Psyllid ID: psy15648

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------
MNTTAGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
cccccccccccccEEEcccccccccccccccccccccccccEEcccccEEcccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccEEEccEEEEEEccccEEEEEEEcccccEEEEEEccccccEEEEcccc
ccccccccccccEEEEEcccccccccccccEEcccccEcEEEEccccEEEEccccccccEEccccHHHHHHHHHHHHHHHHccccEEEEccHHHHcccccccccccccccccccccccccccEcccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHcccccccEEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHccccccccEEEcccccccEEEEcccHHHHHHHHHHHHHccccEEEEccccccccccccHHHcccHHHHHHHHHHccHHHHcccccccccccccccccccccEEcccccHHHcHHHHHcccHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccccHHHHHHHHHHHcccccEEEEccEcccccccccHHHcccHHHHHHHHHHHcHHHHccccccccccccccccccccEEEcccccHHHcHHHHHccccHHHHHHHHHHHHHccccEEEcccHHcccccccEEEEEEEcccccEEEEEEEcccccEEEEcccc
mnttagiapydeyyvwkegkgvnkteppnnwvsvfsgsawtydenrKMFYLHQfsakqpdlnFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFeagdfkdekykpgkegsmnyddlihdkttdlPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKyfkyngrpaahypfnfqlvldpdkgERALVLILNHYMKVksknqfkdnlpaegtsnwvydnhdnprvtNRLGKELADAYLMISLLMpgvgvtyygdeigmegplvrnderrdpnnaggaradetrdpertpmqwdstkhagfstarktwlpvnpnyyylNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKfeaydnhdnprvtNRLGKELADAYLMISLLMpgvgvtyygdeigmegplvrnderrdpnnaggaradetrdpertpmqwdstkhagfstarktwlpvnpnyyylNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVlglsrsmpgndtYIVLINFNSIIEEVDLSVM
mnttagiapydeyyVWKEGkgvnkteppnnWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAgdfkdekykpgkegSMNYDDLIHDKTTDLPELYEILVKWRALVDeykqktghtrilIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGtsnwvydnhdnPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGplvrnderrdpnnaggaradetrdpertpmqwdstkhagfstarktwlpVNPNYYYLNVEaqkkadwsTYKLYRKLSQLRRTDTMIYGAVSThilngewvLGLSRAANMLLTEMKRERAkfeaydnhdnprvTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGplvrnderrdpnnaggaradetrdpertpmqwdstkhagfstarktwlpVNPNYYYLNVEaqkkadwsTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
MNTTAGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
*****GIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFK************NYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGM****************************************GFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDN****RVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGM****************************************GFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEV*****
******IAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
MNTTAGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
*****GIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTTAGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRAANMLLTEMKRERAKFEAYDNHDNPRVTNRLGKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVSTHILNGEWVLGLSRSMPGNDTYIVLINFNSIIEEVDLSVM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query567 2.2.26 [Sep-21-2011]
O16099594 Maltase 2 OS=Drosophila v N/A N/A 0.611 0.584 0.430 3e-76
O16098632 Maltase 1 OS=Drosophila v N/A N/A 0.611 0.549 0.407 3e-73
P13080579 Probable maltase OS=Aedes N/A N/A 0.626 0.613 0.408 1e-72
P07192574 Maltase A3 OS=Drosophila no N/A 0.647 0.639 0.394 2e-69
Q17058567 Alpha-glucosidase OS=Apis no N/A 0.617 0.617 0.377 3e-65
P07191567 Probable maltase D OS=Dro no N/A 0.594 0.594 0.364 2e-62
P07190577 Probable maltase H OS=Dro no N/A 0.622 0.611 0.352 3e-60
Q07837685 Neutral and basic amino a yes N/A 0.592 0.490 0.352 1e-56
Q64319683 Neutral and basic amino a yes N/A 0.578 0.480 0.336 2e-54
O06994561 Oligo-1,6-glucosidase 1 O yes N/A 0.647 0.654 0.319 1e-41
>sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 Back     alignment and function desciption
 Score =  286 bits (732), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 214/367 (58%), Gaps = 20/367 (5%)

Query: 10  YDEYYVWKEGKGVNK--TEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKK 67
           YD +YVW +GK  N+   +PPNNW SVF GSAW + E R  +YLHQF+ +QPDLNFR+  
Sbjct: 159 YDNFYVWADGKLDNQGVRQPPNNWQSVFYGSAWQWHEQRGQYYLHQFAKEQPDLNFRNPA 218

Query: 68  LQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDL 127
           +  AM+ VL FWL+KG+ G+RIDAL H+FE     DE         ++YD   H  T DL
Sbjct: 219 VVRAMDDVLLFWLNKGVAGFRIDALNHLFEDETLPDEPLSGKTTDPLSYDYTKHIYTKDL 278

Query: 128 PELYEILVKWRALVDEY--KQKTGHTRILIVESYTDIENTMKYFK-YNGRPAAHYPFNFQ 184
           PE+  ++  WR L+D+Y  K   G TRI++ E+Y D++  M Y++   G   +  PFNF 
Sbjct: 279 PEVLSMVQHWRQLLDDYTAKHSEGATRIMMTEAYADLQVLMDYYEDAGGVRGSQLPFNFH 338

Query: 185 LVLDP--DKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKEL 242
            + D   D   R  V  +  ++           +P   T+NWV  NHD PRV  R G   
Sbjct: 339 FITDVSGDSDARDFVYNIEKWLIY---------MPRGHTANWVMGNHDKPRVATRFGPAS 389

Query: 243 ADAYLMISLLMPGVGVTYYGDEIGMEG-PLVRNDERRDPNNAGGARAD---ETRDPERTP 298
            DA  M+ L +PGV VTY G+E+GM+    +  ++  DP      + D    +RDPERTP
Sbjct: 390 VDAMNMLLLTLPGVAVTYNGEELGMQDYDEISWEDTVDPPARIAGKLDYKKVSRDPERTP 449

Query: 299 MQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGA 358
            QW +  +AGFSTA KTWLPVNPNY  LN+EAQK+A  S YK+Y+ L +LR+   +  G 
Sbjct: 450 FQWSNATNAGFSTAAKTWLPVNPNYLVLNLEAQKQAVKSHYKVYKSLIELRKLPVLRRGR 509

Query: 359 VSTHILN 365
            S   L+
Sbjct: 510 FSIEPLS 516

Drosophila virilis (taxid: 7244)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 0
>sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 Back     alignment and function description
>sp|P13080|MALT_AEDAE Probable maltase OS=Aedes aegypti GN=MAL1 PE=2 SV=1 Back     alignment and function description
>sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 Back     alignment and function description
>sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 Back     alignment and function description
>sp|P07191|MAL1_DROME Probable maltase D OS=Drosophila melanogaster GN=LvpD PE=2 SV=2 Back     alignment and function description
>sp|P07190|MAL2_DROME Probable maltase H OS=Drosophila melanogaster GN=LvpH PE=2 SV=2 Back     alignment and function description
>sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 Back     alignment and function description
>sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 Back     alignment and function description
>sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
328719875624 PREDICTED: probable maltase L-like [Acyr 0.608 0.552 0.425 2e-83
193709215621 PREDICTED: probable maltase H [Acyrthosi 0.627 0.573 0.433 1e-82
380015004572 PREDICTED: maltase 2-like [Apis florea] 0.627 0.622 0.446 5e-82
307177501 1796 Maltase 1 [Camponotus floridanus] 0.932 0.294 0.337 2e-80
307210528560 Alpha-glucosidase [Harpegnathos saltator 0.619 0.626 0.427 5e-80
347365176637 sucrase [Nilaparvata lugens] 0.624 0.555 0.411 6e-80
345493688559 PREDICTED: alpha-glucosidase-like [Nason 0.617 0.626 0.431 9e-80
170055686604 maltase 1 [Culex quinquefasciatus] gi|16 0.636 0.597 0.416 6e-79
224808528579 alpha-glucosidase isozyme II [Apis ceran 0.620 0.607 0.436 8e-79
94400901580 alpha-glucosidase precursor [Apis mellif 0.620 0.606 0.431 1e-78
>gi|328719875|ref|XP_003246887.1| PREDICTED: probable maltase L-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  316 bits (809), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/364 (42%), Positives = 231/364 (63%), Gaps = 19/364 (5%)

Query: 10  YDEYYVWKEGKGVN--------KTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDL 61
           Y +YY+W+     +        +  PPNNW+SVF GS WT+++ R+ FY HQF++KQPD 
Sbjct: 150 YADYYIWRNASNQDDILKNSTIEPTPPNNWLSVFGGSGWTWNDERQQFYYHQFNSKQPDF 209

Query: 62  NFRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGK-EGSMNYDDLI 120
             R+ ++ + + A+++FW+D+GI G+R DAL+H++E+  F DE     + E  +N+D L 
Sbjct: 210 KIRNPEIHKEIFAIIKFWMDRGIVGFRFDALRHLYESDSFLDEPCLTTEAECKVNHDSLN 269

Query: 121 HDKTTDLPELYEILVKWRALVDEYKQKTGH--TRILIVESYTDIENTMKYFKYNGRPAAH 178
           H  T D PE  EI+ +WR  VD Y +      +  +  ESY+ I+  M+Y+  + +  AH
Sbjct: 270 HTYTVDQPENIEIIREWREFVDNYTKNNDRPISSFIATESYSPIKVLMQYYGNSTKAGAH 329

Query: 179 YPFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRL 238
            PFNF L L  DK  R ++  ++  +K     ++ DN+P    +NWV +NHDNPR+  + 
Sbjct: 330 LPFNFGL-LTVDK--RNIIESIDTNIK-----KWLDNMPENQVANWVVENHDNPRMPTKF 381

Query: 239 GKELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTP 298
             E+   +  + L +PG+ VTYYG EIGM+   VR D+ +DPNNAGG R +E+RD ER P
Sbjct: 382 SPEMVPLFTALKLSLPGIEVTYYGSEIGMDNTYVRPDQSQDPNNAGGNRLEESRDNERCP 441

Query: 299 MQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGA 358
           MQWDS+ +AGF+ A+K WLP+NPNYY +NVE+QKK   S Y  Y+K+S LR+TDT+  G 
Sbjct: 442 MQWDSSINAGFTEAKKPWLPINPNYYKVNVESQKKIPTSNYNFYKKMSLLRKTDTLKNGD 501

Query: 359 VSTH 362
           + T+
Sbjct: 502 LQTY 505

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193709215|ref|XP_001943317.1| PREDICTED: probable maltase H [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380015004|ref|XP_003691502.1| PREDICTED: maltase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|307177501|gb|EFN66615.1| Maltase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307210528|gb|EFN87018.1| Alpha-glucosidase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|347365176|gb|AEO89448.1| sucrase [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|345493688|ref|XP_001604662.2| PREDICTED: alpha-glucosidase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170055686|ref|XP_001863692.1| maltase 1 [Culex quinquefasciatus] gi|167875567|gb|EDS38950.1| maltase 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|224808528|gb|ACN63343.1| alpha-glucosidase isozyme II [Apis cerana japonica] Back     alignment and taxonomy information
>gi|94400901|ref|NP_001035349.1| alpha-glucosidase precursor [Apis mellifera] gi|89885577|dbj|BAE86927.1| alpha-glucosidase [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
FB|FBgn0032382583 Mal-B2 "Maltase B2" [Drosophil 0.631 0.614 0.426 8.4e-74
FB|FBgn0050360601 Mal-A6 "Maltase A6" [Drosophil 0.633 0.597 0.378 1.5e-67
FB|FBgn0032381584 Mal-B1 "Maltase B1" [Drosophil 0.615 0.597 0.392 1.9e-67
FB|FBgn0002571574 Mal-A3 "Maltase A3" [Drosophil 0.647 0.639 0.397 2.4e-67
FB|FBgn0050359630 Mal-A5 "Maltase A5" [Drosophil 0.629 0.566 0.385 5.8e-66
FB|FBgn0033296599 Mal-A7 "Maltase A7" [Drosophil 0.627 0.594 0.386 5.2e-65
ZFIN|ZDB-GENE-090313-225674 slc3a1 "solute carrier family 0.582 0.489 0.402 1.2e-63
FB|FBgn0033297588 Mal-A8 "Maltase A8" [Drosophil 0.641 0.619 0.363 2.6e-63
FB|FBgn0033294579 Mal-A4 "Maltase A4" [Drosophil 0.640 0.626 0.365 4.2e-63
FB|FBgn0002569567 Mal-A2 "Maltase A2" [Drosophil 0.578 0.578 0.371 3.4e-61
FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 745 (267.3 bits), Expect = 8.4e-74, P = 8.4e-74
 Identities = 160/375 (42%), Positives = 225/375 (60%)

Query:    10 YDEYYVWKEG-KGVNKTE-PPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKK 67
             Y+++YVW +G    N T  PPNNW SVF GSAW + E R+ +YLHQF+ +QPDLN+R+ K
Sbjct:   150 YEDFYVWHDGIVQENGTRVPPNNWPSVFYGSAWEWHEGREQYYLHQFTKEQPDLNYRNPK 209

Query:    68 LQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDL 127
             + +AM+ VL FWL+KG+ G+RIDA+ H+FE    KDE        S++YD   H  + DL
Sbjct:   210 VVQAMDDVLLFWLNKGVAGFRIDAVNHLFEDESLKDEPLSGKTTDSLSYDYTKHIYSRDL 269

Query:   128 PELYEILVKWRALVDEYKQKTGH--TRILIVESYTDIENTMKYFK-YNGRPAAHYPFNFQ 184
             PE+ E++  WR L+D++  K     TRI++ E+Y  +     Y++  NG   +H PFNF 
Sbjct:   270 PEVLEMIHHWRQLLDDFSAKHPERPTRIMMTEAYAGLTQLADYYEDSNGVRGSHLPFNFH 329

Query:   185 LVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELAD 244
              + D  KG+         Y  V +  ++   +P    +NWV  NHDNPRV +R G    D
Sbjct:   330 FITDV-KGDSDA----RDY--VYNVEKWLIYMPRGHAANWVMGNHDNPRVASRFGPASVD 382

Query:   245 AYLMISLLMPGVGVTYYGDEIGM-EGPLVRNDERRDP--NNAGGARADE-TRDPERTPMQ 300
             A  M+ L +PGV VTY G+E+GM +   +  +E  DP   N G     E +RDP RTP Q
Sbjct:   383 AMNMLLLTLPGVAVTYNGEELGMVDYRELSWEETVDPPARNVGEKLYQEVSRDPVRTPFQ 442

Query:   301 WDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIYGAVS 360
             W++  +AGFSTA KTWLPV+PNY  LN+EAQK A+ S Y++Y+ L +LR++  M  G  +
Sbjct:   443 WNNETNAGFSTAAKTWLPVHPNYLELNLEAQKVANRSHYQVYKDLLELRKSAIMRVGRFN 502

Query:   361 THILNGEWVLGLSRA 375
                L   WV    R+
Sbjct:   503 IEPLT-RWVFAFKRS 516
GO:0004558 "alpha-glucosidase activity" evidence=ISS
GO:0043169 "cation binding" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
FB|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050359 Mal-A5 "Maltase A5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-225 slc3a1 "solute carrier family 3, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002569 Mal-A2 "Maltase A2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O06994O16G1_BACSU3, ., 2, ., 1, ., 1, 00.31900.64720.6541yesN/A
P29094O16G_BACTR3, ., 2, ., 1, ., 1, 00.31820.61190.6174yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-155
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 1e-123
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 3e-99
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 2e-79
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-55
TIGR02403543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 1e-53
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 2e-53
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 3e-51
cd11329477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 9e-46
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 1e-45
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 8e-42
COG0366505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 2e-41
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 7e-41
PRK10933551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 3e-40
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 3e-39
TIGR02456539 TIGR02456, treS_nterm, trehalose synthase 9e-37
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 6e-32
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 1e-28
TIGR02403543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 7e-25
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 3e-20
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 3e-20
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 7e-18
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 6e-17
PRK10933551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 7e-16
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 1e-15
COG0366505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 3e-15
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 2e-12
TIGR02456539 TIGR02456, treS_nterm, trehalose synthase 1e-11
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 3e-10
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 3e-10
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 2e-09
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 1e-07
cd11343445 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a 2e-07
cd11356458 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha 5e-06
cd11340407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 5e-05
cd11340407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 5e-05
cd11337328 cd11337, AmyAc_CMD_like, Alpha amylase catalytic d 1e-04
cd11337328 cd11337, AmyAc_CMD_like, Alpha amylase catalytic d 1e-04
PRK10785598 PRK10785, PRK10785, maltodextrin glucosidase; Prov 2e-04
cd11320389 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase 4e-04
PRK10785598 PRK10785, PRK10785, maltodextrin glucosidase; Prov 5e-04
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 7e-04
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 0.001
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 0.002
cd11339344 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal 0.002
cd11339344 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal 0.002
PRK10785598 PRK10785, PRK10785, maltodextrin glucosidase; Prov 0.003
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information 
 Score =  453 bits (1168), Expect = e-155
 Identities = 177/361 (49%), Positives = 241/361 (66%), Gaps = 16/361 (4%)

Query: 5   AGIAPYDEYYVWKEGKGVN--KTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLN 62
               PY +YYVW +GK  +     PPNNW+SVF GSAWT++E R+ +YLHQF+ KQPDLN
Sbjct: 115 KRDEPYKDYYVWHDGKNNDNGTRVPPNNWLSVFGGSAWTWNEERQQYYLHQFAVKQPDLN 174

Query: 63  FRSKKLQEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGS--MNYDDLI 120
           +R+ K+ E M+ VLRFWLDKG+DG+RIDA+ H+FE  DF DE     + G+   +YD L 
Sbjct: 175 YRNPKVVEEMKNVLRFWLDKGVDGFRIDAVPHLFEDEDFLDE-PYSDEPGADPDDYDYLD 233

Query: 121 HDKTTDLPELYEILVKWRALVDEY-KQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHY 179
           H  T D PE Y+++ +WR ++DEY K+  G TR+++ E+Y+ ++NTMKY+       AH+
Sbjct: 234 HIYTKDQPETYDLVYEWREVLDEYAKENNGDTRVMMTEAYSSLDNTMKYYGNETTYGAHF 293

Query: 180 PFNFQLVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLG 239
           PFNF+L+ + +K   A              +++ DN+P   T+NWV  NHDNPRV +R G
Sbjct: 294 PFNFELITNLNKNSNATDF-------KDLIDKWLDNMPEGQTANWVLGNHDNPRVASRFG 346

Query: 240 KELADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDERRDPN--NAGGAR-ADETRDPER 296
           +E  D   M+S+L+PGV VTYYG+EIGME   +  ++  DP   NAG       +RDP R
Sbjct: 347 EERVDGMNMLSMLLPGVAVTYYGEEIGMEDTTISWEDTVDPPACNAGPENYEAYSRDPAR 406

Query: 297 TPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTDTMIY 356
           TP QWD +K+AGFSTA KTWLPVNPNY  LN+EAQKK   S Y +Y+KL+QLR++ T + 
Sbjct: 407 TPFQWDDSKNAGFSTANKTWLPVNPNYKTLNLEAQKKDPRSHYNIYKKLAQLRKSPTFLR 466

Query: 357 G 357
           G
Sbjct: 467 G 467

Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) Back     alignment and domain information
>gnl|CDD|200493 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins Back     alignment and domain information
>gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 567
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 100.0
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 100.0
PRK13840495 sucrose phosphorylase; Provisional 100.0
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 100.0
KOG0471|consensus545 100.0
PRK10785598 maltodextrin glucosidase; Provisional 100.0
PRK09505683 malS alpha-amylase; Reviewed 100.0
TIGR02455688 TreS_stutzeri trehalose synthase, Pseudomonas stut 100.0
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 100.0
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.97
PRK09441479 cytoplasmic alpha-amylase; Reviewed 99.97
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 99.97
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 99.97
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 99.96
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 99.95
PLN00196428 alpha-amylase; Provisional 99.94
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 99.93
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 99.93
PRK12313633 glycogen branching enzyme; Provisional 99.93
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 99.92
PRK05402726 glycogen branching enzyme; Provisional 99.92
PRK14706639 glycogen branching enzyme; Provisional 99.92
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 99.92
PLN02361401 alpha-amylase 99.92
PRK03705658 glycogen debranching enzyme; Provisional 99.91
PRK12568730 glycogen branching enzyme; Provisional 99.9
PRK147051224 glycogen branching enzyme; Provisional 99.87
PRK10785598 maltodextrin glucosidase; Provisional 99.86
PLN02960897 alpha-amylase 99.83
TIGR021021111 pullulan_Gpos pullulanase, extracellular, Gram-pos 99.82
PLN02784894 alpha-amylase 99.82
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 99.82
TIGR02401825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.78
PRK09505683 malS alpha-amylase; Reviewed 99.77
PLN02877970 alpha-amylase/limit dextrinase 99.77
PLN02447758 1,4-alpha-glucan-branching enzyme 99.77
PLN03244872 alpha-amylase; Provisional 99.75
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 99.72
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 99.72
KOG0471|consensus545 99.57
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 99.55
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 99.54
PRK12313633 glycogen branching enzyme; Provisional 99.53
PRK05402726 glycogen branching enzyme; Provisional 99.52
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 99.52
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 99.51
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 99.5
PRK09441479 cytoplasmic alpha-amylase; Reviewed 99.46
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 99.45
PRK14706639 glycogen branching enzyme; Provisional 99.42
PRK03705658 glycogen debranching enzyme; Provisional 99.33
PRK14511879 maltooligosyl trehalose synthase; Provisional 99.26
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 99.21
TIGR02401825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.2
PLN00196428 alpha-amylase; Provisional 99.14
KOG2212|consensus504 99.1
PRK12568730 glycogen branching enzyme; Provisional 99.09
PRK147051224 glycogen branching enzyme; Provisional 99.02
PLN02960897 alpha-amylase 98.97
PRK14511879 maltooligosyl trehalose synthase; Provisional 98.94
KOG0470|consensus757 98.87
PLN02361401 alpha-amylase 98.86
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 98.84
TIGR02455688 TreS_stutzeri trehalose synthase, Pseudomonas stut 98.67
PF1194189 DUF3459: Domain of unknown function (DUF3459); Int 98.58
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 98.56
PLN03244872 alpha-amylase; Provisional 98.36
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 98.17
PLN02447758 1,4-alpha-glucan-branching enzyme 98.15
PRK13840495 sucrose phosphorylase; Provisional 98.05
PF02324 809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 97.84
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 97.82
PLN02877970 alpha-amylase/limit dextrinase 97.35
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 97.31
PRK145071693 putative bifunctional 4-alpha-glucanotransferase/m 97.25
PLN02784894 alpha-amylase 97.2
PF14872811 GHL5: Hypothetical glycoside hydrolase 5 96.98
COG3280889 TreY Maltooligosyl trehalose synthase [Carbohydrat 96.33
PF1043878 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal 96.1
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 95.56
PF11852168 DUF3372: Domain of unknown function (DUF3372); Int 95.01
KOG0470|consensus757 94.86
PF1194189 DUF3459: Domain of unknown function (DUF3459); Int 94.43
KOG3625|consensus 1521 93.42
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 93.34
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 93.12
PF0280695 Alpha-amylase_C: Alpha amylase, C-terminal all-bet 90.63
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 89.57
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 85.84
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 85.8
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 84.97
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 84.27
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 83.29
PF0853358 Glyco_hydro_42C: Beta-galactosidase C-terminal dom 81.69
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-58  Score=493.07  Aligned_cols=350  Identities=29%  Similarity=0.514  Sum_probs=284.8

Q ss_pred             CCCCCCCCCCceEEeeeCCCCCCCCCCCCcccccCCCcceeeCCccceeeccCCCCCCccCCCCHHHHHHHHHHHHHHHh
Q psy15648          2 NTTAGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLD   81 (567)
Q Consensus         2 ~a~~~~~~~~d~y~w~~~~~~~~~~~p~~w~s~f~~~~w~~~~~~~~~y~~~f~~~~pdLN~~np~vr~~i~~~~~~Wl~   81 (567)
                      ++.++++||+|||+|+++.   ...+|++|.+.|++++|.|++.+++||+|.|.++|||||++||+||++|+++++||++
T Consensus       115 ~~~~~~~~y~d~y~~~~~~---~~~~~~~~~~~~~~~~w~~~~~~~~~y~~~f~~~~pdLn~~np~V~~~l~~~~~~W~~  191 (551)
T PRK10933        115 EALNKESPYRQFYIWRDGE---PETPPNNWRSKFGGSAWRWHAESEQYYLHLFAPEQADLNWENPAVRAELKKVCEFWAD  191 (551)
T ss_pred             hhcCCCCCCcCceEecCCC---CCCCCCcccccCCCccccccCCCCceEeecccccCCccCCCCHHHHHHHHHHHHHHHH
Confidence            3456789999999999754   2456889999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCeeEecccCccccCCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHhhhcCCceEEEEeccC-
Q psy15648         82 KGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYT-  160 (567)
Q Consensus        82 ~GVDGfRlD~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~~~~~~~~~~~~~~~ligE~~~-  160 (567)
                      +||||||||+|+++.++..+++.+...           ...+..++++++++|+++++.+..     .+++++|||++. 
T Consensus       192 ~GvDGfRlDa~~~i~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~l~~~~~~~~~-----~~~~~~vgE~~~~  255 (551)
T PRK10933        192 RGVDGLRLDVVNLISKDQDFPDDLDGD-----------GRRFYTDGPRAHEFLQEMNRDVFT-----PRGLMTVGEMSST  255 (551)
T ss_pred             CCCcEEEEcchhhcCcCCCCCCCcccc-----------cccccCCChHHHHHHHHHHHHhhc-----ccCcEEEEeecCC
Confidence            999999999999998887777543211           112335678999999999875422     346899999997 


Q ss_pred             CHHHHhhhhccCCCCCCCcccccccccC--CCCC------cchHHHhhhhhhhHhHHHHHHHhCCCCCCceeeccCCCCC
Q psy15648        161 DIENTMKYFKYNGRPAAHYPFNFQLVLD--PDKG------ERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNP  232 (567)
Q Consensus       161 ~~~~~~~y~~~~~~~~~~~~~~~~~~~~--l~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fl~nHD~~  232 (567)
                      +.+.+..|... .+..+++.|+|.....  +...      .....+       ++.+..+...+....|+.+|++|||++
T Consensus       256 ~~~~~~~y~~~-~~~~~~~~fnf~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~fl~NHD~~  327 (551)
T PRK10933        256 SLEHCQRYAAL-TGSELSMTFNFHHLKVDYPNGEKWTLAKPDFVAL-------KTLFRHWQQGMHNVAWNALFWCNHDQP  327 (551)
T ss_pred             CHHHHHHhhcc-cCCeeeeEecHHHhhhhhccCCcccccccCHHHH-------HHHHHHHHHhhcccCeeccccCCCCcc
Confidence            44555565442 2356888888864321  1110      122344       677777877777778888999999999


Q ss_pred             cccccCCch------HHHHHHHHHHhCCCceeeeccccccCCCCC-CCCCcccCccccCCCC----------------CC
Q psy15648        233 RVTNRLGKE------LADAYLMISLLMPGVGVTYYGDEIGMEGPL-VRNDERRDPNNAGGAR----------------AD  289 (567)
Q Consensus       233 R~~~~~~~~------~~~~a~a~ll~~pG~P~iYyG~E~G~~~~~-~~~~~~~d~~~~~~~~----------------~~  289 (567)
                      |++++++++      .++++++++||+||+|+||||||+||.+.. .++++++|+...+.+.                ..
T Consensus       328 R~~sr~g~~~~~~~~~aklla~ll~tlpG~P~IYyGeEiGm~~~~~~~~~~~~D~~~~~~~~~~~~~g~~~~~~~~~~~~  407 (551)
T PRK10933        328 RIVSRFGDEGEYRVPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPHFTRITDYRDVESLNMFAELRNDGRDADELLAILAS  407 (551)
T ss_pred             cHHHHcCCchhHHHHHHHHHHHHHHhCCCceEEEeecccCCCCCCCCCHHHhcCHHHHHHHHHHhhcCCCHHHHHhhhhc
Confidence            999999854      368889999999999999999999999964 5667888887755421                23


Q ss_pred             CCCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCcccccHHHhhhCCCchHHHHHHHHhccccC-ccccCceEEeecCCCc
Q psy15648        290 ETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTD-TMIYGAVSTHILNGEW  368 (567)
Q Consensus       290 ~~~d~~r~pm~W~~~~~~gf~~~~~~w~~~~~~~~~~~v~~q~~d~~sl~~~~k~Li~lR~~~-al~~G~~~~~~~~~~~  368 (567)
                      .+||++|+||+|++..++|||++ +||+++..+|.++||++|..++.|++++||+||+||+++ +|+.|++..+...++.
T Consensus       408 ~~Rd~~RtPMqW~~~~~~GFs~~-~pwl~~~~~~~~inv~~Q~~~~~Sll~~yk~Li~lRk~~~aL~~G~~~~~~~~~~~  486 (551)
T PRK10933        408 KSRDNSRTPMQWDNGDNAGFTQG-EPWIGLCDNYQEINVEAALADEDSVFYTYQKLIALRKQEPVLTWGDYQDLLPNHPS  486 (551)
T ss_pred             cCCCCCccccccCCCCCCCCCCC-CCCCCCCcccccccHHHHhcCcccHHHHHHHHHHHhhcChhhccceeEEeccCCCc
Confidence            57999999999999999999998 799999999999999999999999999999999999998 9999999977654568


Q ss_pred             EEEEeccccch
Q psy15648        369 VLGLSRAANML  379 (567)
Q Consensus       369 v~~f~R~~~~~  379 (567)
                      |++|.|..+++
T Consensus       487 v~af~R~~~~~  497 (551)
T PRK10933        487 LWCYRREWQGQ  497 (551)
T ss_pred             EEEEEEEcCCc
Confidence            99999987653

>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>PF11941 DUF3459: Domain of unknown function (DUF3459); InterPro: IPR022567 This functionally uncharacterised domain is found in bacteria Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10438 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal domain; InterPro: IPR019492 This domain is at the very C terminus of cyclo-malto-dextrinase proteins and consists of 8 beta strands, is largely globular and appears to help stabilise the active sites created by upstream domains, IPR015171 from INTERPRO, and IPR006047 from INTERPRO Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PF11852 DUF3372: Domain of unknown function (DUF3372); InterPro: IPR024561 This entry represents the uncharacterised C-terminal domain of secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PF11941 DUF3459: Domain of unknown function (DUF3459); InterPro: IPR022567 This functionally uncharacterised domain is found in bacteria Back     alignment and domain information
>KOG3625|consensus Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF02806 Alpha-amylase_C: Alpha amylase, C-terminal all-beta domain; InterPro: IPR006048 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF08533 Glyco_hydro_42C: Beta-galactosidase C-terminal domain; InterPro: IPR013739 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
1uok_A558 Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas 1e-37
1uok_A558 Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas 8e-16
2ze0_A555 Alpha-glucosidase Gsj Length = 555 9e-37
2ze0_A555 Alpha-glucosidase Gsj Length = 555 2e-15
3gbd_A558 Crystal Structure Of The Isomaltulose Synthase Smua 2e-34
3gbd_A558 Crystal Structure Of The Isomaltulose Synthase Smua 6e-16
2zid_A543 Crystal Structure Of Dextran Glucosidase E236q Comp 1e-33
2zid_A543 Crystal Structure Of Dextran Glucosidase E236q Comp 1e-18
2zic_A543 Crystal Structure Of Streptococcus Mutans Dextran G 1e-33
2zic_A543 Crystal Structure Of Streptococcus Mutans Dextran G 1e-18
1m53_A570 Crystal Structure Of Isomaltulose Synthase (Pali) F 1e-33
1m53_A570 Crystal Structure Of Isomaltulose Synthase (Pali) F 4e-15
4gin_A584 Crystal Structure Of The Mutb R284c Mutant From Cry 3e-32
4gin_A584 Crystal Structure Of The Mutb R284c Mutant From Cry 4e-14
2pwg_A556 Crystal Structure Of The Trehalulose Synthase Mutb 4e-32
2pwg_A556 Crystal Structure Of The Trehalulose Synthase Mutb 4e-14
4h2c_A557 Trehalulose Synthase Mutb R284c Mutant Length = 557 4e-32
4h2c_A557 Trehalulose Synthase Mutb R284c Mutant Length = 557 4e-14
1zja_A557 Crystal Structure Of The Trehalulose Synthase Mutb 4e-32
1zja_A557 Crystal Structure Of The Trehalulose Synthase Mutb 4e-14
2pwe_A556 Crystal Structure Of The Mutb E254q Mutant In Compl 7e-32
2pwe_A556 Crystal Structure Of The Mutb E254q Mutant In Compl 4e-14
4gi6_A557 Crystal Structure Of The Mutb F164l Mutant In Compl 2e-31
4gi6_A557 Crystal Structure Of The Mutb F164l Mutant In Compl 4e-14
2pwf_A556 Crystal Structure Of The Mutb D200a Mutant In Compl 3e-31
2pwf_A556 Crystal Structure Of The Mutb D200a Mutant In Compl 4e-14
4aie_A549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 4e-31
4aie_A549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 1e-12
3axh_A589 Crystal Structure Of Isomaltase In Complex With Iso 2e-20
3a47_A589 Crystal Structure Of Isomaltase From Saccharomyces 4e-20
3a47_A589 Crystal Structure Of Isomaltase From Saccharomyces 9e-04
1wza_A488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 3e-13
1wza_A488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 2e-05
1lwh_A441 Crystal Structure Of T. Maritima 4-Alpha-Glucanotra 1e-06
3k8l_A669 Crystal Structure Of Susg-D498n Mutant With Maltohe 3e-06
3k8k_A669 Crystal Structure Of Susg Length = 669 1e-05
1wzk_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 3e-04
1jf6_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 3e-04
1jf5_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 3e-04
1wzm_A585 Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (t 4e-04
1bvz_A585 Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vul 4e-04
1a47_A683 Cgtase From Thermoanaerobacterium Thermosulfurigene 4e-04
3bmv_A683 Cyclodextrin Glycosyl Transferase From Thermoanerob 4e-04
1wzl_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 4e-04
4aee_A696 Crystal Structure Of Maltogenic Amylase From S.Mari 8e-04
4aee_A696 Crystal Structure Of Maltogenic Amylase From S.Mari 8e-04
>pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/420 (28%), Positives = 200/420 (47%), Gaps = 61/420 (14%)
Query: 10  YDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQ 69
           Y +YY+W+ GK   + + PNNW + FSGSAW YDE    +YLH FS KQPDLN+ ++K++
Sbjct: 122 YRDYYIWRPGK---EGKEPNNWGAAFSGSAWQYDEMTDEYYLHLFSKKQPDLNWDNEKVR 178
Query: 70  EAMEAVLRFWLDKGIDGWRIDALKHMF-EAG----DFKDEKYKPGKEGSMNYDDL---IH 121
           + +  +++FWL+KGIDG+R+D +  +  E G    + ++E Y  G +  MN  ++   +H
Sbjct: 179 QDVYEMMKFWLEKGIDGFRMDVINFISKEEGLPTVETEEEGYVSGHKHFMNGPNIHKYLH 238
Query: 122 DKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPF 181
           +   ++   Y+I+              G    +  E         K +    R      F
Sbjct: 239 EMNEEVLSHYDIMT------------VGEMPGVTTEE-------AKLYTGEERKELQMVF 279
Query: 182 NFQ-LVLDPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGK 240
            F+ + LD  +G +  V   +     ++  +++  L   G ++  ++NHD PRV +R G 
Sbjct: 280 QFEHMDLDSGEGGKWDVKPCSLLTLKENLTKWQKALEHTGWNSLYWNNHDQPRVVSRFGN 339
Query: 241 E----LADAYLMISLL--MPGVGVTYYGDEIGMEGPLVRN-DERRDPNNAGGARAD---- 289
           +    +  A ++ ++L  M G    Y G+EIGM      + DE RD       +      
Sbjct: 340 DGMYRIESAKMLATVLHMMKGTPYIYQGEEIGMTNVRFESIDEYRDIETLNMYKEKVMER 399
Query: 290 -------------ETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADW 336
                        + RD  RTPMQWD   HAGF+T  + W+ VNPNY  +NV+   +   
Sbjct: 400 GEDIEKVMQSIYIKGRDNARTPMQWDDQNHAGFTTG-EPWITVNPNYKEINVKQAIQNKD 458
Query: 337 STYKLYRKLSQLRR-TDTMIYGAVSTHILNGEWVLGLSRAAN----MLLTEMKRERAKFE 391
           S +  Y+KL +LR+  + ++YG+    + N   +    R       +++     E   FE
Sbjct: 459 SIFYYYKKLIELRKNNEIVVYGSYDLILENNPSIFAYVRTYGVEKLLVIANFTAEECIFE 518
>pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 Back     alignment and structure
>pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 Back     alignment and structure
>pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 Back     alignment and structure
>pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 Back     alignment and structure
>pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 Back     alignment and structure
>pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 Back     alignment and structure
>pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 Back     alignment and structure
>pdb|1WZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt D465n Length = 585 Back     alignment and structure
>pdb|1JF6|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase Mutant F286y Length = 585 Back     alignment and structure
>pdb|1JF5|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2 Mutant F286a Length = 585 Back     alignment and structure
>pdb|1WZM|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (tva Ii) Mutatnt R469k Length = 585 Back     alignment and structure
>pdb|1BVZ|A Chain A, Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R- 47 Length = 585 Back     alignment and structure
>pdb|1A47|A Chain A, Cgtase From Thermoanaerobacterium Thermosulfurigenes Em1 In Complex With A Maltohexaose Inhibitor Length = 683 Back     alignment and structure
>pdb|3BMV|A Chain A, Cyclodextrin Glycosyl Transferase From Thermoanerobacterium Thermosulfurigenes Em1 Mutant S77p Length = 683 Back     alignment and structure
>pdb|1WZL|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt R469l Length = 585 Back     alignment and structure
>pdb|4AEE|A Chain A, Crystal Structure Of Maltogenic Amylase From S.Marinus Length = 696 Back     alignment and structure
>pdb|4AEE|A Chain A, Crystal Structure Of Maltogenic Amylase From S.Marinus Length = 696 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 1e-90
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 6e-37
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 1e-87
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 2e-39
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 3e-78
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 1e-31
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 6e-78
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 2e-31
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 4e-77
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 5e-31
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 2e-76
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 8e-31
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 5e-72
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 3e-31
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 4e-71
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 2e-25
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 1e-66
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 4e-32
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 4e-19
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 1e-39
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 6e-29
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 3e-04
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 9e-33
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 2e-04
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 9e-33
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1e-05
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 1e-27
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 9e-06
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 5e-26
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 3e-14
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 2e-23
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 6e-04
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 3e-23
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 4e-13
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 6e-21
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 8e-06
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 6e-21
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 7e-05
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 1e-20
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 8e-15
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 4e-19
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 3e-13
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 8e-19
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 2e-13
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 9e-19
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 8e-12
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 8e-18
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 3e-11
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 1e-17
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 1e-13
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 1e-17
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 2e-13
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 4e-17
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 2e-10
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 4e-17
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 3e-13
3hje_A704 704AA long hypothetical glycosyltransferase; treha 4e-17
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 6e-17
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 1e-04
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 1e-16
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 8e-11
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 2e-16
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 3e-10
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 5e-16
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 1e-10
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 9e-16
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 1e-07
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 5e-15
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 7e-15
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 7e-04
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 3e-11
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 7e-08
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 5e-06
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 3e-11
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 1e-07
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 2e-06
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 2e-10
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 5e-08
1iv8_A720 Maltooligosyl trehalose synthase; beta alpha barre 2e-07
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 1e-05
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 3e-05
1hx0_A496 Alpha amylase (PPA); inhibitor, carbohydrate, panc 3e-04
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 5e-04
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
 Score =  286 bits (734), Expect = 1e-90
 Identities = 75/353 (21%), Positives = 120/353 (33%), Gaps = 70/353 (19%)

Query: 9   PYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKL 68
            Y +YYVW                 +  G  W Y       Y   F +  PDLN+ + ++
Sbjct: 124 EYRDYYVWAGPD------TDTKETKLDGGRVWHYSPTG--MYYGYFWSGMPDLNYNNPEV 175

Query: 69  QEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLP 128
           QE +  + ++WL +G+DG+R+D   H+     F                           
Sbjct: 176 QEKVIGIAKYWLKQGVDGFRLDGAMHI-----FPPA---------------------QYD 209

Query: 129 ELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLV-L 187
           + +    K+R  ++E K        L+ E +   E    YF    +      FNF+L   
Sbjct: 210 KNFTWWEKFRQEIEEVKP-----VYLVGEVWDISETVAPYF----KYGFDSTFNFKLAEA 260

Query: 188 DPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLGKELADAYL 247
                +       N   K       ++             NHD  R+ ++LG++   A +
Sbjct: 261 VIATAKAGFPFGFNKKAKHIYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKARV 320

Query: 248 MISLL--MPGVGVTYYGDEIGMEGPLVRNDERRDPNNAGGARADETRDPERTPMQWDSTK 305
             S+   +PG    YYG+EIGM                G        +  R P QW +  
Sbjct: 321 AASIYLTLPGNPFIYYGEEIGMR-------------GQGP------HEVIREPFQWYNGS 361

Query: 306 HAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRT-DTMIYG 357
             G +     W P   N  + +VE ++K   S    YR+L   R        G
Sbjct: 362 GEGET----YWEPAMYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFYTG 410
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Length = 471 Back     alignment and structure
>1hx0_A Alpha amylase (PPA); inhibitor, carbohydrate, pancreas, hydrolase; HET: GLC AC1 BGC MAL; 1.38A {Sus scrofa} SCOP: b.71.1.1 c.1.8.1 PDB: 1wo2_A* 1ua3_A* 1kxq_A 1kxt_A 1kxv_A 1jfh_A* 1vah_A* 1ppi_A* 3l2m_A* 3l2l_A* 1dhk_A* 1ose_A* 1pig_A* 1pif_A* 1bvn_P 3oli_A* 3old_A* 3olg_A* 3ole_A* 3ij8_A* ... Length = 496 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 100.0
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 100.0
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.97
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.97
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.97
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.97
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.97
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 99.97
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.97
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.96
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.96
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.96
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 99.96
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.96
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.95
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.95
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 99.95
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 99.95
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.95
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 99.95
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 99.95
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 99.95
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 99.94
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.94
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.94
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 99.94
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.94
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 99.94
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.94
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 99.94
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 99.93
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.93
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 99.93
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.93
3aml_A755 OS06G0726400 protein; starch-branching, transferas 99.91
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 99.91
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 99.91
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.91
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 99.9
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 99.9
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 99.89
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 99.88
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.88
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 99.86
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 99.85
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.83
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.82
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 99.8
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 99.8
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 99.8
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 99.79
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 99.78
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 99.78
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 99.77
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 99.77
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 99.76
1iv8_A720 Maltooligosyl trehalose synthase; beta alpha barre 99.75
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.75
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 99.75
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 99.74
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.71
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.69
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 99.68
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 99.68
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 99.68
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.68
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.68
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.68
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 99.66
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.66
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 99.63
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.62
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 99.62
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 99.61
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.61
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 99.57
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.56
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.54
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 99.49
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.49
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.49
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.47
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 99.46
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.45
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.42
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.41
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 99.4
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.39
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.38
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.37
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 99.37
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.3
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 99.3
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.28
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 99.27
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.18
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 99.17
3hje_A704 704AA long hypothetical glycosyltransferase; treha 99.02
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 98.9
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 98.78
3klk_A 1039 Glucansucrase; native form, open conformation, mul 98.66
1iv8_A720 Maltooligosyl trehalose synthase; beta alpha barre 98.05
3hje_A704 704AA long hypothetical glycosyltransferase; treha 97.71
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 94.04
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 91.33
2aam_A309 Hypothetical protein TM1410; structural genomics, 87.6
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 82.87
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 82.86
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
Probab=100.00  E-value=6e-56  Score=480.58  Aligned_cols=351  Identities=31%  Similarity=0.547  Sum_probs=286.9

Q ss_pred             CCCCCCCceEEeeeCCCCCCCCCCCCcccccCCCcceeeCCccceeeccCCCCCCccCCCCHHHHHHHHHHHHHHHhCCC
Q psy15648          5 AGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGI   84 (567)
Q Consensus         5 ~~~~~~~d~y~w~~~~~~~~~~~p~~w~s~f~~~~w~~~~~~~~~y~~~f~~~~pdLN~~np~vr~~i~~~~~~Wl~~GV   84 (567)
                      .+++||+|||+|+++.   .+.||++|.+.|++++|+|++.+++||+|.|.++|||||++||+||++|+++++||+++||
T Consensus       117 ~~~~~y~d~y~~~~~~---~g~~p~~~~~~f~~~~w~~~~~~~~~y~~~f~~~~pdLn~~np~Vr~~i~~~~~~W~~~gv  193 (558)
T 1uok_A          117 SKDNKYRDYYIWRPGK---EGKEPNNWGAAFSGSAWQYDEMTDEYYLHLFSKKQPDLNWDNEKVRQDVYEMMKFWLEKGI  193 (558)
T ss_dssp             CTTCTTGGGBCEECCS---SSSCSSCBBCTTSSBSEEEETTTTEEEECSSCTTSCBBCTTSHHHHHHHHHHHHHHHHTTC
T ss_pred             CCCCCcccceEeccCc---CCCCCccccccCCCccccccCCcCcEEeeccccccccccCCCHHHHHHHHHHHHHHHHcCC
Confidence            5689999999999864   2457899999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEecccCccccCCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHhhhcCCceEEEEeccC-CHH
Q psy15648         85 DGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYT-DIE  163 (567)
Q Consensus        85 DGfRlD~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~~~~~~~~~~~~~~~ligE~~~-~~~  163 (567)
                      ||||||+|++|.++..+++.+..     ...++... .++.++++++++++++++.+..     .+++++|||+|. ++.
T Consensus       194 DGfRlDa~~~i~~~~~~~~~~~~-----~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~-----~~~~~~vgE~~~~~~~  262 (558)
T 1uok_A          194 DGFRMDVINFISKEEGLPTVETE-----EEGYVSGH-KHFMNGPNIHKYLHEMNEEVLS-----HYDIMTVGEMPGVTTE  262 (558)
T ss_dssp             CEEEETTGGGSCCCTTCCCCCCC-----CSSCBCCG-GGTTTCTTHHHHHHHHHHHTGG-----GSCCEEEEECTTCCHH
T ss_pred             CEEEEccccccccccccCCCCCc-----cccccccc-ccccCChHHHHHHHHHHHHhhc-----cCCeEEEEeccCCCHH
Confidence            99999999999887667655431     01111111 2356788999999999885533     247999999995 566


Q ss_pred             HHhhhhccCCCCCCCcccccccccCC--C------CCcchHHHhhhhhhhHhHHHHHHHhCCCCCCceeeccCCCCCccc
Q psy15648        164 NTMKYFKYNGRPAAHYPFNFQLVLDP--D------KGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVT  235 (567)
Q Consensus       164 ~~~~y~~~~~~~~~~~~~~~~~~~~l--~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fl~nHD~~R~~  235 (567)
                      ....|.+. ++.+++++|+|.+...-  .      ...+...+       +..+..+...++...+..+|++|||++|++
T Consensus       263 ~~~~y~~~-~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~l-------~~~l~~~~~~~~~~~~~~~fl~NHD~~R~~  334 (558)
T 1uok_A          263 EAKLYTGE-ERKELQMVFQFEHMDLDSGEGGKWDVKPCSLLTL-------KENLTKWQKALEHTGWNSLYWNNHDQPRVV  334 (558)
T ss_dssp             HHHHHHCG-GGCSCSCEECCGGGSTTEETTEEEEECCCCHHHH-------HHHHHHHHHHTSSSSCCEECSCCTTSCCHH
T ss_pred             HHHHHhcc-CCCccceEEehhhhhcccccccccccCCCCHHHH-------HHHHHHHHHhcccCCccceeecCCCccchh
Confidence            67777753 23578999998875310  0      12234566       677777777776667888899999999999


Q ss_pred             ccCCch------HHHHHHHHHHhCCCceeeeccccccCCCCC-CCCCcccCccccCCCC-----------------CCCC
Q psy15648        236 NRLGKE------LADAYLMISLLMPGVGVTYYGDEIGMEGPL-VRNDERRDPNNAGGAR-----------------ADET  291 (567)
Q Consensus       236 ~~~~~~------~~~~a~a~ll~~pG~P~iYyG~E~G~~~~~-~~~~~~~d~~~~~~~~-----------------~~~~  291 (567)
                      ++++.+      +++++++++||+||+|+||||||+||++.. .+++++.||...+.+.                 ...+
T Consensus       335 ~~~g~~~~~~~~~~k~~~~~llt~pG~P~iy~G~E~G~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~~~~~~~~~~~~~s  414 (558)
T 1uok_A          335 SRFGNDGMYRIESAKMLATVLHMMKGTPYIYQGEEIGMTNVRFESIDEYRDIETLNMYKEKVMERGEDIEKVMQSIYIKG  414 (558)
T ss_dssp             HHTSCSSTTHHHHHHHHHHHHHTSSSEEEEETTGGGTCCCCCCSSGGGCCCHHHHHHHHHHHHTSCCCHHHHHHHHHHHC
T ss_pred             hhcCCchhhhHHHHHHHHHHHHhCCCceEEEechhcCccCCCCCCHHhhcChhhhcchhhhhhhcCCcHHHhhhhhcccc
Confidence            998764      489999999999999999999999999975 4467788887543221                 1125


Q ss_pred             CCCCCCCcccCCCCCCCCCCCCCCCCCCCCCcccccHHHhhhCCCchHHHHHHHHhccccC-ccccCceEEeecCCCcEE
Q psy15648        292 RDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTD-TMIYGAVSTHILNGEWVL  370 (567)
Q Consensus       292 ~d~~r~pm~W~~~~~~gf~~~~~~w~~~~~~~~~~~v~~q~~d~~sl~~~~k~Li~lR~~~-al~~G~~~~~~~~~~~v~  370 (567)
                      ||.+|+||+|+...++||+++ +||++++.+|..+||++|..++.|++++||+||+||+++ +|+.|+++.+...++.|+
T Consensus       415 Rd~~R~pm~W~~~~~agFs~~-~pwl~~~~~~~~~nv~~q~~~~~s~~~~y~~Li~lRk~~~~l~~G~~~~~~~~~~~v~  493 (558)
T 1uok_A          415 RDNARTPMQWDDQNHAGFTTG-EPWITVNPNYKEINVKQAIQNKDSIFYYYKKLIELRKNNEIVVYGSYDLILENNPSIF  493 (558)
T ss_dssp             GGGGTSCCCCCSSTTTTSCSS-CCSSCCCGGGGTSSHHHHHHCTTSHHHHHHHHHHHHHHCHHHHHCEEEEESTTCSSEE
T ss_pred             CCCCcCCccCCCcCCCCCcCC-CCCCcCCccccccCHHHHhhccccHHHHHHHHHHHHccCccccccceEEeecCCCCEE
Confidence            889999999999999999987 899999999999999999999999999999999999998 999999998755467899


Q ss_pred             EEeccccc
Q psy15648        371 GLSRAANM  378 (567)
Q Consensus       371 ~f~R~~~~  378 (567)
                      +|.|..++
T Consensus       494 a~~R~~~~  501 (558)
T 1uok_A          494 AYVRTYGV  501 (558)
T ss_dssp             EEEEEETT
T ss_pred             EEEEEeCC
Confidence            99998754
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 567
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 7e-46
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 2e-24
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 5e-45
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 3e-23
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 1e-27
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 2e-10
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 6e-26
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 4e-16
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 8e-25
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 1e-17
d1iv8a2653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 4e-16
d1g5aa2554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 2e-14
d1g5aa2554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 8e-05
d1r7aa2434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 3e-14
d1r7aa2434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 1e-05
d2bhua3420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 2e-13
d2bhua3420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 1e-11
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 5e-13
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 9e-06
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 5e-13
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 1e-11
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 5e-12
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 5e-04
d2fhfa5563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 8e-12
d2fhfa5563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 8e-11
d1ji1a3432 c.1.8.1 (A:123-554) Maltogenic amylase, central do 4e-11
d1ji1a3432 c.1.8.1 (A:123-554) Maltogenic amylase, central do 2e-07
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 4e-11
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 2e-06
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 5e-11
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 4e-05
d1h3ga3422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 7e-11
d1h3ga3422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 8e-08
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 2e-10
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 7e-10
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 3e-06
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 3e-09
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 2e-05
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 4e-09
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 8e-06
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 1e-08
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 1e-04
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 2e-08
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 5e-08
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 7e-08
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 0.003
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 9e-08
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 1e-06
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 2e-07
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 1e-04
d1ea9c3382 c.1.8.1 (C:122-503) Maltogenic amylase, central do 2e-07
d1ea9c3382 c.1.8.1 (C:122-503) Maltogenic amylase, central do 1e-06
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 1e-06
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 4e-05
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 3e-06
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 3e-05
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 1e-05
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 1e-04
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Oligo-1,6, glucosidase
species: Bacillus cereus [TaxId: 1396]

 Score =  165 bits (419), Expect = 7e-46
 Identities = 102/374 (27%), Positives = 172/374 (45%), Gaps = 41/374 (10%)

Query: 9   PYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKL 68
            Y +YY+W+      + + PNNW + FSGSAW YDE    +YLH FS KQPDLN+ ++K+
Sbjct: 121 KYRDYYIWRP---GKEGKEPNNWGAAFSGSAWQYDEMTDEYYLHLFSKKQPDLNWDNEKV 177

Query: 69  QEAMEAVLRFWLDKGIDGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLP 128
           ++ +  +++FWL+KGIDG+R+D +  + +       + +             H    + P
Sbjct: 178 RQDVYEMMKFWLEKGIDGFRMDVINFISKEEGLPTVETEE------EGYVSGHKHFMNGP 231

Query: 129 ELYEILVKWRALVDEYKQKTGHTRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLV-L 187
            +++ L +    V  +     +  + + E         K +    R      F F+ + L
Sbjct: 232 NIHKYLHEMNEEVLSH-----YDIMTVGEMPGVTTEEAKLYTGEERKELQMVFQFEHMDL 286

Query: 188 DPDKGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTNRLG------KE 241
           D  +G +  V   +     ++  +++  L   G ++  ++NHD PRV +R G       E
Sbjct: 287 DSGEGGKWDVKPCSLLTLKENLTKWQKALEHTGWNSLYWNNHDQPRVVSRFGNDGMYRIE 346

Query: 242 LADAYLMISLLMPGVGVTYYGDEIGMEGPLVRNDER------------------RDPNNA 283
            A     +  +M G    Y G+EIGM      + +                    D    
Sbjct: 347 SAKMLATVLHMMKGTPYIYQGEEIGMTNVRFESIDEYRDIETLNMYKEKVMERGEDIEKV 406

Query: 284 GGARADETRDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYR 343
             +   + RD  RTPMQWD   HAGF+T  + W+ VNPNY  +NV+   +   S +  Y+
Sbjct: 407 MQSIYIKGRDNARTPMQWDDQNHAGFTTG-EPWITVNPNYKEINVKQAIQNKDSIFYYYK 465

Query: 344 KLSQLRRT-DTMIY 356
           KL +LR+  + ++Y
Sbjct: 466 KLIELRKNNEIVVY 479
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.98
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 99.97
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.97
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 99.97
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.97
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 99.97
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.97
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.97
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 99.96
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 99.94
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.93
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.92
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 99.91
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 99.91
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.89
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.89
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.88
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 99.88
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.88
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.88
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 99.87
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 99.87
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 99.86
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.85
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.85
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.83
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 99.83
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.83
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.82
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.76
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 99.69
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.61
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 99.61
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.59
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.55
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 99.54
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 99.53
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 99.51
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.51
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 99.5
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.48
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 99.44
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 99.35
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.33
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.26
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 99.23
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.17
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 99.13
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 98.95
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 98.93
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 98.87
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 98.83
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 98.81
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 98.75
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 98.72
d1iv8a2653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 98.68
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 98.62
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 98.56
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 98.2
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 98.17
d1uoka179 Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 139 97.72
d1m53a178 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 97.69
d1j0ha283 Neopullulanase {Bacillus stearothermophilus [TaxId 97.61
d1wzla283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 97.16
d1ea9c280 Maltogenic amylase {Bacillus sp., cyclomaltodextri 97.04
d1ji1a283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 96.63
d1h3ga283 Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId 95.69
d1g5aa174 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 95.65
d1iv8a2653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 94.6
d1m7xa2106 1,4-alpha-glucan branching enzyme {Escherichia col 92.93
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 92.72
d1cxla390 Cyclodextrin glycosyltransferase {Bacillus circula 89.7
d3bmva389 Cyclodextrin glycosyltransferase {Thermoanaerobact 89.43
d1cyga389 Cyclodextrin glycosyltransferase {Bacillus stearot 88.59
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 84.2
d1gjwa164 Maltosyltransferase {Thermotoga maritima [TaxId: 2 80.33
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Isomaltulose synthase PalI
species: Klebsiella sp., lx3 [TaxId: 576]

Probab=100.00  E-value=1.8e-45  Score=390.81  Aligned_cols=327  Identities=30%  Similarity=0.505  Sum_probs=250.8

Q ss_pred             CCCCCCCceEEeeeCCCCCCCCCCCCcccccCCCcceeeCCccceeeccCCCCCCccCCCCHHHHHHHHHHHHHHHhCCC
Q psy15648          5 AGIAPYDEYYVWKEGKGVNKTEPPNNWVSVFSGSAWTYDENRKMFYLHQFSAKQPDLNFRSKKLQEAMEAVLRFWLDKGI   84 (567)
Q Consensus         5 ~~~~~~~d~y~w~~~~~~~~~~~p~~w~s~f~~~~w~~~~~~~~~y~~~f~~~~pdLN~~np~vr~~i~~~~~~Wl~~GV   84 (567)
                      .+.++|+++|.|.++..   ..||++|.+.+++..|.++...+++|++.|...+||||+.+|+|+++|+++++||+++||
T Consensus       117 ~~~~~~~~~~~~~d~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~~~~V~~~i~~~~~~w~e~gv  193 (478)
T d1m53a2         117 DKNNPYRDYYFWRDGKD---NQPPNNYPSFFGGSAWQKDAKSGQYYLHYFARQQPDLNWDNPKVREDLYAMLRFWLDKGV  193 (478)
T ss_dssp             CTTCTTGGGBCEECCSS---SSCSSCCBCTTSSBSEEECTTTCCEEECSSCTTCCBBCTTSHHHHHHHHHHHHHHHTTTC
T ss_pred             CCCCCccccccccCCCc---CCCCccccccCCCCccccccccCcccccCcCCCCCcccchhHHHHHHHHHHHHHHHhcCC
Confidence            35789999999999863   567899999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEecccCccccCCCCCCCCCCCCCCCCCCccccccccCCCchhHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCHHH
Q psy15648         85 DGWRIDALKHMFEAGDFKDEKYKPGKEGSMNYDDLIHDKTTDLPELYEILVKWRALVDEYKQKTGHTRILIVESYTDIEN  164 (567)
Q Consensus        85 DGfRlD~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~~~~~~~~~~~~~~~ligE~~~~~~~  164 (567)
                      ||||||+|+++.+...+.+.....       .....+. ....+..++++++++..+..     .++.+++||.+.....
T Consensus       194 DGfR~D~~~~~~~~~~~~~~~~~~-------~~~~~~~-~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~e~~~~~~~  260 (478)
T d1m53a2         194 SGMRFDTVATYSKIPGFPNLTPEQ-------QKNFAEQ-YTMGPNIHRYIQEMNRKVLS-----RYDVATAGEIFGVPLD  260 (478)
T ss_dssp             CEEEETTGGGSSCCTTCCCCCHHH-------HHTHHHH-TTCCTTHHHHHHHHHHHTGG-----GSCCEEEEECTTCCGG
T ss_pred             ceeccccceeecccccccccchhh-------hhccchh-hccchhHHHHHHHHHHHHhh-----ccccceeeeecCCCHH
Confidence            999999999997655443211000       0000000 12335577788777665432     4689999999975444


Q ss_pred             HhhhhccCCCCCCCcccccccccCCC--------CCcchHHHhhhhhhhHhHHHHHHHhCCCCCCceeeccCCCCCcccc
Q psy15648        165 TMKYFKYNGRPAAHYPFNFQLVLDPD--------KGERALVLILNHYMKVKSKNQFKDNLPAEGTSNWVYDNHDNPRVTN  236 (567)
Q Consensus       165 ~~~y~~~~~~~~~~~~~~~~~~~~l~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fl~nHD~~R~~~  236 (567)
                      ....+.......+++.+++.+.....        .......+       .+.+..+....+...+..+|++|||++|+.+
T Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~nhd~~R~~~  333 (478)
T d1m53a2         261 RSSQFFDRRRHELNMAFMFDLIRLDRDSNERWRHKSWSLSQF-------RQIISKMDVTVGKYGWNTFFLDNHDNPRAVS  333 (478)
T ss_dssp             GTHHHHCGGGCSCSEEECCTTTTTTBCSSCTTCBCCCCHHHH-------HHHHHHHHHHHTTTCCBEECSCCTTSCCHHH
T ss_pred             HHHhhhcccCCccccccchhhhhhhhhhhhhhccccccHHHH-------HHHHHHHHhhhcccccceeeccCCCCccccc
Confidence            33333323335677777777654221        11234445       5666666666677778888999999999999


Q ss_pred             cCCch-------HHHHHHHHHHhCCCceeeeccccccCCCCC-CCCCcccCccccCC-------CC----------CCCC
Q psy15648        237 RLGKE-------LADAYLMISLLMPGVGVTYYGDEIGMEGPL-VRNDERRDPNNAGG-------AR----------ADET  291 (567)
Q Consensus       237 ~~~~~-------~~~~a~a~ll~~pG~P~iYyG~E~G~~~~~-~~~~~~~d~~~~~~-------~~----------~~~~  291 (567)
                      +++.+       +.+++++++||+||+||||||||+||.+.. ...++..|+...+.       +.          ...+
T Consensus       334 ~~~~~~~~~~~~~~~~~~~lllt~pGiP~iyyGdEiG~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  413 (478)
T d1m53a2         334 HFGDDRPQWREASAKALATITLTQRATPFIYQGSELGMTNYPFRQLNEFDDIEVKGFWQDYVQSGKVTATEFLDNVRLTS  413 (478)
T ss_dssp             HHSCCSTTTHHHHHHHHHHHHTSSSSEEEEETTTTTTCCCCCCCSGGGCCCHHHHHHHHHHTTTTSSCHHHHHHHHHHHC
T ss_pred             ccCCchHHHHHHHHHHHHHHHHhCCCCCEEecccccCCcCCCcccccccCChhhhhhhHHHHhcccCchHHHHhhccccC
Confidence            88753       468889999999999999999999999875 44556666543211       11          2346


Q ss_pred             CCCCCCCcccCCCCCCCCCCCCCCCCCCCCCcccccHHHhhhCCCchHHHHHHHHhccccC-ccc
Q psy15648        292 RDPERTPMQWDSTKHAGFSTARKTWLPVNPNYYYLNVEAQKKADWSTYKLYRKLSQLRRTD-TMI  355 (567)
Q Consensus       292 ~d~~r~pm~W~~~~~~gf~~~~~~w~~~~~~~~~~~v~~q~~d~~sl~~~~k~Li~lR~~~-al~  355 (567)
                      ||++|+||+|++..++|||++ +||+++..+|..+||++|..+++|+|++||+||+|||++ +|.
T Consensus       414 rd~~R~Pm~W~~~~~~GFs~~-~~wl~~~~~~~~~nv~~q~~~~~S~l~~yr~Li~lRk~~paL~  477 (478)
T d1m53a2         414 RDNSRTPFQWNDTLNAGFTRG-KPWFHINPNYVEINAEREETREDSVLNYYKKMIQLRHHIPALV  477 (478)
T ss_dssp             GGGGCSCCCCSSSGGGGSCSS-CCSSCCCGGGGTSCHHHHHHCTTSHHHHHHHHHHHHHHCHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCC-CcCCcCCcchhhhhHHHHhhCcccHHHHHHHHHHHHhhCchhc
Confidence            889999999999999999986 799999999999999999999999999999999999998 874
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uoka1 b.71.1.1 (A:480-558) Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a1 b.71.1.1 (A:521-598) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1j0ha2 b.71.1.1 (A:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wzla2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ea9c2 b.71.1.1 (C:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1ji1a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1h3ga2 b.71.1.1 (A:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cxla3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d3bmva3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gjwa1 b.71.1.1 (A:573-636) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure