Psyllid ID: psy15633

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MCENSGGTYPNTLLSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAGYA
cccccccccccccccccccccccccccccHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHccccccc
mcensggtypntllspekkiddhikrpmNAFMVWSRLQRRKiaqdnpkmhnSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMhmkdhpdykyrprrkpktlrkdgytypavsvpyqsvpvdalragya
mcensggtypntllspekkiDDHIKRPMNAFMVWSRLQRRKIaqdnpkmhnseiskrlgaewklltenekrpyiDEAKRlramhmkdhpdykyrprrkpktlrkdgytypavsvpyqsvpvDALRAGYA
MCENSGGTYPNTLLSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAGYA
***************************MNAFMVWSRL************************WKLL*****************************************YTYPAVSVPYQ************
****************************NAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKY************************************
********YPNTLLSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAGYA
***********************IKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRR********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCENSGGTYPNTLLSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAGYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q6RVD7 245 Transcription factor Sox- yes N/A 0.798 0.420 0.766 1e-41
B0ZTE1 262 Transcription factor Sox- N/A N/A 0.798 0.393 0.726 2e-41
Q811W0 276 Transcription factor SOX- yes N/A 0.713 0.333 0.833 2e-41
Q9Y651 276 Transcription factor SOX- yes N/A 0.713 0.333 0.833 3e-41
Q6P0E1 315 Transcription factor Sox- no N/A 0.837 0.342 0.745 2e-40
Q9W7R6 240 Transcription factor SOX- yes N/A 0.813 0.437 0.754 3e-40
Q9W7R5 280 Transcription factor SOX- no N/A 0.713 0.328 0.822 3e-40
Q32PP9 238 Transcription factor Sox- no N/A 0.736 0.399 0.808 3e-40
Q04892 240 Transcription factor SOX- no N/A 0.736 0.395 0.808 4e-40
P61259 240 Transcription factor SOX- N/A N/A 0.736 0.395 0.808 5e-40
>sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 Back     alignment and function desciption
 Score =  168 bits (425), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/107 (76%), Positives = 93/107 (86%), Gaps = 4/107 (3%)

Query: 22  DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR 81
           DH+KRPMNAFMVWSR QRRK+AQ+NPKMHNSEISKRLGAEWKLLTE+EKRP+IDEAKRLR
Sbjct: 6   DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLR 65

Query: 82  AMHMKDHPDYKYRPRRKPKTL-RKDGYTYPAVSVPYQSVPVDALRAG 127
           AMHMK+HPDYKYRPRRKPKTL +KD + +P   V Y     +AL+ G
Sbjct: 66  AMHMKEHPDYKYRPRRKPKTLMKKDKFAFP---VAYNLGEHEALKVG 109
Acts as a negative regulator of transcription.
Danio rerio (taxid: 7955)
>sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 Back     alignment and function description
>sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 Back     alignment and function description
>sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 Back     alignment and function description
>sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 Back     alignment and function description
>sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 Back     alignment and function description
>sp|Q32PP9|SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio GN=sox14 PE=2 SV=1 Back     alignment and function description
>sp|Q04892|SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus GN=Sox14 PE=2 SV=2 Back     alignment and function description
>sp|P61259|SOX14_MACFA Transcription factor SOX-14 OS=Macaca fascicularis GN=SOX14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
270008130 379 Sox21b [Tribolium castaneum] 0.906 0.308 0.819 1e-50
91083765 398 PREDICTED: similar to Sox21b CG32139-PA 0.906 0.293 0.819 2e-50
195378570 627 GJ11556 [Drosophila virilis] gi|19415521 0.937 0.192 0.746 1e-49
242007461 381 transcription factor SOX-2, putative [Pe 0.937 0.317 0.767 1e-49
195427297 618 GK17144 [Drosophila willistoni] gi|19415 0.937 0.195 0.746 2e-49
442632266 587 Sox21b, isoform C [Drosophila melanogast 0.937 0.206 0.746 2e-49
21357781 571 Sox21b, isoform A [Drosophila melanogast 0.937 0.211 0.746 2e-49
198465214 590 GA23525 [Drosophila pseudoobscura pseudo 0.937 0.205 0.746 2e-49
195327518 575 GM24556 [Drosophila sechellia] gi|194119 0.937 0.210 0.746 2e-49
195128971 614 GI11537 [Drosophila mojavensis] gi|19392 0.937 0.197 0.746 3e-49
>gi|270008130|gb|EFA04578.1| Sox21b [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 110/122 (90%), Gaps = 5/122 (4%)

Query: 10  PNTLLSPE--KKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTE 67
           P  L +P+  KK +DHIKRPMNAFMVWSRLQRRKIAQ+NPKMHNSEISKRLGAEWKLLTE
Sbjct: 26  PQGLQNPQATKKQEDHIKRPMNAFMVWSRLQRRKIAQENPKMHNSEISKRLGAEWKLLTE 85

Query: 68  NEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAG 127
           +EKRP+IDEAKRLRAMHMK+HPDYKYRPRRKPKTLRK+GY Y   S+PY SVP+DALRAG
Sbjct: 86  DEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTLRKEGYPY---SIPYPSVPMDALRAG 142

Query: 128 YA 129
            A
Sbjct: 143 MA 144

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91083765|ref|XP_971967.1| PREDICTED: similar to Sox21b CG32139-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195378570|ref|XP_002048056.1| GJ11556 [Drosophila virilis] gi|194155214|gb|EDW70398.1| GJ11556 [Drosophila virilis] Back     alignment and taxonomy information
>gi|242007461|ref|XP_002424558.1| transcription factor SOX-2, putative [Pediculus humanus corporis] gi|212508001|gb|EEB11820.1| transcription factor SOX-2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195427297|ref|XP_002061713.1| GK17144 [Drosophila willistoni] gi|194157798|gb|EDW72699.1| GK17144 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|442632266|ref|NP_001261829.1| Sox21b, isoform C [Drosophila melanogaster] gi|440215768|gb|AGB94522.1| Sox21b, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|21357781|ref|NP_648695.1| Sox21b, isoform A [Drosophila melanogaster] gi|442632264|ref|NP_001261828.1| Sox21b, isoform B [Drosophila melanogaster] gi|16197817|gb|AAL13542.1| GH07353p [Drosophila melanogaster] gi|23093490|gb|AAF49754.2| Sox21b, isoform A [Drosophila melanogaster] gi|220945316|gb|ACL85201.1| Sox21b-PA [synthetic construct] gi|220952556|gb|ACL88821.1| Sox21b-PA [synthetic construct] gi|440215767|gb|AGB94521.1| Sox21b, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198465214|ref|XP_002134931.1| GA23525 [Drosophila pseudoobscura pseudoobscura] gi|198150060|gb|EDY73558.1| GA23525 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195327518|ref|XP_002030465.1| GM24556 [Drosophila sechellia] gi|194119408|gb|EDW41451.1| GM24556 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195128971|ref|XP_002008932.1| GI11537 [Drosophila mojavensis] gi|193920541|gb|EDW19408.1| GI11537 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
FB|FBgn0042630 571 Sox21b "Sox21b" [Drosophila me 0.837 0.189 0.837 3.7e-48
UNIPROTKB|F2Z520 416 SOX21 "Uncharacterized protein 0.829 0.257 0.758 1.4e-41
ZFIN|ZDB-GENE-040429-1 245 sox21b "SRY-box containing gen 0.798 0.420 0.766 7.5e-41
UNIPROTKB|E1BHN5204 LOC614121 "Uncharacterized pro 0.713 0.450 0.833 9.6e-41
UNIPROTKB|Q9Y651 276 SOX21 "Transcription factor SO 0.713 0.333 0.833 9.6e-41
MGI|MGI:2654070 276 Sox21 "SRY-box containing gene 0.713 0.333 0.833 9.6e-41
UNIPROTKB|B0ZTE1 262 sox21 "Transcription factor So 0.790 0.389 0.775 1.2e-40
UNIPROTKB|Q9W7R5 280 SOX21 "Transcription factor SO 0.713 0.328 0.822 5.3e-40
UNIPROTKB|Q9W7R6 240 SOX14 "Transcription factor SO 0.806 0.433 0.761 8.7e-40
UNIPROTKB|O95416 240 SOX14 "Transcription factor SO 0.806 0.433 0.761 8.7e-40
FB|FBgn0042630 Sox21b "Sox21b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 503 (182.1 bits), Expect = 3.7e-48, P = 3.7e-48
 Identities = 93/111 (83%), Positives = 103/111 (92%)

Query:    17 EKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDE 76
             +++ ++HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTE EKRP+IDE
Sbjct:   241 KRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDE 300

Query:    77 AKRLRAMHMKDHPDYKYRPRRKPKTLRKDGYTYPAVSVPYQSVPVDALRAG 127
             AKRLRAMHMK+HPDYKYRPRRKPK LR+DGY YP   +PY SVPV+ALRAG
Sbjct:   301 AKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYP---MPYPSVPVEALRAG 348
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0008301 "DNA binding, bending" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
UNIPROTKB|F2Z520 SOX21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040429-1 sox21b "SRY-box containing gene 21 b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHN5 LOC614121 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y651 SOX21 "Transcription factor SOX-21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2654070 Sox21 "SRY-box containing gene 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B0ZTE1 sox21 "Transcription factor Sox-21" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W7R5 SOX21 "Transcription factor SOX-21" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W7R6 SOX14 "Transcription factor SOX-14" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O95416 SOX14 "Transcription factor SOX-14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6RVD7SX21B_DANRENo assigned EC number0.76630.79840.4204yesN/A
Q9W7R6SOX14_CHICKNo assigned EC number0.75450.81390.4375yesN/A
Q811W0SOX21_MOUSENo assigned EC number0.83330.71310.3333yesN/A
Q9Y651SOX21_HUMANNo assigned EC number0.83330.71310.3333yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 3e-35
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 2e-25
smart0039870 smart00398, HMG, high mobility group 2e-22
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 3e-20
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 1e-18
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 7e-14
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 1e-10
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 1e-04
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 0.004
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information 
 Score =  115 bits (291), Expect = 3e-35
 Identities = 41/72 (56%), Positives = 54/72 (75%)

Query: 23 HIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRA 82
          HIKRPMNAFM++S+  RRK+ Q+ P   N  ISK LG  WK L+  EK+PY +EAK+L+ 
Sbjct: 1  HIKRPMNAFMLFSKRHRRKVLQEYPLKENRAISKILGDRWKALSNEEKQPYYEEAKKLKE 60

Query: 83 MHMKDHPDYKYR 94
          +HMK +PDYK+R
Sbjct: 61 LHMKLYPDYKWR 72

These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif. Length = 72
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
KOG0527|consensus 331 99.95
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.95
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.93
PTZ0019994 high mobility group protein; Provisional 99.9
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.86
smart0039870 HMG high mobility group. 99.85
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.85
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.81
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.8
COG5648211 NHP6B Chromatin-associated proteins containing the 99.76
KOG0381|consensus96 99.74
KOG3248|consensus 421 99.73
KOG0528|consensus511 99.71
KOG0526|consensus615 99.59
KOG4715|consensus 410 99.24
KOG2746|consensus 683 99.07
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.23
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.78
COG5648211 NHP6B Chromatin-associated proteins containing the 97.47
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 97.44
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 96.98
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 96.54
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 93.81
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 91.82
PRK15117211 ABC transporter periplasmic binding protein MlaC; 89.65
PF05494170 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: 85.05
KOG3223|consensus221 81.23
>KOG0527|consensus Back     alignment and domain information 
Probab=99.95  E-value=9.2e-28  Score=187.24  Aligned_cols=93  Identities=71%  Similarity=1.071  Sum_probs=87.8

Q ss_pred             CCCCCCCCCCCCCCCcHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHHhCCCCCC
Q psy15633         14 LSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKY   93 (129)
Q Consensus        14 ~~~~~k~~~~pkrP~naf~lf~~~~r~~~~~~~p~~~~~eisk~l~~~Wk~ls~~eK~~y~~~a~~~k~~y~~~~~~yk~   93 (129)
                      ....++..+++||||||||+|.+..|.+|..+||++.+.||||.||..||.|+++||.+|+++|++++..|++++|+|+|
T Consensus        53 ~~~~k~~~~hIKRPMNAFMVWSq~~RRkma~qnP~mHNSEISK~LG~~WK~Lse~EKrPFi~EAeRLR~~HmkehPdYKY  132 (331)
T KOG0527|consen   53 GMKDKTSTDRIKRPMNAFMVWSQGQRRKLAKQNPKMHNSEISKRLGAEWKLLSEEEKRPFVDEAERLRAQHMKEYPDYKY  132 (331)
T ss_pred             cccCCCCccccCCCcchhhhhhHHHHHHHHHhCcchhhHHHHHHHHHHHhhcCHhhhccHHHHHHHHHHHHHHhCCCccc
Confidence            34567889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcccccCC
Q psy15633         94 RPRRKPKTLRKDG  106 (129)
Q Consensus        94 ~p~~~~~~~~~~~  106 (129)
                      +||||+++.....
T Consensus       133 RPRRKkk~~~~~~  145 (331)
T KOG0527|consen  133 RPRRKKKKRPKLL  145 (331)
T ss_pred             ccccccccccccc
Confidence            9999988777764

>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0381|consensus Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>KOG0526|consensus Back     alignment and domain information
>KOG4715|consensus Back     alignment and domain information
>KOG2746|consensus Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>PF05494 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation [] Back     alignment and domain information
>KOG3223|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 2e-37
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 6e-37
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 7e-37
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 6e-27
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 6e-27
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 2e-26
4euw_A106 Crystal Structure Of A Hmg Domain Of Transcription 8e-26
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 1e-25
1hrz_A76 The 3d Structure Of The Human Sry-Dna Complex Solve 6e-25
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 3e-24
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 3e-23
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 2e-22
1i11_A81 Solution Structure Of The Dna Binding Domain, Sox-5 2e-21
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 8e-09
1wz6_A82 Solution Structure Of The Hmg_box Domain Of Murine 8e-08
2lef_A86 Lef1 Hmg Domain (From Mouse), Complexed With Dna (1 6e-07
2e6o_A87 Solution Structure Of The Hmg Box Domain From Human 4e-06
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 4e-05
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 4e-05
2crj_A92 Solution Structure Of The Hmg Domain Of Mouse Hmg D 8e-05
1j3d_A78 Solution Structure Of The C-Terminal Domain Of The 9e-05
1j3c_A79 Solution Structure Of The C-Terminal Domain Of The 1e-04
2lhj_A97 Nmr Structure Of The High Mobility Group Protein-Li 3e-04
1nhm_A81 The Structure Of The Hmg Box And Its Interaction Wi 6e-04
1e7j_A74 Hmg-D Complexed To A Bulge Dna Length = 74 6e-04
1hsm_A79 The Structure Of The Hmg Box And Its Interaction Wi 6e-04
1hma_A73 The Solution Structure And Dynamics Of The Dna Bind 8e-04
1qrv_A73 Crystal Structure Of The Complex Of Hmg-D And Dna L 8e-04
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (379), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/83 (85%), Positives = 78/83 (93%)
Query: 22  DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR 81
           D +KRPMNAFMVWSR QRRK+AQ+NPKMHNSEISKRLGAEWKLL+E EKRP+IDEAKRLR
Sbjct: 6   DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLR 65
Query: 82  AMHMKDHPDYKYRPRRKPKTLRK 104
           A+HMK+HPDYKYRPRRK KTL K
Sbjct: 66  ALHMKEHPDYKYRPRRKTKTLMK 88
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 Back     alignment and structure
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure
>pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|1I11|A Chain A, Solution Structure Of The Dna Binding Domain, Sox-5 Hmg Box From Mouse Length = 81 Back     alignment and structure
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure
>pdb|1WZ6|A Chain A, Solution Structure Of The Hmg_box Domain Of Murine Bobby Sox Homolog Length = 82 Back     alignment and structure
>pdb|2LEF|A Chain A, Lef1 Hmg Domain (From Mouse), Complexed With Dna (15bp), Nmr, 12 Structures Length = 86 Back     alignment and structure
>pdb|2E6O|A Chain A, Solution Structure Of The Hmg Box Domain From Human Hmg-Box Transcription Factor 1 Length = 87 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|2CRJ|A Chain A, Solution Structure Of The Hmg Domain Of Mouse Hmg Domain Protein Hmgx2 Length = 92 Back     alignment and structure
>pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 Back     alignment and structure
>pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 Back     alignment and structure
>pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 Back     alignment and structure
>pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 Back     alignment and structure
>pdb|1E7J|A Chain A, Hmg-D Complexed To A Bulge Dna Length = 74 Back     alignment and structure
>pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 Back     alignment and structure
>pdb|1HMA|A Chain A, The Solution Structure And Dynamics Of The Dna Binding Domain Of Hmg-D From Drosophila Melanogaster Length = 73 Back     alignment and structure
>pdb|1QRV|A Chain A, Crystal Structure Of The Complex Of Hmg-D And Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 3e-46
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 3e-46
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 1e-45
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 4e-45
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 5e-45
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 8e-45
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 2e-44
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 3e-44
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 1e-43
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 6e-42
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 1e-40
1wgf_A90 Upstream binding factor 1; transcription factor, D 4e-34
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 4e-32
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 6e-32
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 3e-29
1hme_A77 High mobility group protein fragment-B; DNA-bindin 3e-26
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 3e-25
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 1e-22
2lhj_A97 High mobility group protein homolog NHP1; structur 4e-22
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 2e-21
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-21
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 2e-20
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 2e-19
2yrq_A173 High mobility group protein B1; HMG box domain, DN 6e-17
2yrq_A173 High mobility group protein B1; HMG box domain, DN 5e-10
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 2e-16
1ckt_A71 High mobility group 1 protein; high-mobility group 3e-16
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 5e-15
3tq6_A214 Transcription factor A, mitochondrial; transcripti 1e-12
3tq6_A214 Transcription factor A, mitochondrial; transcripti 2e-08
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 3e-12
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 3e-12
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 4e-12
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 1e-09
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 1e-08
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 3e-07
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
 Score =  143 bits (363), Expect = 3e-46
 Identities = 54/85 (63%), Positives = 70/85 (82%)

Query: 20  IDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKR 79
           + D +KRPMNAF+VWSR QRRK+A +NP+M NSEISK+LG +WK+LTE EK P+  EA++
Sbjct: 1   MQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQK 60

Query: 80  LRAMHMKDHPDYKYRPRRKPKTLRK 104
           L+AMH + +P+YKYRPRRK K L K
Sbjct: 61  LQAMHREKYPNYKYRPRRKAKMLPK 85
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.96
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.96
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.96
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.96
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.95
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.95
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.95
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.95
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.95
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.95
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.93
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.93
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.93
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.93
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.93
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.92
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.92
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.92
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.91
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.9
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.9
1ckt_A71 High mobility group 1 protein; high-mobility group 99.9
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.9
2lhj_A97 High mobility group protein homolog NHP1; structur 99.89
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.87
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.87
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.87
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.87
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.87
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.87
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.87
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.86
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.84
2cto_A93 Novel protein; high mobility group box domain, hel 99.84
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.83
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.82
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.79
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.74
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.73
2qgu_A211 Probable signal peptide protein; NESG, RSR89, Q8XV 83.45
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=6.1e-29  Score=165.50  Aligned_cols=93  Identities=54%  Similarity=0.993  Sum_probs=71.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHHh
Q psy15633          8 TYPNTLLSPEKKIDDHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKD   87 (129)
Q Consensus         8 ~~p~~~~~~~~k~~~~pkrP~naf~lf~~~~r~~~~~~~p~~~~~eisk~l~~~Wk~ls~~eK~~y~~~a~~~k~~y~~~   87 (129)
                      +..+++.....+++++||||+||||||++++|.+++.++|++++.+|+++||++|+.|+++||++|.++|++++++|+++
T Consensus        14 ~~~~~~~~~~~k~~~~pKRP~naf~lF~~~~r~~~k~~~P~~~~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e   93 (106)
T 4euw_A           14 KMSENLYFQSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKD   93 (106)
T ss_dssp             --------------CCCCCCCCHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccchhhhccCCCCcCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHH
Confidence            34556677888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCc
Q psy15633         88 HPDYKYRPRRKPK  100 (129)
Q Consensus        88 ~~~yk~~p~~~~~  100 (129)
                      +++|+|+|+++++
T Consensus        94 ~~~Yky~PrrkKs  106 (106)
T 4euw_A           94 HPDYKYQPRRRKS  106 (106)
T ss_dssp             CTTCCC-------
T ss_pred             hhhcCcCCCCCCC
Confidence            9999999998763
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2qgu_A Probable signal peptide protein; NESG, RSR89, Q8XV73, structural genomics, PSI-2, protein STR initiative; HET: MSE PEF; 1.50A {Ralstonia solanacearum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 1e-31
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 7e-30
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 6e-29
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 5e-26
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 7e-23
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 8e-20
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 2e-18
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 4e-18
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 7e-18
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 9e-18
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-17
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-17
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  105 bits (263), Expect = 1e-31
 Identities = 69/80 (86%), Positives = 76/80 (95%)

Query: 22  DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLR 81
           D +KRPMNAFMVWSR QRRK+AQ+NPKMHNSEISKRLGAEWKLL+E EKRP+IDEAKRLR
Sbjct: 1   DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLR 60

Query: 82  AMHMKDHPDYKYRPRRKPKT 101
           A+HMK+HPDYKYRPRRK KT
Sbjct: 61  ALHMKEHPDYKYRPRRKTKT 80
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.95
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.91
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.9
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.89
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.89
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.89
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.87
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.83
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.82
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 96.58
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=1.3e-28  Score=154.77  Aligned_cols=79  Identities=86%  Similarity=1.389  Sum_probs=76.2

Q ss_pred             CCCCCCCcHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCCc
Q psy15633         22 DHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTENEKRPYIDEAKRLRAMHMKDHPDYKYRPRRKPK  100 (129)
Q Consensus        22 ~~pkrP~naf~lf~~~~r~~~~~~~p~~~~~eisk~l~~~Wk~ls~~eK~~y~~~a~~~k~~y~~~~~~yk~~p~~~~~  100 (129)
                      ++||||+||||||++++|.+|+.+||++++.+|+++||++|++|+++||++|+++|..++++|..++++|+|+|+++.+
T Consensus         1 ~kiKRP~nAy~lF~~~~r~~~~~~~p~~~~~eisk~~g~~W~~l~~eeK~~y~~~A~~~k~~y~~~~p~Yk~~p~rk~k   79 (80)
T d1gt0d_           1 DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTK   79 (80)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHCTTCCCCCCCCCC
T ss_pred             CCCCCCCcHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHCcCCHHHHHHHHHHHHHHHHHHHHHCccccCCCCCCCC
Confidence            5799999999999999999999999999999999999999999999999999999999999999999999999987654
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure