 96.63
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 96.63
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.63
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.62
COG1075336 LipA Predicted acetyltransferases and hydrolases w 96.61
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 96.61
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 96.6
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 96.6
PLN02858 1378 fructose-bisphosphate aldolase 96.59
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 96.57
PLN02858 1378 fructose-bisphosphate aldolase 96.57
PRK08291330 ectoine utilization protein EutC; Validated 96.57
COG1505648 Serine proteases of the peptidase family S9A [Amin 96.55
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.55
KOG2237|consensus712 96.54
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.54
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 96.52
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 96.51
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.51
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.5
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 96.5
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 96.49
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 96.49
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 96.48
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 96.46
KOG0067|consensus435 96.45
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.43
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.42
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.42
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 96.39
PRK14805302 ornithine carbamoyltransferase; Provisional 96.38
PRK02255338 putrescine carbamoyltransferase; Provisional 96.38
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 96.38
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.38
PRK08818 370 prephenate dehydrogenase; Provisional 96.35
PRK10637 457 cysG siroheme synthase; Provisional 96.35
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.35
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.34
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.33
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.31
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 96.31
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 96.29
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.27
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 96.27
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 96.26
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 96.26
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 96.25
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 96.24
PRK07680273 late competence protein ComER; Validated 96.24
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 96.24
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.23
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.22
PLN02702364 L-idonate 5-dehydrogenase 96.21
KOG3253|consensus784 96.21
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 96.2
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.19
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.18
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.16
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.16
cd08252336 AL_MDR Arginate lyase and other MDR family members 96.15
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 96.15
PLN02606306 palmitoyl-protein thioesterase 96.14
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.13
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.11
COG4814288 Uncharacterized protein with an alpha/beta hydrola 96.11
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 96.11
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.1
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.1
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.09
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 96.08
PTZ00317559 NADP-dependent malic enzyme; Provisional 96.04
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 96.04
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 96.03
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 96.02
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.0
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.0
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 95.99
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 95.99
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 95.99
PRK06199379 ornithine cyclodeaminase; Validated 95.99
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 95.98
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 95.96
COG2130340 Putative NADP-dependent oxidoreductases [General f 95.93
KOG4230|consensus 935 95.93
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.93
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 95.92
COG2085211 Predicted dinucleotide-binding enzymes [General fu 95.84
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 95.8
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.79
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 95.78
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 95.77
PRK13529563 malate dehydrogenase; Provisional 95.77
KOG0089|consensus309 95.76
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 95.75
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.75
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 95.72
PLN02633314 palmitoyl protein thioesterase family protein 95.69
>COG0192 MetK S-adenosylmethionine synthetase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-158  Score=1266.38  Aligned_cols=382  Identities=65%  Similarity=1.079  Sum_probs=373.1

Q ss_pred             ceEeeccccCCCCccccchhhhhhHHHHHHhhCcccccccccccccceeeeeeeeeeccchhHHHHHHHHhhhcCCCCCC
Q psy15208        182 PVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNID  261 (1027)
Q Consensus       182 ~~L~t~Esv~~GHPdkvaDqIsdaILD~~L~~Dp~srva~e~l~~~~~v~v~GEist~~~~d~~~~~r~~l~~iGy~~~~  261 (1027)
                      ..+|++|++++|||||+||||+|+|+|++|++||++|+||||++++|+|+|+|||+|++++|+++++|++|++|||+..+
T Consensus         4 ~~lFTSESVseGHPDKi~DqISDaILD~~L~~Dp~srVAcEt~v~tg~v~i~GEitt~~~vd~~~~~r~~I~~IGY~~~~   83 (388)
T COG0192           4 YFLFTSESVSEGHPDKICDQISDAILDAILKQDPNSRVACETLVTTGLVVIAGEITTSAYVDIVNIARKTIKEIGYTESD   83 (388)
T ss_pred             cceeeeccccCCCChHHHHHHhHHHHHHHHhcCCCceEEEEEEEecCeEEEEEEEecCccccHHHHHHHHHHHhCCCccc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccceEEEEeeccCChhhhhccccCCCCCcCCCCCCceeeeeeecCCCCCCCCcHHHHHHHHHHHHHHHHHcCCCCC
Q psy15208        262 YGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLPW  341 (1027)
Q Consensus       262 ~g~~~~~~~~~~~i~~qs~~i~~~v~~~~~~~~~~gagdqg~~~gya~~et~~~mp~~~~~a~~l~~~~~~~r~~~~~~~  341 (1027)
                      +|||+++|+|+++|++|||||+|||++..++.+++|||||||||||||||||+||||||+|||+|++|++++||+|.+||
T Consensus        84 ~Gfd~~t~~vl~~i~~QSpDIaqgVd~~~~~~~~~GAGDQGimFGyA~~ET~~lMPlpI~lAH~l~~r~a~~Rk~g~l~~  163 (388)
T COG0192          84 YGFDAKTCAVLVAIGEQSPDIAQGVDEADEELDEIGAGDQGIMFGYACNETPELMPLPISLAHRLLRRLAEVRKNGELPW  163 (388)
T ss_pred             cCcCccceEEEeecccCChhHHHhhhhcccchhhcCCCcceeEeeeecCCcccccChHHHHHHHHHHHHHHHHhcCCCcc
Confidence            99999999999999999999999999875444579999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceeEEEEec-CCceeEEeEEEEeeccCCCCChHHHHHHHHHHhhhcccCCCCC-CCceEEECCCCCceecCCCCc
Q psy15208        342 LRPDAKSQVTLRYD-NGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLL-KNTRYLINPTGRFVIGGPKGD  419 (1027)
Q Consensus       342 ~~pd~k~qv~~~y~-~~~~~~~~~~~~s~qh~~~~~~~~~~~~~~~~vi~~~~~~~~~-~~~~~~inp~g~f~~ggp~~d  419 (1027)
                      ||||+||||||+|+ +++|++|++||+||||++++++++||+.++|+||+|++|++++ ++|+|+||||||||||||+||
T Consensus       164 LrpD~KsQVtv~Y~~~~~p~~idtIvvStQH~~~i~~~~l~~~v~e~iI~pv~~~~~l~~~tk~~INPtGrFViGGP~gD  243 (388)
T COG0192         164 LRPDAKSQVTVEYEDNGKPVRIDTIVVSTQHDPDISQEQLREDVIEEIIKPVLPEELLDDKTKYFINPTGRFVIGGPQGD  243 (388)
T ss_pred             cCCCcceeEEEEEcCCCCceeEEEEEEEeccCcccCHHHHHHHHHHHHHhhhccHhhcCcCceEEECCCCCeeeCCCCcc
Confidence            99999999999999 5999999999999999999999999999999999999999887 689999999999999999999


Q ss_pred             cccCCceeEEecCCCcccCCCccccCCCCCccchhhhhHHHHHHHHhhhhhccceeeeEEEEeeccccceEEEEeecCCC
Q psy15208        420 CGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSG  499 (1027)
Q Consensus       420 ~gltgrk~~vdtygg~~~hggga~sgkd~tkvdrs~ay~ar~~ak~~v~~g~a~~~~vq~~yaig~~~p~s~~v~~~~t~  499 (1027)
                      ||||||||||||||||+|||||||||||||||||||||+||||||||||||||+|||||||||||+++|+||+||||||+
T Consensus       244 ~GLTGRKIIVDTYGG~a~HGGGAFSGKDptKVDRSaAYaARyvAKNiVAAglA~~ceVQlsYAIGva~PvSi~VdtfgT~  323 (388)
T COG0192         244 AGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADRCEVQLSYAIGVAEPVSISVDTFGTG  323 (388)
T ss_pred             ccCccceEEEEcCCCccCCCCccCCCCCCcccchHHHHHHHHHHHHHHHhhhhhheEEEEEeEecccCceEEEEEccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHhcCCCHHHHHHHhcCCcchhhcccccccCCCCCCCCCcccchhHhhhcccCC
Q psy15208        500 KISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSAD  564 (1027)
Q Consensus       500 ~~~~~~~~~~~~~~f~~~~~~i~~~l~l~~~~y~~~a~~ghfg~~~~~~~we~~~~~~~~~~~~~  564 (1027)
                      ++|+++|+++|+++|||||++||++|+|++|||++||+||||||++ +|||||+||++.||+++.
T Consensus       324 kvse~~i~~~v~~~FdlrP~gIi~~LdL~~piY~~tAaYGHFGr~~-~~pWEk~dkv~~lk~~~~  387 (388)
T COG0192         324 KVSEEKIEEAVRKVFDLRPAGIIKMLDLLRPIYRKTAAYGHFGRED-DFPWEKLDKVDELKKAAK  387 (388)
T ss_pred             ccCHHHHHHHHHHhcCCCHHHHHHHhccCCccchhcccccccCCCC-CCCccchhhHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999997 899999999999998753

>TIGR01034 metK S-adenosylmethionine synthetase Back     alignment and domain information
>PRK05250 S-adenosylmethionine synthetase; Validated Back     alignment and domain information
>PRK12459 S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>PLN02243 S-adenosylmethionine synthase Back     alignment and domain information
>PTZ00104 S-adenosylmethionine synthase; Provisional Back     alignment and domain information
>KOG1506|consensus Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>PF02773 S-AdoMet_synt_C: S-adenosylmethionine synthetase, C-terminal domain; InterPro: IPR022630 The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold Back     alignment and domain information
>PF02772 S-AdoMet_synt_M: S-adenosylmethionine synthetase, central domain; InterPro: IPR022629 The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF00438 S-AdoMet_synt_N: S-adenosylmethionine synthetase, N-terminal domain; InterPro: IPR022628 The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>KOG2551|consensus Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK04439 S-adenosylmethionine synthetase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PF01941 AdoMet_Synthase: S-adenosylmethionine synthetase (AdoMet synthetase); InterPro: IPR002795 A highly diverged class of S-adenosylmethionine synthetases have been identified in the archaea Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>KOG2931|consensus Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>KOG2565|consensus Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>KOG0067|consensus Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>KOG3253|consensus Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1027
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 0.0
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-172
3iml_A399 Crystal Structure Of S-Adenosylmethionine Synthetas 1e-150
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 1e-145
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 1e-145
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 1e-142
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 1e-142
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 1e-142
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 1e-142
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 1e-142
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 1e-141
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 1e-140
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 1e-138
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 1e-136
1fug_A383 S-adenosylmethionine Synthetase Length = 383 1e-134
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 1e-133
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 1e-124
1xrb_A383 S-adenosylmethionine Synthetase (mat, Atp: L-methio 1e-124
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 1e-123
3rv2_A407 Crystal Structure Of S-Adenosylmethionine Synthetas 1e-108
3s82_A407 Structure Of A S-Adenosylmethionine Synthetase From 1e-108
3tde_A408 Crystal Structure Of S-Adenosylmethionine Synthetas 1e-106
1qm4_A396 Methionine Adenosyltransferase Complexed With A L-M 1e-100
2obv_A384 Crystal Structure Of The Human S-adenosylmethionine 1e-100
2p02_A396 Crystal Structure Of The Alpha Subunit Of Human S- 1e-99
3so4_A415 Methionine-Adenosyltransferase From Entamoeba Histo 4e-97
3trd_A208 Structure Of An Alpha-Beta Serine Hydrolase Homolog 3e-25
2fuk_A220 Crystal Structure Of Xc6422 From Xanthomonas Campes 8e-20
2i3d_A249 Crystal Structure Of Protein Of Unknown Function At 3e-17
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure 
Iteration: 1

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/467 (71%), Positives = 388/467 (83%), Gaps = 3/467 (0%)
Query: 561  NSADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAV 620
            ++ D+V+ADI L+ WGRKE+ IAETEM  L+ IR+E+   +PLKGARI+GS+HMTIQT V
Sbjct: 31   SAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGV 90
Query: 621  LIETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPG 680
            LIETLK LGA+VRW+SCNI+STQDHAAAAI   G PVFAFKGES+ +YWEF+HRIF+WP 
Sbjct: 91   LIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWP- 149
Query: 681  NSNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWY 740
              N E ANMILDDGGDAT LL LG++AE + S+++ P +EEEV LFKSI+  L+ID  WY
Sbjct: 150  --NGEFANMILDDGGDATLLLILGSKAEKDRSVIARPTNEEEVALFKSIERHLEIDGSWY 207
Query: 741  SSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGI 800
            S RL  IKGVTEETTTGV+RL +M K+G+L FPA NVNDSVTKSKFDNLYGCRESL+DGI
Sbjct: 208  SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI 267
Query: 801  KRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTME 860
            KRATDVMIAGKIAV+ GYGDVGKG AQ++R L A VW+ EIDPICALQAAMEG+ VVTME
Sbjct: 268  KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGYRVVTME 327
Query: 861  YAKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQV 920
            YA    DIFVT TGNYHVI HDHM+ M+  AIVCNIGHFD+EI+V   ++Y+WENIKPQV
Sbjct: 328  YAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQYQWENIKPQV 387
Query: 921  DHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYT 980
            DHIIFPDGK++ILLAEGRLVNLGC TGHPS+VMS+SF NQTLAQIELF     Y   +Y 
Sbjct: 388  DHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFTRGGEYANKVYV 447
Query: 981  LPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027
            LPK LDEKVARL L ++  QLS+L+D QA YIGVSK GP+K D+YRY
Sbjct: 448  LPKHLDEKVARLHLARIGAQLSELSDDQAAYIGVSKAGPFKPDHYRY 494
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3IML|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase From Burkholderia Pseudomallei Length = 399 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|1FUG|A Chain A, S-adenosylmethionine Synthetase Length = 383 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|1XRB|A Chain A, S-adenosylmethionine Synthetase (mat, Atp: L-methionine S- Adenosyltransferase, E.c.2.5.1.6) In Which Met Residues Are Replaced With Selenomethionine Residues (mse) Length = 383 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure
>pdb|3RV2|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase From Mycobacterium Marinum Length = 407 Back     alignment and structure
>pdb|3S82|A Chain A, Structure Of A S-Adenosylmethionine Synthetase From Mycobacterium Avium Length = 407 Back     alignment and structure
>pdb|3TDE|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase Rv1392 From Mycobacterium Tuberculosis Length = 408 Back     alignment and structure
>pdb|1QM4|A Chain A, Methionine Adenosyltransferase Complexed With A L-Methionine Analogous Length = 396 Back     alignment and structure
>pdb|2OBV|A Chain A, Crystal Structure Of The Human S-adenosylmethionine Synthetase 1 In Complex With The Product Length = 384 Back     alignment and structure
>pdb|2P02|A Chain A, Crystal Structure Of The Alpha Subunit Of Human S- Adenosylmethionine Synthetase 2 Length = 396 Back     alignment and structure
>pdb|3SO4|A Chain A, Methionine-Adenosyltransferase From Entamoeba Histolytica Length = 415 Back     alignment and structure
>pdb|3TRD|A Chain A, Structure Of An Alpha-Beta Serine Hydrolase Homologue From Coxiella Burnetii Length = 208 Back     alignment and structure
>pdb|2FUK|A Chain A, Crystal Structure Of Xc6422 From Xanthomonas Campestris: A Member Of AB SERINE HYDROLASE WITHOUT LID AT 1.6 Resolution Length = 220 Back     alignment and structure
>pdb|2I3D|A Chain A, Crystal Structure Of Protein Of Unknown Function Atu1826, A Putative AlphaBETA HYDROLASE FROM AGROBACTERIUM TUMEFACIENS Length = 249 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1027
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 0.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 0.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 0.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 0.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 0.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 0.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 0.0
3iml_A399 S-adenosylmethionine synthetase; structural genomi 0.0
1p7l_A383 S-adenosylmethionine synthetase; AMPPNP, SAM, tran 0.0
3s82_A407 S-adenosylmethionine synthase; seattle structural 0.0
3so4_A415 Methionine-adenosyltransferase; structural genomic 0.0
2p02_A396 S-adenosylmethionine synthetase isoform type-2; st 0.0
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 2e-36
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 4e-31
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 2e-30
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 2e-27
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 2e-12
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 1e-10
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 1e-09
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 3e-08
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 7e-07
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 9e-07
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 2e-05
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 3e-05
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 4e-05
3llc_A270 Putative hydrolase; structural genomics, joint cen 5e-05
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 8e-05
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 8e-04
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
 Score =  838 bits (2167), Expect = 0.0
 Identities = 296/466 (63%), Positives = 361/466 (77%), Gaps = 3/466 (0%)

Query: 562  SADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVL 621
                V+ DI+L+ WGRKE++IAETEM  L++ REEF KS+PLKGARISGS+HMTIQTAVL
Sbjct: 2    PGSMVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVL 61

Query: 622  IETLKCLGAEVRWSSCNIYSTQDHAAAAIASKGIPVFAFKGESISDYWEFNHRIFDWPGN 681
            IETLK LGAEVRW+SCNI+STQDHAAAAIA+ G PVFA KGE++ +YW +  +IF WP  
Sbjct: 62   IETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWP-- 119

Query: 682  SNTEQANMILDDGGDATFLLHLGAQAENNISILSNPCSEEEVCLFKSIKNKLKIDSKWYS 741
             + E +NMILDDGGDAT  + +GA+AE    +LSNP SEEE  LF  IK ++     +++
Sbjct: 120  -DGEPSNMILDDGGDATMYILIGARAEAGEDVLSNPQSEEEEVLFAQIKKRMAATPGFFT 178

Query: 742  SRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRESLIDGIK 801
             +   IKGVTEETTTGV RL ++ K+G L FPAINVNDSVTKSKFDN YGC+ESL+DGI+
Sbjct: 179  KQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGIR 238

Query: 802  RATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEY 861
            R TDVM+AGK+AV+ GYGDVGKGSAQ++    A+V + E+DPICALQAAM+GF VVT++ 
Sbjct: 239  RGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEVVTLDD 298

Query: 862  AKKYGDIFVTCTGNYHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVD 921
            A    DI VT TGN  VIT DHMR MKD  IV NIGHFDNEI+V  L+  KW N+KPQVD
Sbjct: 299  AASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRNLKWTNVKPQVD 358

Query: 922  HIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSSSFANQTLAQIELFNNTSNYPIGIYTL 981
             I FPDGK++ILL+EGRL+NLG  TGHPS+VMS+SF NQ L QIELF  T  Y   +Y L
Sbjct: 359  LIEFPDGKRLILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTRTDAYKNEVYVL 418

Query: 982  PKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027
            PK LDEKVARL L KL  +L+ L+++QA YIGV+  GP+K ++YRY
Sbjct: 419  PKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 464
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3iml_A S-adenosylmethionine synthetase; structural genomics, ATP-BI cobalt, magnesium, metal-binding, nucleotide-binding, one-C metabolism; 2.35A {Burkholderia pseudomallei} Length = 399 Back     alignment and structure
>1p7l_A S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1fug_A 1mxb_A* 1mxc_A* 1mxa_A* 1rg9_A* 1xra_A 1xrb_A 1xrc_A Length = 383 Back     alignment and structure
>3s82_A S-adenosylmethionine synthase; seattle structural genomics center for infectious disease, S adenosylmethionine synthetase, transferase; 1.73A {Mycobacterium avium} PDB: 3tde_A 3rv2_A Length = 407 Back     alignment and structure
>3so4_A Methionine-adenosyltransferase; structural genomics, medical structural genomics of pathogen protozoa, MSGPP; 3.18A {Entamoeba histolytica} Length = 415 Back     alignment and structure
>2p02_A S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1qm4_A 1o92_A* 1o93_A* 1o90_A* 1o9t_A 2obv_A* Length = 396 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Length = 208 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Length = 220 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Length = 176 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Length = 249 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Length = 270 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Length = 251 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Length = 335 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1027
3iml_A399 S-adenosylmethionine synthetase; structural genomi 100.0
3s82_A407 S-adenosylmethionine synthase; seattle structural 100.0
3so4_A415 Methionine-adenosyltransferase; structural genomic 100.0
1p7l_A383 S-adenosylmethionine synthetase; AMPPNP, SAM, tran 100.0
2p02_A396 S-adenosylmethionine synthetase isoform type-2; st 100.0
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 100.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.87
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.87
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.84
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.83
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.82
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.79
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.79
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.78
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.77
3h04_A275 Uncharacterized protein; protein with unknown func 99.76
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.76
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.76
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.76
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.76
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.75
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.75
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.75
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.74
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.74
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.74
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.74
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.74
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.73
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.73
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.73
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.73
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.73
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.73
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.73
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.73
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.73
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.72
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.72
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.72
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.72
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.71
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.71
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.71
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.71
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.71
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.7
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.7
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.7
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.7
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.7
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.69
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.69
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.69
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.69
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.69
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.69
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.69
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.69
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.69
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.69
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.68
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.68
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.67
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.67
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.67
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.67
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.67
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.67
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.67
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.67
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.66
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.66
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.66
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.66
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.66
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.65
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.65
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.65
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.65
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.65
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.64
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.64
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.64
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.64
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.64
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.64
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.64
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.64
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.64
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.64
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.64
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.64
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.63
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.63
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.63
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.63
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 99.63
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.62
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.62
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.62
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.62
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.62
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.61
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.61
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.61
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.61
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.61
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.61
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.6
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.6
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.6
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.6
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.6
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.6
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.6
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.6
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.6
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.59
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.59
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.59
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.59
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.58
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.58
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.58
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.58
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.58
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.57
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.57
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.57
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.57
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.57
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.56
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.56
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.55
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.55
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.55
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.55
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.54
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.54
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.53
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.53
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.53
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.53
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.53
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.53
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.52
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.51
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.51
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.51
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.5
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.25
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.5
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.49
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.48
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.48
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.48
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.48
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.47
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.47
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.47
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.46
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.46
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.45
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.45
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.45
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.45
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.44
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.44
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.43
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.43
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.43
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.42
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.42
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.4
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.4
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.4
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.39
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.39
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.38
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.37
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.37
3lp5_A250 Putative cell surface hydrolase; structural genom 99.37
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.37
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.37
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.36
1mpx_A615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.36
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.34
3iii_A560 COCE/NOND family hydrolase; structural genomics, c 99.33
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.32
1lns_A763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.31
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.31
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.3
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.28
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.27
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.27
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.27
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.27
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.27
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.26
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.25
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.25
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.25
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.25
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.25
2b9v_A652 Alpha-amino acid ester hydrolase; catalytic triad, 99.24
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.24
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.23
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.21
3i2k_A587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.2
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.2
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.2
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.19
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.18
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.18
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.16
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.15
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.14
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.13
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.13
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.12
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.12
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.12
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.12
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.11
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.1
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.09
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.09
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.08
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.08
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.08
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.07
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.07
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.06
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.06
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.04
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.04
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.04
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.03
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 99.03
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.02
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.02
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.02
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.02
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 99.02
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.01
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.01
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.98
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.97
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.95
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.95
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.94
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.94
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.93
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.93
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.93
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.92
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.92
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.92
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.91
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.9
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.89
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.89
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.88
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 98.87
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.86
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.83
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.79
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.72
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.7
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.69
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.65
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 98.63
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.62
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.6
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 98.58
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.56
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 98.54
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.53
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.52
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 98.52
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.52
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.49
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 98.47
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.46
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.45
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 98.45
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.44
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 98.44
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.43
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 98.43
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 98.42
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 98.41
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 98.41
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 98.4
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.38
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.37
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 98.36
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.35
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 98.35
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.32
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 98.31
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 98.31
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 98.31
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.31
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 98.3
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 98.3
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 98.29
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 98.29
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 98.29
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.27
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 98.27
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 98.26
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 98.25
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 98.25
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 98.24
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.21
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 98.21
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 98.18
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.18
3fbg_A346 Putative arginate lyase; structural genomics, unkn 98.17
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 98.16
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.14
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.13
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 98.1
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 98.1
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.1
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 98.09
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.09
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.07
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.07
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 98.06
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.06
4eye_A342 Probable oxidoreductase; structural genomics, niai 98.05
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 98.03
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.03
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.02
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.01
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 98.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 97.99
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.99
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.99
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 97.99
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.98
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.98
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 97.98
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 97.97
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.96
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.96
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.95
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.95
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 97.94
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.93
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.93
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.92
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 97.91
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 97.91
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 97.9
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.9
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.9
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.9
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.89
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 97.89
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.88
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.88
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 97.87
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.85
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.85
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 97.84
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.84
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.83
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.83
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 97.81
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.8
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 97.79
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.79
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.79
4ezb_A317 Uncharacterized conserved protein; structural geno 97.79
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 97.76
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.74
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.74
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 97.73
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.72
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.72
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.71
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.7
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.7
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.69
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.69
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.69
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.69
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.69
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.68
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.68
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.67
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.67
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.66
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.66
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 97.66
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 97.65
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.65
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.63
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 97.62
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.61
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 97.61
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.6
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 97.6
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.59
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.58
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.57
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.57
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 97.55
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.55
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.55
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 97.54
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.54
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 97.53
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.53
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 96.66
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.52
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.51
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.5
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.5
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.5
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.5
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.49
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.48
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.48
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 97.48
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 97.46
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.46
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.43
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 97.42
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.4
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 97.39
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.36
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.36
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.35
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.35
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 97.34
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 97.33
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.32
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.3
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 97.28
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.27
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.27
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 97.24
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.24
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.23
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.23
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 97.21
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 97.2
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 97.17
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.16
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.14
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.13
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.13
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.13
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.12
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.1
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 97.1
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.1
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.05
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.05
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.05
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.03
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.02
4hpv_A407 S-adenosylmethionine synthase; structural genomics 97.02
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.01
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.99
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 96.97
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.96
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.96
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.95
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.95
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.94
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.94
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.92
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.91
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.91
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.91
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.9
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.9
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 96.87
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.85
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 96.85
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 96.84
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.84
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.83
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 96.78
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.76
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.76
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.76
>3iml_A S-adenosylmethionine synthetase; structural genomics, ATP-BI cobalt, magnesium, metal-binding, nucleotide-binding, one-C metabolism; 2.35A {Burkholderia pseudomallei} Back     alignment and structure
Probab=100.00  E-value=1.1e-158  Score=1290.14  Aligned_cols=383  Identities=70%  Similarity=1.163  Sum_probs=355.7

Q ss_pred             CceEeeccccCCCCccccchhhhhhHHHHHHhhCcccccccccccccceeeeeeeeeeccchhHHHHHHHHhhhcCCCCC
Q psy15208        181 IPVVVIPESVSEGHPDKIADQISDAILDEIFLKDLKARVAAETLCNNNLIVLSGEITTDANIDYVNIVRKTIKDIGYNNI  260 (1027)
Q Consensus       181 ~~~L~t~Esv~~GHPdkvaDqIsdaILD~~L~~Dp~srva~e~l~~~~~v~v~GEist~~~~d~~~~~r~~l~~iGy~~~  260 (1027)
                      ..++|++|++++|||||+||||+|+++|++|++||++|+||||++++++|+|+|||||++++|+++|||+++++|||+++
T Consensus         7 ~~~lFTSESVseGHPDKicDqISDaILDa~L~~Dp~arVAcEt~~~tg~V~v~GEItt~a~vd~~~ivR~~i~~IGY~~~   86 (399)
T 3iml_A            7 NDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAETLCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNT   86 (399)
T ss_dssp             CEEEEEEEEECTTSHHHHHHHHHHHHHHHHHHHCTTCEEEEEEEECSSEEEEEEEEECSCCCCHHHHHHHHHHHHTCC--
T ss_pred             cCceEeccccCCCCCcHHHHHHhHHHHHHHHhcCCCCcEEEEEEeccCeEEEEEEEecccccCHHHHHHHHHhccCCCCc
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccceEEEEeeccCChhhhhccccCCCCCcCCCCCCceeeeeeecCCCCCCCCcHHHHHHHHHHHHHHHHHcCCCC
Q psy15208        261 DYGIDYKSCAVLLIYNKQSLDIAQGVNEGEGLNFDQGAGDQGLMFGYACDETPELMPSAIYYSHLIVKRQSELRKNGNLP  340 (1027)
Q Consensus       261 ~~g~~~~~~~~~~~i~~qs~~i~~~v~~~~~~~~~~gagdqg~~~gya~~et~~~mp~~~~~a~~l~~~~~~~r~~~~~~  340 (1027)
                      ++|||++||+|++.|++|||||+|||+.+....+++|||||||||||||||||+||||||+|||+|++||+++||+|++|
T Consensus        87 ~~gFd~~tc~Vl~~i~~QSpDIaqGVd~~~~~~~~~GAGDQGiMFGYA~~ET~elMPlpi~lAH~L~~rl~~~Rk~g~l~  166 (399)
T 3iml_A           87 DYGIDYRGCAVLVAYDKQSPDIAQGVDRAHDNNLDQGAGDQGLMFGYACDETPELMPLPIHLSHRLVERQANLRRDGRLP  166 (399)
T ss_dssp             -------CCEEEEEEEEECC------------CTTCCBSSCEEEEEEEETTSTTSCCHHHHHHHHHHHHHHHHHHTTSST
T ss_pred             ccCccCCceEEEEecccCChhHhhhhcccccchhhcCcCcceeEEEEecCCccccCCcHHHHHHHHHHHHHHHHHcCCCC
Confidence            99999999999999999999999999973111247999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCceeEEEEecCCceeEEeEEEEeeccCCCCChHHHHHHHHHHhhhcccCCCCC-CCceEEECCCCCceecCCCCc
Q psy15208        341 WLRPDAKSQVTLRYDNGKPVAIDTIVLSTQHDPEIPYRSIKEAAIEEIIRPIIPKNLL-KNTRYLINPTGRFVIGGPKGD  419 (1027)
Q Consensus       341 ~~~pd~k~qv~~~y~~~~~~~~~~~~~s~qh~~~~~~~~~~~~~~~~vi~~~~~~~~~-~~~~~~inp~g~f~~ggp~~d  419 (1027)
                      |||||+||||||+|++++|+||+||||||||++++++++++++|+|+||++++|++|+ ++|+||||||||||||||+||
T Consensus       167 ~LrPD~KtQVTveY~~~~P~rv~tvViStQH~~~v~~~~l~~~i~e~vi~~vip~~~l~~~t~~~INPtGrFViGGP~gD  246 (399)
T 3iml_A          167 WLRPDAKSQVTVRYVDGKPHSIDTVVLSTQHAPEIDLPALREAVIEEVIKPTLPADLIKGDIKFLVNPTGRFVIGGPQGD  246 (399)
T ss_dssp             TEEEEEEEEEEEEEETTEEEEEEEEEEEEEECTTSCHHHHHHHHHHHTTTTTSCGGGCCTTCEEEESTTCCCCSCGGGTS
T ss_pred             eecCCCceEEEEEEECCceeeEEEEEEEeecCCCCCHHHHHHHHHHHHHHHhcCcccCCCCcEEEECCCCCeEeCCCccc
Confidence            9999999999999999999999999999999999999999999999999999999888 579999999999999999999


Q ss_pred             cccCCceeEEecCCCcccCCCccccCCCCCccchhhhhHHHHHHHHhhhhhccceeeeEEEEeeccccceEEEEeecCCC
Q psy15208        420 CGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKIDRSAAYVGRYIAKNIVAANLAKRCQIQISYAIGVAKPTSIMVTSFGSG  499 (1027)
Q Consensus       420 ~gltgrk~~vdtygg~~~hggga~sgkd~tkvdrs~ay~ar~~ak~~v~~g~a~~~~vq~~yaig~~~p~s~~v~~~~t~  499 (1027)
                      ||||||||||||||||++|||||||||||||||||||||||||||||||||||+|||||||||||+++|+||+||||||+
T Consensus       247 aGLTGRKIIVDTYGG~~~HGGGAFSGKDptKVDRSaAYaAR~vAKniVAAGLA~rc~VQlsYAIGva~P~Si~V~tfGT~  326 (399)
T 3iml_A          247 CGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLASRALIQVSYAIGVAEPTSVMVNTFGTG  326 (399)
T ss_dssp             CEETTSCTTTTTTTTSSCCCSCCCTTBCTTSHHHHHHHHHHHHHHHHHHTTSCSEEEEEEEECBTCSSCSEEEEECTTCC
T ss_pred             ccccccceeeecCCcccCCCCccccCCCccccchHHHHHHHHHHHHHHhhcccceeEEEEEEecCcccceEEEEEeCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHhcCCCHHHHHHHhcCCcchhhcccccccCCCCCCCCCcccchhHhhhcccC
Q psy15208        500 KISDEKLTMLVKKHFDLRPKNIIKMLNLLRPIYKKTSVYGHFGRKEPEFTWELTDKAEVLKNSA  563 (1027)
Q Consensus       500 ~~~~~~~~~~~~~~f~~~~~~i~~~l~l~~~~y~~~a~~ghfg~~~~~~~we~~~~~~~~~~~~  563 (1027)
                      ++++++|.++|+++|||||++||++|+|++|||++||+||||||++++||||++||+++||++.
T Consensus       327 ~~~~~~i~~~v~~~FdlrP~~Ii~~L~L~~PiY~~tAaYGHFGR~~~~f~WE~~d~v~~lk~~~  390 (399)
T 3iml_A          327 RVSDETITKLVREHFDLRPKGIIQMLDLLRPIYEKTAAYGHFGREEPEFSWEAADKALALAEAA  390 (399)
T ss_dssp             SSCHHHHHHHHHHHCCCSHHHHHHHHTCCSSCCGGGGSSCSSSCCCTTCGGGCCTTHHHHHHHH
T ss_pred             ccCHHHHHHHHHHHcCCCHHHHHHHcCCCCCchhhhcCcCCCCCCCCCCCccCccHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999998899999999999999875
>3s82_A S-adenosylmethionine synthase; seattle structural genomics center for infectious disease, S adenosylmethionine synthetase, transferase; 1.73A {Mycobacterium avium} PDB: 3tde_A 3rv2_A Back     alignment and structure
>3so4_A Methionine-adenosyltransferase; structural genomics, medical structural genomics of pathogen protozoa, MSGPP; 3.18A {Entamoeba histolytica} Back     alignment and structure
>1p7l_A S-adenosylmethionine synthetase; AMPPNP, SAM, transferase; HET: SAM ANP PPK; 2.50A {Escherichia coli} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1fug_A 1mxb_A* 1mxc_A* 1mxa_A* 1rg9_A* 1xra_A 1xrb_A 1xrc_A Back     alignment and structure
>2p02_A S-adenosylmethionine synthetase isoform type-2; structural genomics, structural genomics consortium, SGC, transferase; HET: SAM; 1.21A {Homo sapiens} SCOP: d.130.1.1 d.130.1.1 d.130.1.1 PDB: 1qm4_A 1o92_A* 1o93_A* 1o90_A* 1o9t_A 2obv_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4hpv_A S-adenosylmethionine synthase; structural genomics, PSI-biology; 2.21A {Sulfolobus solfataricus P2} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1027
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 1e-84
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 1e-36
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 6e-78
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 3e-75
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 2e-34
d1mxaa3152 d.130.1.1 (A:232-383) S-adenosylmethionine synthet 5e-72
d2p02a3144 d.130.1.1 (A:274-417) S-adenosylmethionine synthet 3e-70
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 4e-67
d1mxaa2124 d.130.1.1 (A:108-231) S-adenosylmethionine synthet 2e-50
d2p02a2126 d.130.1.1 (A:148-273) S-adenosylmethionine synthet 2e-49
d2p02a1110 d.130.1.1 (A:38-147) S-adenosylmethionine syntheta 1e-36
d1mxaa1102 d.130.1.1 (A:1-102) S-adenosylmethionine synthetas 2e-33
d2i3da1218 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 { 3e-29
d2fuka1218 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas ca 4e-28
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 3e-05
d1uxoa_186 c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus 8e-05
d1id1a_153 c.2.1.9 (A:) Rck domain from putative potassium ch 1e-04
d2fy8a1129 c.2.1.9 (A:116-244) Potassium channel-related prot 2e-04
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 4e-04
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 4e-04
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 0.002
d1pjca1168 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phorm 0.003
d1pjqa1113 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 0.004
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]

 Score =  273 bits (700), Expect = 1e-84
 Identities = 110/272 (40%), Positives = 169/272 (62%), Gaps = 16/272 (5%)

Query: 564 DFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIE 623
              + DI+L+ +G+ ++EI+E EM  L+ IREE+ K +PLK A+I+G +HMT++ A+LIE
Sbjct: 2   KSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIE 61

Query: 624 TLKCLGAEVRWSSCNIYSTQDHAAAAI-ASKGIPVFAFKGESISDYWEFNHRIFDWPGNS 682
           TL+ LGA++RW SCNIYST D+AAAA+   + + VFA+K E++ +YW        W    
Sbjct: 62  TLQKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGD 121

Query: 683 NTEQANMILDDGGDATFLLHLGAQAEN---NISILSNPC---SEEEVCLFKSIKNKLKID 736
           +    +MI+DDGGDAT L+H G + E      +IL +P    +EEE C    +KN +  +
Sbjct: 122 DN-GPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSILKN 180

Query: 737 SKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDN------LY 790
            K +++  K+I GV+EETTTGV RL++M K+ +L F AINVND+VTK K+D+        
Sbjct: 181 PKKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDHPAFVMSFS 240

Query: 791 GCRESL--IDGIKRATDVMIAGKIAVIIGYGD 820
            C ++   +D  +         K+ ++  + D
Sbjct: 241 FCNQTFAQLDLWQNKDTNKYENKVYLLPKHLD 272
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1mxaa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 152 Back     information, alignment and structure
>d2p02a3 d.130.1.1 (A:274-417) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1mxaa2 d.130.1.1 (A:108-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 124 Back     information, alignment and structure
>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1mxaa1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Length = 218 Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Length = 218 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Length = 168 Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1027
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d2p02a3144 S-adenosylmethionine synthetase {Human (Homo sapie 100.0
d1mxaa3152 S-adenosylmethionine synthetase {Escherichia coli 100.0
d1mxaa2124 S-adenosylmethionine synthetase {Escherichia coli 100.0
d2p02a2126 S-adenosylmethionine synthetase {Human (Homo sapie 100.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d2p02a1110 S-adenosylmethionine synthetase {Human (Homo sapie 99.96
d1mxaa1102 S-adenosylmethionine synthetase {Escherichia coli 99.93
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.9
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.79
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.79
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.78
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.77
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.77
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.77
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.73
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.73
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.72
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.71
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.71
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.71
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.71
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.7
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.7
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.7
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.7
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.7
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.68
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.68
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.68
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.67
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.67
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.66
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.66
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.64
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.64
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.63
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.63
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.62
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.62
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.61
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.57
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.55
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.54
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.52
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.45
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.44
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.44
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.42
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.42
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.4
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.4
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.38
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.38
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.36
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.34
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.33
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.33
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.31
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.3
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.29
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.27
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.27
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.26
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.25
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.24
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.23
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.21
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.19
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.13
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.1
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.09
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.06
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.06
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.05
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.04
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.03
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.02
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.98
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 98.98
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.97
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.95
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.95
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.94
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 98.8
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.78
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.77
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.72
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 98.7
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.67
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 98.65
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.65
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.64
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 98.61
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.61
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.58
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.58
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.57
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 98.57
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.57
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.52
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.52
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 98.5
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.49
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.47
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.43
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.41
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 98.34
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.29
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.23
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.23
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.22
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.21
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.2
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.16
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.16
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.16
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.14
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.1
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.08
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.07
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.05
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.0
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.96
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.94
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.89
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.88
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.86
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.85
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.82
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.79
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.76
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.73
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.73
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.73
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.66
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.66
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.64
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.49
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.48
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.47
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.46
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.42
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.42
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.41
d2h7ca1532 Mammalian carboxylesterase (liver carboxylesterase 97.41
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.4
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.4
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.39
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.36
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.31
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 97.23
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.23
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 97.16
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.15
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.14
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.02
d1ea5a_532 Acetylcholinesterase {Pacific electric ray (Torped 97.01
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.99
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.97
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.96
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.96
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 96.95
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.85
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.8
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 96.8
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 96.8
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 96.79
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 96.79
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.77
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.76
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.73
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.72
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.61
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.6
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.55
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.53
d2bcea_579 Bile-salt activated lipase (cholesterol esterase) 96.5
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.48
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.38
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.38
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.21
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.21
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.19
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.18
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.14
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.14
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.13
d1dx4a_571 Acetylcholinesterase {Fruit fly (Drosophila melano 96.12
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.1
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.08
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.05
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.02
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.96
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.9
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.82
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.8
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.78
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.78
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.77
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 95.75
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.74
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 95.73
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.7
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.64
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.63
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.61
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.57
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.56
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.56
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 95.52
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.52
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.49
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.48
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.47
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.45
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 95.43
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.39
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.33
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.29
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.25
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.25
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 95.23
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 95.15
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.14
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.12
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.12
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 95.11
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 95.02
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.97
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 94.96
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.93
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.89
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.88
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.87
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.84
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.83
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.82
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.81
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 94.75
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.7
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.66
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.65
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.59
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.59
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.59
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.57
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.48
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.42
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.38
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 94.36
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.35
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.33
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 94.3
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 94.18
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 94.18
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 94.15
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.14
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.14
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.14
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.13
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.12
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.12
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.11
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.1
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.1
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 94.08
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 93.95
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.95
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.94
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.91
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.86
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.85
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 93.8
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 93.69
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 93.66
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 93.57
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.52
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.51
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 93.4
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.4
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.38
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 93.38
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.32
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 93.31
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.22
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 93.2
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.15
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 93.04
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.0
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.99
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.92
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 92.91
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 92.9
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.88
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.78
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.7
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.7
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.35
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 92.16
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 91.96
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.94
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 91.91
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.91
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.83
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.57
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 91.53
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 91.49
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 91.48
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 91.06
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 91.03
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 90.98
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 90.97
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 90.94
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.94
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 90.9
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 90.88
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 90.81
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 90.81
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 90.7
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 90.67
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 90.63
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 90.57
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 90.16
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 90.15
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.09
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 90.08
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.04
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 89.96
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.91
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.84
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.82
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 89.74
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 89.61
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 89.52
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 89.52
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.52
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.39
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 89.32
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 89.2
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.16
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 89.09
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 88.98
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 88.91
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 88.89
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.89
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 88.81
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 88.79
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 88.74
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 88.52
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 88.17
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.03
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.88
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.73
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 87.54
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.18
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.94
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 86.49
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 86.45
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 86.39
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 86.34
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 86.31
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 86.2
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 86.1
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 85.97
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 85.95
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 85.76
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 85.18
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 85.06
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 84.9
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 84.86
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 84.74
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.64
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 84.39
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.35
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 84.35
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 84.15
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 84.03
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 84.01
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 83.87
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 83.53
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 83.44
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 83.38
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.36
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 83.29
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 83.27
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 83.19
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 83.01
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 82.9
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 82.38
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.25
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 82.22
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 82.19
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 82.05
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.9
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 81.82
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 81.29
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 80.83
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 80.75
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.44
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 80.33
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 80.04
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]

Probab=100.00  E-value=2.9e-97  Score=804.53  Aligned_cols=304  Identities=49%  Similarity=0.836  Sum_probs=289.4

Q ss_pred             CCceecCCCchhhhHHhHHHHHHhChhHHHHHHHhhcCCCCCCcEEEEEeechHHHHHHHHHHHhCCCEEEEecCCCCCC
Q psy15208        563 ADFVIADINLSQWGRKEIEIAETEMFSLISIREEFVKSKPLKGARISGSIHMTIQTAVLIETLKCLGAEVRWSSCNIYST  642 (1027)
Q Consensus       563 ~~~~~~d~~l~~~g~~~i~~a~~~mp~l~~~~~~~~~~~pl~G~~i~~~lhl~~~Ta~l~~~L~~~GA~v~~~~~n~~st  642 (1027)
                      +.|+||||+||++|+++|+||++|||+||+||++|+.+|||||+||++|||||+|||+|++||+++||||+|||||||||
T Consensus         1 ~~s~VkDisLA~~G~~~IewAe~eMP~L~alr~~~~~~kPlkG~rIagcLHmt~qTAvLietL~~~GAeV~~~scNp~ST   80 (313)
T d1v8ba2           1 NKSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYST   80 (313)
T ss_dssp             CCCBCSCGGGHHHHHHHHHHHGGGCHHHHHHHHHSTTTCTTTTCEEEEESCCSHHHHHHHHHHHHTTCEEEEECSSSSCC
T ss_pred             CCCccCChhhhHHhHHHHHHHHHHCHHHHHHHHHHhccCCCCCCEEEEEEccHHHHHHHHHHHHHhCCeeEEeccCCccc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHh-CCCcEEEeeCCCHHHHHHHHHHHhcCCCCCCCcCcceeecccchhhHHhhhcccccc---ccccCCCCC
Q psy15208        643 QDHAAAAIAS-KGIPVFAFKGESISDYWEFNHRIFDWPGNSNTEQANMILDDGGDATFLLHLGAQAEN---NISILSNPC  718 (1027)
Q Consensus       643 qd~~aaal~~-~g~~v~a~~~~~~~ey~~~~~~~l~~~~~~~~~~p~~i~DdGgdl~~~~~~~~~~~~---~~~~~~~~~  718 (1027)
                      ||||||||++ .||+||||||||.||||||++++|+|+++. +++|+|||||||||++++|+|.+.|+   ..+.++.|.
T Consensus        81 QD~vAAAl~~~~gi~VfAwkGet~eey~~~i~~~L~~~dg~-~~~P~~IlDDGgDlt~~vh~g~~~E~l~~~~~~lp~p~  159 (313)
T d1v8ba2          81 ADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGD-DNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPE  159 (313)
T ss_dssp             CHHHHHHHTTSTTEEEECCTTCCHHHHHHHHHHHHCCSSSS-SCSCSEEEESSSHHHHHHHHHHHHHHHHHHHCCCCCGG
T ss_pred             chHHHHHhhccCCceEEEecCCCHHHHHHHHHHHHhcCCCC-CCCCcEEeehhHHHHHHHHhcchhccccccccccCCCC
Confidence            9999999987 799999999999999999999999998763 26999999999999999999887665   334555553


Q ss_pred             ---ChhHHHHHHHHHhHhhhCCcchhhhcccccccccchhhHHHHHHHHHHcCCCccceEeecccccccccccchhhhhh
Q psy15208        719 ---SEEEVCLFKSIKNKLKIDSKWYSSRLKQIKGVTEETTTGVYRLRRMFKEGKLSFPAINVNDSVTKSKFDNLYGCRES  795 (1027)
Q Consensus       719 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~EeTttG~~rl~~~~~~~~l~~Pv~~vnds~~K~~~dn~~g~~~s  795 (1027)
                         +.+++|++.+|+..+.++|++|++++++++|++|||||||+||++|+++|.|.||+|+|||+.+|++||        
T Consensus       160 ~~~n~~~~~~~~~lk~~~~~~~~~~~~~~~~i~GvsEETTTGV~RL~~m~~~g~L~fPainVNDsvtK~~F~--------  231 (313)
T d1v8ba2         160 KAKNEEERCFLTLLKNSILKNPKKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYD--------  231 (313)
T ss_dssp             GCSSHHHHHHHHHHHHHHTTCTTHHHHHHTTCCEEEECSHHHHHHHHHHHHTTCCCSEEEECTTSHHHHTTH--------
T ss_pred             CCCCHHHHHHHHHHHHHHhhCcHHHHHhhhcEEEEeCCCCccHHhHHHHHHcCcceeeeEecCcccCHHHhC--------
Confidence               679999999999999999999999999999999999999999999999999999999999999999994        


Q ss_pred             HHHHHhhhcCccccCCEEEEEcCChhHHHHHHHHHhCCCEEEEEcCCchhHHHHhhcCcEEcCHHHHhccCCEEEecCCC
Q psy15208        796 LIDGIKRATDVMIAGKIAVIIGYGDVGKGSAQAMRALSAQVWIIEIDPICALQAAMEGFLVVTMEYAKKYGDIFVTCTGN  875 (1027)
Q Consensus       796 ~~~~i~r~t~~~l~Gk~VvViG~G~IG~~vA~~a~~~Ga~ViV~d~dp~r~~~A~~~G~~v~~~~e~l~~aDvvi~atG~  875 (1027)
                                                                                                      
T Consensus       232 --------------------------------------------------------------------------------  231 (313)
T d1v8ba2         232 --------------------------------------------------------------------------------  231 (313)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccCcHHHHhcCCCCeEEEEecCCCcccchhhhhccceeccccceeeeecCCCcEEEEecCCccccccCCCCCCcceEeh
Q psy15208        876 YHVITHDHMRDMKDQAIVCNIGHFDNEIEVEKLKKYKWENIKPQVDHIIFPDGKKIILLAEGRLVNLGCGTGHPSYVMSS  955 (1027)
Q Consensus       876 ~~vi~~~~~~~mk~gailvNvG~~d~eid~~~l~~~~~~~~~~~v~~y~~~dg~~i~LLa~GrlvNl~~~~G~P~~vmd~  955 (1027)
                                                                                              ||++|||+
T Consensus       232 ------------------------------------------------------------------------~P~~vMd~  239 (313)
T d1v8ba2         232 ------------------------------------------------------------------------HPAFVMSF  239 (313)
T ss_dssp             ------------------------------------------------------------------------SCHHHHHH
T ss_pred             ------------------------------------------------------------------------CcHHHHHH
Confidence                                                                                    89999999


Q ss_pred             hhHhHHHHHHHHhhcC--CCCCCcEEeCChHHHHHHHHHhhhhcCccccCCCHHHHhhhCCCCCCCCCCCCCCC
Q psy15208        956 SFANQTLAQIELFNNT--SNYPIGIYTLPKILDEKVARLQLKKLNVQLSKLTDQQAKYIGVSKNGPYKLDNYRY 1027 (1027)
Q Consensus       956 sf~~q~la~~~l~~~~--~~~~~gv~~lp~~~d~~vA~~~l~~~g~~~~~l~~~q~~y~~~~~~g~~~~~~~~~ 1027 (1027)
                      ||++|+||+.+|+.+.  ++++++||.||+++||+||++||++||++||+||++|++||++|++||||||||||
T Consensus       240 SFanQ~La~~~l~~~~~~~~~~~~Vy~lP~~lDe~vA~l~L~~~g~~id~Lt~~Q~~Yl~~~~~gp~k~~~y~y  313 (313)
T d1v8ba2         240 SFCNQTFAQLDLWQNKDTNKYENKVYLLPKHLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY  313 (313)
T ss_dssp             HHHHHHHHHHHHHHTTTSSSCCSSEECCCHHHHHHHHHHHHGGGTCCCCCCCHHHHHHHTCCTTSCCSCTTCCC
T ss_pred             HHHhHHHHHHHHHhcCcccccCCcEEECChHHHHHHHHHHHHhcCCEeccCCHHHHHHCCCCCCCCCCCCCCCC
Confidence            9999999999999765  57999999999999999999999999999999999999999999999999999999
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p02a3 d.130.1.1 (A:274-417) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d1mxaa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxaa2 d.130.1.1 (A:108-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} Back     information, alignment and structure
>d1mxaa1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure