Psyllid ID: psy15288

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MEKKSPNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
cccccccHHHHHHHHHHHcccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccEEccccccccccEEEEEEEccc
cccccHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHHHHHHHHHHHHHHccHHEEEEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccHccc
mekkspniscFTAVFISLESRLressshrstwifgpvlchlvPYAQMVSVFVSTLTLTAIAIDRYFVimypfqprmrlgtcTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVimypfqprmrlgtcTTLIVLIWAVSLCIALPYAYCMTLAkhsdsatlcnedwssetfqrifypswlgg
mekkspniscFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
MEKKSPNISCFTAVFIslesrlressshrsTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
*******ISCFTAVFISLESRL*****HRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWL**
**KKSPNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
MEKKSPNISCFTAVFISLES********RSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
MEKKSPNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDS***********************G
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKKSPNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSATLCNEDWSSETFQRIFYPSWLGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q9NYM4 423 Probable G-protein couple yes N/A 0.347 0.153 0.507 6e-12
Q9TTQ9 422 Probable G-protein couple yes N/A 0.347 0.154 0.492 9e-12
P30731 423 Probable G-protein couple yes N/A 0.347 0.153 0.492 1e-11
Q8SPN2 393 Prokineticin receptor 1 O no N/A 0.299 0.142 0.516 2e-10
Q8SPN1 384 Prokineticin receptor 2 O no N/A 0.315 0.153 0.476 2e-10
Q8TCW9 393 Prokineticin receptor 1 O no N/A 0.299 0.142 0.516 3e-10
P25931 464 Neuropeptide Y receptor O no N/A 0.294 0.118 0.484 4e-10
Q8NFJ6 384 Prokineticin receptor 2 O no N/A 0.438 0.213 0.397 6e-10
Q9JKL1 393 Prokineticin receptor 1 O no N/A 0.299 0.142 0.5 6e-10
Q8R416 393 Prokineticin receptor 1 O no N/A 0.299 0.142 0.5 7e-10
>sp|Q9NYM4|GPR83_HUMAN Probable G-protein coupled receptor 83 OS=Homo sapiens GN=GPR83 PE=2 SV=2 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%)

Query: 29  RSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLI 88
            STWIFG  +CH+  +AQ  S+ VS LTLTAIA+DR+ VIM+P +PR+ +      I +I
Sbjct: 134 NSTWIFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVI 193

Query: 89  WAVAT 93
           W +AT
Sbjct: 194 WTMAT 198
Orphan receptor. Could be a neuropeptide Y receptor.
Homo sapiens (taxid: 9606)
>sp|Q9TTQ9|GPR83_CANFA Probable G-protein coupled receptor 83 OS=Canis familiaris GN=GPR83 PE=2 SV=1 Back     alignment and function description
>sp|P30731|GPR83_MOUSE Probable G-protein coupled receptor 83 OS=Mus musculus GN=Gpr83 PE=2 SV=2 Back     alignment and function description
>sp|Q8SPN2|PKR1_BOVIN Prokineticin receptor 1 OS=Bos taurus GN=PROKR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8SPN1|PKR2_BOVIN Prokineticin receptor 2 OS=Bos taurus GN=PROKR2 PE=2 SV=1 Back     alignment and function description
>sp|Q8TCW9|PKR1_HUMAN Prokineticin receptor 1 OS=Homo sapiens GN=PROKR1 PE=2 SV=1 Back     alignment and function description
>sp|P25931|NPYR_DROME Neuropeptide Y receptor OS=Drosophila melanogaster GN=NepYr PE=2 SV=2 Back     alignment and function description
>sp|Q8NFJ6|PKR2_HUMAN Prokineticin receptor 2 OS=Homo sapiens GN=PROKR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9JKL1|PKR1_MOUSE Prokineticin receptor 1 OS=Mus musculus GN=Prokr1 PE=2 SV=2 Back     alignment and function description
>sp|Q8R416|PKR1_RAT Prokineticin receptor 1 OS=Rattus norvegicus GN=Prokr1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
195128937 618 GI11548 [Drosophila mojavensis] gi|19392 0.689 0.208 0.391 2e-18
195015763 605 GH16355 [Drosophila grimshawi] gi|193897 0.679 0.209 0.380 4e-18
195378536 600 GJ11567 [Drosophila virilis] gi|19415519 0.721 0.225 0.397 4e-18
345490648 381 PREDICTED: neuropeptide Y receptor type 0.352 0.173 0.621 5e-18
90654900 575 short neuropeptide F receptor [Anopheles 0.213 0.069 0.688 9e-18
312377295 777 hypothetical protein AND_11448 [Anophele 0.192 0.046 0.672 1e-17
31239533 470 AGAP012378-PA [Anopheles gambiae str. PE 0.213 0.085 0.688 1e-17
157117266 529 neuropeptide f receptor 76f [Aedes aegyp 0.352 0.124 0.651 1e-17
157136190 529 neuropeptide f receptor 76f [Aedes aegyp 0.352 0.124 0.651 1e-17
403183365 393 AAEL013505-PA, partial [Aedes aegypti] 0.352 0.167 0.651 2e-17
>gi|195128937|ref|XP_002008915.1| GI11548 [Drosophila mojavensis] gi|193920524|gb|EDW19391.1| GI11548 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 80/156 (51%), Gaps = 27/156 (17%)

Query: 32  WIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAV 91
           W FG  LCHLV +AQ  S+++STLTLT+IAIDRYFVI+YPF PRM+L TC  +IV IW +
Sbjct: 158 WAFGRTLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVI 217

Query: 92  ATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLI----WAVSLCI 147
           A           L+T+             MY       +   T LI +     W  S   
Sbjct: 218 A----------LLATVPYG----------MYMKMTNEVMDNATQLIGVNETSGWGRSYGY 257

Query: 148 ALPYAYCMTLAKH---SDSATLCNEDWSSETFQRIF 180
             P A     A     SD  T+C E+W SE ++++F
Sbjct: 258 PAPDATSAAQAYMQVISDGVTVCEENWPSEHYRKVF 293

Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195015763|ref|XP_001984271.1| GH16355 [Drosophila grimshawi] gi|193897753|gb|EDV96619.1| GH16355 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195378536|ref|XP_002048039.1| GJ11567 [Drosophila virilis] gi|194155197|gb|EDW70381.1| GJ11567 [Drosophila virilis] Back     alignment and taxonomy information
>gi|345490648|ref|XP_001601972.2| PREDICTED: neuropeptide Y receptor type 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|90654900|gb|ABD96049.1| short neuropeptide F receptor [Anopheles gambiae] Back     alignment and taxonomy information
>gi|312377295|gb|EFR24159.1| hypothetical protein AND_11448 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|31239533|ref|XP_320180.1| AGAP012378-PA [Anopheles gambiae str. PEST] gi|21287892|gb|EAA00213.1| AGAP012378-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157117266|ref|XP_001658724.1| neuropeptide f receptor 76f [Aedes aegypti] Back     alignment and taxonomy information
>gi|157136190|ref|XP_001663694.1| neuropeptide f receptor 76f [Aedes aegypti] Back     alignment and taxonomy information
>gi|403183365|gb|EAT34232.2| AAEL013505-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
FB|FBgn0036934 600 sNPF-R "short neuropeptide F r 0.352 0.11 0.606 2.1e-20
UNIPROTKB|I3LUJ4 393 PROKR1 "Uncharacterized protei 0.486 0.231 0.412 5.8e-12
UNIPROTKB|Q8TCW9 393 PROKR1 "Prokineticin receptor 0.470 0.223 0.397 2.7e-13
UNIPROTKB|Q8NFJ6 384 PROKR2 "Prokineticin receptor 0.470 0.229 0.397 6.9e-13
UNIPROTKB|J9P6F8 384 PROKR2 "Uncharacterized protei 0.470 0.229 0.386 1.5e-12
UNIPROTKB|Q30D05 385 NPY7R "Uncharacterized protein 0.336 0.163 0.523 3.3e-12
RGD|1562685 456 Pgr15l "G protein-coupled rece 0.352 0.144 0.409 3.9e-12
UNIPROTKB|F1NK50 420 GPR83-L "Uncharacterized prote 0.673 0.3 0.353 4e-12
UNIPROTKB|Q8SPN1 384 PROKR2 "Prokineticin receptor 0.331 0.161 0.483 4.1e-12
UNIPROTKB|F1MX56 418 GPR83 "Uncharacterized protein 0.336 0.150 0.492 6.6e-12
FB|FBgn0036934 sNPF-R "short neuropeptide F receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 2.1e-20, Sum P(2) = 2.1e-20
 Identities = 40/66 (60%), Positives = 51/66 (77%)

Query:    32 WIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAV 91
             W FG  LCHLV +AQ  S+++STLTLT+IAIDRYFVI+YPF PRM+L TC  +IV IW +
Sbjct:   129 WAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVI 188

Query:    92 ATVCVL 97
             A +  +
Sbjct:   189 ALLATV 194
GO:0004930 "G-protein coupled receptor activity" evidence=ISS
GO:0007218 "neuropeptide signaling pathway" evidence=ISS
GO:0004983 "neuropeptide Y receptor activity" evidence=IEA;ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS;IDA
GO:0004995 "tachykinin receptor activity" evidence=ISS
GO:0070374 "positive regulation of ERK1 and ERK2 cascade" evidence=IMP
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
UNIPROTKB|I3LUJ4 PROKR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TCW9 PROKR1 "Prokineticin receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFJ6 PROKR2 "Prokineticin receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6F8 PROKR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q30D05 NPY7R "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1562685 Pgr15l "G protein-coupled receptor 15-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK50 GPR83-L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SPN1 PROKR2 "Prokineticin receptor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX56 GPR83 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 5e-12
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 6e-09
PHA02638417 PHA02638, PHA02638, CC chemokine receptor-like pro 2e-04
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 61.9 bits (151), Expect = 5e-12
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 25  SSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPF--QPRMRLGTCT 82
                  W FG  LC LV +  +V+ + S L LTAI+IDRY  I++P   +         
Sbjct: 37  YYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAK 96

Query: 83  TLIVLIWAVATVCVL 97
            LI+++W +A +  L
Sbjct: 97  VLILVVWVLALLLSL 111

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
>gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG4219|consensus 423 99.63
PHA03234 338 DNA packaging protein UL33; Provisional 99.57
KOG4220|consensus 503 99.51
PHA02834 323 chemokine receptor-like protein; Provisional 99.42
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.31
PHA03235 409 DNA packaging protein UL33; Provisional 99.3
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.3
PHA03087 335 G protein-coupled chemokine receptor-like protein; 99.14
KOG2087|consensus 363 98.2
KOG4219|consensus 423 97.37
PHA03234 338 DNA packaging protein UL33; Provisional 96.82
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 96.66
KOG4220|consensus 503 96.53
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 95.47
PHA02834 323 chemokine receptor-like protein; Provisional 95.18
PHA02638 417 CC chemokine receptor-like protein; Provisional 94.45
PHA03235 409 DNA packaging protein UL33; Provisional 91.11
PHA03087 335 G protein-coupled chemokine receptor-like protein; 91.09
PF11710201 Git3: G protein-coupled glucose receptor regulatin 89.82
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 89.24
KOG2087|consensus 363 88.77
PF10323 283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 86.94
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 85.08
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 81.27
>KOG4219|consensus Back     alignment and domain information 
Probab=99.63  E-value=1.6e-17  Score=137.18  Aligned_cols=117  Identities=31%  Similarity=0.579  Sum_probs=100.6

Q ss_pred             cceeeeceeeeeeeccceeccccccccccccccccccchhhHHHHHHHHHHHHHHHhhheeeEEeeccceeeccchhhhh
Q psy15288          6 PNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLI   85 (187)
Q Consensus         6 ~~la~~dl~~~~~~~p~~i~~~~~~~w~~g~~~C~~~~~~~~~~~~~s~~~l~~iavdR~~ai~~p~~~~~~~~~~~~~~   85 (187)
                      .|||++|+.++....++.-...+...|.+|...|+++.++..+..++|.++|+++|+|||.||.+|++.+.+.|      
T Consensus        75 ~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f~C~f~nf~~itav~vSVfTlvAiA~DRy~AIi~Pl~~r~s~r------  148 (423)
T KOG4219|consen   75 VNLAFADLSMSIFNTVFNFQYALHQEWYFGSFYCRFVNFFPITAVFVSVFTLVAIAIDRYMAIIHPLQPRPSRR------  148 (423)
T ss_pred             HHHHHHHHHHHHHhhHHHHHHHHHhccccccceeeeccccchhhhhHhHHHHHHHHHHHHHHHhhhcccCCCCc------
Confidence            48999999999999999888888889999999999999999999999999999999999999999998875544      


Q ss_pred             HHHHHHhhhhhhhccccchhhHhhhheeeeeEEEEEeeCCCCccchhhHHHHHHHHHHHHHHHhHHHhhhhcccCCC---
Q psy15288         86 VLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSD---  162 (187)
Q Consensus        86 ~~~W~~~~~~~~~~~~~~~s~~~l~~is~dR~~~i~~p~~~~~~~~~~~~~~~~~Wi~~~~~~~p~~~~~~~~~~~~---  162 (187)
                                                                    .++..++++|+++++.+.|..++.++++..+   
T Consensus       149 ----------------------------------------------~sk~iIllIW~lA~l~a~P~~l~s~v~~~~~~d~  182 (423)
T KOG4219|consen  149 ----------------------------------------------SSKIIILLIWALALLLALPQLLYSSVEELYLYDG  182 (423)
T ss_pred             ----------------------------------------------ceeehhHHHHHHHHHHhccceeeeeeEEeeccCC
Confidence                                                          7778899999999999999999877665433   


Q ss_pred             -Cccccccccccc
Q psy15288        163 -SATLCNEDWSSE  174 (187)
Q Consensus       163 -~~~~C~~~~~~~  174 (187)
                       ..+.|.-.|+++
T Consensus       183 ~~~~~~~~~~pe~  195 (423)
T KOG4219|consen  183 ESRVVCVTAWPEH  195 (423)
T ss_pred             cceEEEEEecccc
Confidence             245676666654

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
2ks9_A 364 Solution Conformation Of Substance P In Water Compl 3e-06
2ks9_A 364 Solution Conformation Of Substance P In Water Compl 7e-06
4ea3_B434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 1e-04
3vw7_A 484 Crystal Structure Of Human Protease-Activated Recep 1e-04
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%)
Query: 32  WIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAV 91
           W +G   C    +  + +VF S  ++TA+A DRY  I++P QPR+       +I +IW +
Sbjct: 98  WYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVL 157
Query: 92  A 92
           A
Sbjct: 158 A 158
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|3VW7|A Chain A, Crystal Structure Of Human Protease-Activated Receptor 1 (Par1) Bound With Antagonist Vorapaxar At 2.2 Angstrom Length = 484 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 2e-23
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 2e-18
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 3e-16
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 8e-11
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-07
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-10
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 2e-07
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 2e-09
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-07
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 8e-08
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 9e-07
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 1e-07
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-05
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-07
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-06
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 3e-07
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 4e-06
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 8e-07
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 6e-05
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 1e-06
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 6e-05
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 2e-06
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 2e-05
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 1e-05
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-04
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 1e-05
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 6e-05
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
 Score = 94.0 bits (234), Expect = 2e-23
 Identities = 21/68 (30%), Positives = 36/68 (52%)

Query: 30  STWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIW 89
           + W +G   C    +  + +VF S  ++TA+A DRY  I++P QPR+       +I +IW
Sbjct: 96  NEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIW 155

Query: 90  AVATVCVL 97
            +A +   
Sbjct: 156 VLALLLAF 163
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.52
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.46
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.45
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.45
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.41
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.41
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.4
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.4
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.39
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.37
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.37
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.37
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.33
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.3
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.29
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.28
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.27
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.21
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 97.82
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 97.66
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 96.43
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 96.08
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 95.89
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 95.83
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 95.5
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 95.23
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 95.06
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 94.7
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 94.52
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 94.28
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 93.79
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 93.52
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 93.49
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 93.23
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 93.18
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 92.95
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 92.77
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 92.39
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.52  E-value=5.1e-16  Score=133.62  Aligned_cols=119  Identities=18%  Similarity=0.387  Sum_probs=97.6

Q ss_pred             cceeeeceeeeeeeccceecccc--ccccccccccccccchhhHHHHHHHHHHHHHHHhhheeeEEeeccceeeccchhh
Q psy15288          6 PNISCFTAVFISLESRLRESSSH--RSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTT   83 (187)
Q Consensus         6 ~~la~~dl~~~~~~~p~~i~~~~--~~~w~~g~~~C~~~~~~~~~~~~~s~~~l~~iavdR~~ai~~p~~~~~~~~~~~~   83 (187)
                      .|||++|++++++.+|+.+....  .+.|.+|+..|++..++.......+.+++++||+|||+||++|++++...+    
T Consensus        75 ~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~~~C~~~~~~~~~~~~~S~~~l~~is~dRy~ai~~P~~~~~~~t----  150 (510)
T 4grv_A           75 GSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVARYLAICHPFKAKTLMS----  150 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCCCCCC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHheEEEecccccccccc----
Confidence            38999999999889999887654  357999999999999999999999999999999999999999998764333    


Q ss_pred             hhHHHHHHhhhhhhhccccchhhHhhhheeeeeEEEEEeeCCCCccchhhHHHHHHHHHHHHHHHhHHHhhhhcccCCC-
Q psy15288         84 LIVLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSD-  162 (187)
Q Consensus        84 ~~~~~W~~~~~~~~~~~~~~~s~~~l~~is~dR~~~i~~p~~~~~~~~~~~~~~~~~Wi~~~~~~~p~~~~~~~~~~~~-  162 (187)
                                                                    ++++..+++++|++++++++|++++++...... 
T Consensus       151 ----------------------------------------------~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~~~~~  184 (510)
T 4grv_A          151 ----------------------------------------------RSRTKKFISAIWLASALLAIPMLFTMGLQNRSAD  184 (510)
T ss_dssp             ----------------------------------------------CSCCHHHHHHHHHHHHHHHTTHHHHEEEEECSSS
T ss_pred             ----------------------------------------------ccccceeehHHHHHHHHHHHHHHHhhcccccccC
Confidence                                                          447778899999999999999999876543322 


Q ss_pred             ----Cccccccccccc
Q psy15288        163 ----SATLCNEDWSSE  174 (187)
Q Consensus       163 ----~~~~C~~~~~~~  174 (187)
                          +...|.+.++..
T Consensus       185 ~~~~~~~~c~~~~~~~  200 (510)
T 4grv_A          185 GTHPGGLVCTPIVDTA  200 (510)
T ss_dssp             SCCGGGEEEEECSCHH
T ss_pred             CCCCCccccccccccc
Confidence                223577776643
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 98.96
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.96  E-value=1.6e-11  Score=97.48  Aligned_cols=116  Identities=17%  Similarity=0.230  Sum_probs=94.2

Q ss_pred             cceeeeceeeeeeeccceeccccccccccccccccccchhhHHHHHHHHHHHHHHHhhheeeEEeeccceeeccchhhhh
Q psy15288          6 PNISCFTAVFISLESRLRESSSHRSTWIFGPVLCHLVPYAQMVSVFVSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLI   85 (187)
Q Consensus         6 ~~la~~dl~~~~~~~p~~i~~~~~~~w~~g~~~C~~~~~~~~~~~~~s~~~l~~iavdR~~ai~~p~~~~~~~~~~~~~~   85 (187)
                      .|||++|++++....|..+.....+.|..+...|+...+....+...+.++++++++|||.++++|++++...       
T Consensus        77 ~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~~-------  149 (348)
T d1u19a_          77 LNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFG-------  149 (348)
T ss_dssp             HHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCCC-------
T ss_pred             HHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhhhhhccccceeeecchhhhhhcccceeeeccccccccc-------
Confidence            4789999998888888888888888899999999999999999999999999999999999999999875432       


Q ss_pred             HHHHHHhhhhhhhccccchhhHhhhheeeeeEEEEEeeCCCCccchhhHHHHHHHHHHHHHHHhHHHhhhhcccCCCCcc
Q psy15288         86 VLIWAVATVCVLYDAGEALSTLTLTAIAIDRYFVIMYPFQPRMRLGTCTTLIVLIWAVSLCIALPYAYCMTLAKHSDSAT  165 (187)
Q Consensus        86 ~~~W~~~~~~~~~~~~~~~s~~~l~~is~dR~~~i~~p~~~~~~~~~~~~~~~~~Wi~~~~~~~p~~~~~~~~~~~~~~~  165 (187)
                                                                  +++.....+.+|..++.+..|+.++......+++..
T Consensus       150 --------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (348)
T d1u19a_         150 --------------------------------------------ENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQC  185 (348)
T ss_dssp             --------------------------------------------HHHHHHHHHHHHHHHHHHHSGGGTTSSCCEEETTTT
T ss_pred             --------------------------------------------cccccccceeeehhhhheecccccccceeccCCccc
Confidence                                                        235666777889999999999888766555444445


Q ss_pred             ccccccc
Q psy15288        166 LCNEDWS  172 (187)
Q Consensus       166 ~C~~~~~  172 (187)
                      .|...+.
T Consensus       186 ~~~~~~~  192 (348)
T d1u19a_         186 SCGIDYY  192 (348)
T ss_dssp             EEECCCS
T ss_pred             ccccccc
Confidence            5554443