Psyllid ID: psy15666


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
VEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWNPDKIA
cccccccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHcccccHHHHHHHHccccEEEcccccEEEEcccHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccEEEEEccccccHHHHHHHHcccHHHHHHHHHHccccEEEcccccHHHHHHHccccccccHHHHHHHHcccccccccccccccc
cccccccccHHHHHHHHHHccEEEEEEccccccccccEEEcccEEEEccccccccHHccccEEEEccccEccEEccEEEEccHHHHHHHHHHHHHHcccEEEccHHHccHHHHHHHHHHHHHcccccHHHcEEEEEEcHHHcccHHHHHHHHHHHHHHHccccEEEEEEcccccEccccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccccEEEEEcEccEccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccHHHHHHHHHHccccEEccEcccHHHHHHHHEEEEEccHHHHHHHHHHcccccccccccccc
vefhphflqpqelIDVCNQNKIALQAYASlgstssnpliadsTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLlpkfnlkredifitsklspqyngnadQVKSLVAQTLKDLGTTYLDLFLihwpgtfgvdssspqqisNRHTLWNALTelynpnngplksigvsnYTAKHLVNLIqnskvvpavnqvefhphflqpqelIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQEnfliipksvtpeRIVQNIAldfelspeEVKAienipnkqkycwnpdkia
vefhphflqpqELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFItsklspqyngnADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAienipnkqkycwnpdkia
VEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWNPDKIA
******FLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVD******ISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCW******
VEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWNP**IA
VEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWNPDKIA
*EFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSSNPLIADSTLAQIAKVHSVSPAQVLLRWALQENFCKFIKLYHKVHSVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENIPNKQKYCWNPDKIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q6AZW2324 Alcohol dehydrogenase [NA no N/A 0.678 0.709 0.381 9e-38
Q4DJ07283 Prostaglandin F synthase N/A N/A 0.663 0.795 0.357 3e-36
A4TE41279 Uncharacterized oxidoredu yes N/A 0.657 0.799 0.370 4e-36
A0QV10275 Uncharacterized oxidoredu yes N/A 0.648 0.8 0.393 5e-36
A1T726279 Uncharacterized oxidoredu yes N/A 0.646 0.784 0.384 5e-36
Q6IMN8297 Aldose reductase A OS=Dic no N/A 0.681 0.777 0.36 5e-36
P51635325 Alcohol dehydrogenase [NA yes N/A 0.716 0.747 0.358 6e-36
O80944311 Aldo-keto reductase famil yes N/A 0.678 0.739 0.370 1e-35
A1UEC5283 Uncharacterized oxidoredu yes N/A 0.646 0.773 0.364 4e-35
Q1BAN7283 Uncharacterized oxidoredu yes N/A 0.646 0.773 0.364 4e-35
>sp|Q6AZW2|A1A1A_DANRE Alcohol dehydrogenase [NADP(+)] A OS=Danio rerio GN=akr1a1a PE=2 SV=2 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 146/262 (55%), Gaps = 32/262 (12%)

Query: 98  YRAIDTAQEYGNEASIGRAL-KVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTL 156
           YR ID A  Y NE  +G AL + L P  +L+R+DIF+TSKL      + D V+    ++L
Sbjct: 40  YRHIDCAAAYSNEREVGEALTERLGPGKSLRRDDIFVTSKLW-NTKHHPDDVEEACRRSL 98

Query: 157 KDLGTTYLDLFLIHWPGTFGV-DSSSPQ------QISNRH--TLWNALTELYNPNNGPLK 207
            DL  +YLDL+LIHWP  FG  D   P+      Q  + H    W A+ +L   + G  K
Sbjct: 99  SDLRLSYLDLYLIHWPMAFGRGDELIPRHPDGTIQYDDTHYRDTWAAMEKLV--DQGLAK 156

Query: 208 SIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGST 267
           +IG+SN+ AK + +++  +K  P VNQVE HP+ +Q  EL+  C    + + AY+ LGS 
Sbjct: 157 AIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQ-AELVSHCWSRNLTVTAYSPLGSP 215

Query: 268 S-----------------TQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNI-A 309
                               IAK ++ +PAQV++RW +Q   + IPKSVTP RI QNI  
Sbjct: 216 DRPWVTPGEALLLDDPRVVGIAKSYNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEV 275

Query: 310 LDFELSPEEVKAIENIPNKQKY 331
            DF+LS E+++ IE+    +++
Sbjct: 276 FDFKLSDEDMRLIESFNRNERF 297




Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2
>sp|Q4DJ07|PGFS_TRYCC Prostaglandin F synthase OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511287.49 PE=1 SV=2 Back     alignment and function description
>sp|A4TE41|Y4205_MYCGI Uncharacterized oxidoreductase Mflv_4205 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_4205 PE=3 SV=1 Back     alignment and function description
>sp|A0QV10|Y2408_MYCS2 Uncharacterized oxidoreductase MSMEG_2408/MSMEI_2347 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2408 PE=1 SV=1 Back     alignment and function description
>sp|A1T726|Y2161_MYCVP Uncharacterized oxidoreductase Mvan_2161 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2161 PE=3 SV=1 Back     alignment and function description
>sp|Q6IMN8|ALRA_DICDI Aldose reductase A OS=Dictyostelium discoideum GN=alrA PE=2 SV=1 Back     alignment and function description
>sp|P51635|AK1A1_RAT Alcohol dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Akr1a1 PE=1 SV=2 Back     alignment and function description
>sp|O80944|AKRC8_ARATH Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana GN=AKR4C8 PE=1 SV=2 Back     alignment and function description
>sp|A1UEC5|Y1984_MYCSK Uncharacterized oxidoreductase Mkms_1984 OS=Mycobacterium sp. (strain KMS) GN=Mkms_1984 PE=3 SV=1 Back     alignment and function description
>sp|Q1BAN7|Y1938_MYCSS Uncharacterized oxidoreductase Mmcs_1938 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_1938 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
193580022301 PREDICTED: aldose reductase A-like [Acyr 0.713 0.803 0.519 2e-68
345489139292 PREDICTED: alcohol dehydrogenase [NADP+] 0.740 0.859 0.488 2e-60
242011603287 aldo-keto reductase, putative [Pediculus 0.693 0.818 0.501 2e-57
340713261292 PREDICTED: aldo-keto reductase family 4 0.699 0.811 0.492 2e-56
170046404295 aldo-keto reductase [Culex quinquefascia 0.719 0.827 0.481 2e-56
350420298292 PREDICTED: aldo-keto reductase family 4 0.699 0.811 0.488 7e-56
357626319377 putative aldo-keto reductase [Danaus ple 0.702 0.631 0.443 4e-55
157115626292 aldo-keto reductase [Aedes aegypti] gi|1 0.761 0.883 0.463 5e-55
380020887292 PREDICTED: aldo-keto reductase family 4 0.707 0.821 0.466 2e-54
383856865292 PREDICTED: aldo-keto reductase family 4 0.699 0.811 0.468 5e-54
>gi|193580022|ref|XP_001944716.1| PREDICTED: aldose reductase A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 132/254 (51%), Positives = 174/254 (68%), Gaps = 12/254 (4%)

Query: 98  YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
           YR IDTA  Y NE  I  ALKVLLPK++LKRED+FITSKL+P+ +G+  QV + V ++L 
Sbjct: 48  YRLIDTAAVYNNEQYIKEALKVLLPKYHLKREDLFITSKLAPKDHGDEKQVTAAVQRSLD 107

Query: 158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
           +LGT+YLDL+LIHWPG   +D+ SP+    R+  W  L +L++  NG LK+IGVSNYT K
Sbjct: 108 NLGTSYLDLYLIHWPGAGRIDAKSPENSKLRNLTWKTLMKLHDNGNGSLKNIGVSNYTVK 167

Query: 218 HLVNLIQN-SKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTS-------- 268
           H+  ++ + + +VPAVNQVEFHP+F Q  E   VC   KI LQAY S+G ++        
Sbjct: 168 HIKEMLADPTNIVPAVNQVEFHPYFQQSSEFHKVCKNAKIVLQAYCSMGGSAGKNSLLND 227

Query: 269 ---TQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENI 325
               +IAK HS+S AQVLLRWA+Q N+ +IPKSVT ERI  N  LD EL+ E+V  I NI
Sbjct: 228 EVINRIAKKHSISAAQVLLRWAIQRNYAVIPKSVTAERIKTNFDLDTELTKEDVDDINNI 287

Query: 326 PNKQKYCWNPDKIA 339
            + +K+ W P+ IA
Sbjct: 288 KHTEKFAWEPEVIA 301




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345489139|ref|XP_001604710.2| PREDICTED: alcohol dehydrogenase [NADP+]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242011603|ref|XP_002426538.1| aldo-keto reductase, putative [Pediculus humanus corporis] gi|212510664|gb|EEB13800.1| aldo-keto reductase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340713261|ref|XP_003395163.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|170046404|ref|XP_001850756.1| aldo-keto reductase [Culex quinquefasciatus] gi|167869179|gb|EDS32562.1| aldo-keto reductase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350420298|ref|XP_003492465.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357626319|gb|EHJ76449.1| putative aldo-keto reductase [Danaus plexippus] Back     alignment and taxonomy information
>gi|157115626|ref|XP_001658269.1| aldo-keto reductase [Aedes aegypti] gi|108876825|gb|EAT41050.1| AAEL007275-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|380020887|ref|XP_003694308.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Apis florea] Back     alignment and taxonomy information
>gi|383856865|ref|XP_003703927.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
ZFIN|ZDB-GENE-041010-156288 zgc:101765 "zgc:101765" [Danio 0.699 0.822 0.44 4e-51
DICTYBASE|DDB_G0285025289 alrE "aldo-keto reductase" [Di 0.722 0.847 0.389 4.2e-47
DICTYBASE|DDB_G0285027290 alrD "aldo-keto reductase" [Di 0.749 0.875 0.407 2.7e-45
ZFIN|ZDB-GENE-050320-51287 zgc:110782 "zgc:110782" [Danio 0.693 0.818 0.416 3.1e-44
WB|WBGene00016443287 C35D10.6 [Caenorhabditis elega 0.719 0.850 0.391 4.5e-43
DICTYBASE|DDB_G0285023305 alrF "aldo-keto reductase" [Di 0.699 0.777 0.389 7.5e-41
WB|WBGene00009981283 F53F1.3 [Caenorhabditis elegan 0.666 0.798 0.418 5.3e-40
WB|WBGene00009980297 F53F1.2 [Caenorhabditis elegan 0.681 0.777 0.381 2.3e-39
CGD|CAL0000925371 GRE3 [Candida albicans (taxid: 0.492 0.450 0.365 1.3e-38
WB|WBGene00015307287 C01G5.5 [Caenorhabditis elegan 0.681 0.804 0.371 3.9e-37
ZFIN|ZDB-GENE-041010-156 zgc:101765 "zgc:101765" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 531 (192.0 bits), Expect = 4.0e-51, P = 4.0e-51
 Identities = 110/250 (44%), Positives = 159/250 (63%)

Query:    98 YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
             YRA DTA  Y NEA +G AL+ LLPK  L RED+FITSKL P+  G+  + ++   ++L+
Sbjct:    44 YRAFDTAAVYRNEAHLGHALRCLLPKHGLSREDVFITSKLGPKDQGS--KARNGCQKSLE 101

Query:   158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
              LG  Y+DL+LIHWPGT G+     +   NR   W  L E Y+   G  ++IGVSNYT +
Sbjct:   102 QLGLGYIDLYLIHWPGTQGLPVGDKRNPENRAQSWRVLEEFYS--EGKFRAIGVSNYTVE 159

Query:   218 HLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGS-------TSTQ 270
             H+  L+++ KV PAV QVEFHP  LQ  +L  +C    +  QAY+SLG+          +
Sbjct:   160 HMQELLKSCKVPPAVLQVEFHPKLLQ-NDLRGLCKIRGVCFQAYSSLGTGLLLSNPVVLE 218

Query:   271 IAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFELSPEEVKAIENIPNKQ 329
             IAK    +PAQVLLRWA+Q++  ++PKS  PER+ +N  L DFE+S E+++ +  +   +
Sbjct:   219 IAKECGRTPAQVLLRWAVQQSIAVLPKSSQPERVKENGRLFDFEISEEDMERLSALDCGE 278

Query:   330 KYCWNPDKIA 339
             K+CW+P +++
Sbjct:   279 KFCWDPTQVS 288


GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
DICTYBASE|DDB_G0285025 alrE "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285027 alrD "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-51 zgc:110782 "zgc:110782" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016443 C35D10.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285023 alrF "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00009981 F53F1.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00009980 F53F1.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0000925 GRE3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
WB|WBGene00015307 C01G5.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A1UEC5Y1984_MYCSK1, ., -, ., -, ., -0.3640.64600.7738yesN/A
Q1BAN7Y1938_MYCSS1, ., -, ., -, ., -0.3640.64600.7738yesN/A
A1T726Y2161_MYCVP1, ., -, ., -, ., -0.38490.64600.7849yesN/A
Q3ZCJ2AK1A1_BOVIN1, ., 1, ., 1, ., 20.35760.70200.7323yesN/A
O14088YER5_SCHPO1, ., -, ., -, ., -0.36840.65190.8036yesN/A
O80944AKRC8_ARATH1, ., 1, ., 1, ., -0.37000.67840.7395yesN/A
P50578AK1A1_PIG1, ., 1, ., 1, ., 20.35530.69910.7292yesN/A
P51635AK1A1_RAT1, ., 1, ., 1, ., 20.35840.71680.7476yesN/A
A1KMW6Y2993_MYCBP1, ., -, ., -, ., -0.37140.64890.7801yesN/A
P95124Y2971_MYCTU1, ., -, ., -, ., -0.36730.64890.7801yesN/A
A4TE41Y4205_MYCGI1, ., -, ., -, ., -0.37090.65780.7992yesN/A
A5U6Y1Y2999_MYCTA1, ., -, ., -, ., -0.36730.64890.7801yesN/A
Q7TXI6Y2996_MYCBO1, ., -, ., -, ., -0.37140.64890.7801yesN/A
Q5R5D5AK1A1_PONAB1, ., 1, ., 1, ., 20.36290.69020.72yesN/A
O32210GR_BACSU1, ., 1, ., 1, ., 2, 8, 30.37750.65480.8043yesN/A
A0QV10Y2408_MYCS21, ., -, ., -, ., -0.39350.64890.8yesN/A
P14065GCY_YEAST1, ., 1, ., 1, ., -0.36320.64010.6955yesN/A
Q9JII6AK1A1_MOUSE1, ., 1, ., 1, ., 20.35490.67840.7076yesN/A
O60218AK1BA_HUMAN1, ., 1, ., 1, ., -0.37120.68140.7310yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-77
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 7e-64
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 1e-47
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 3e-42
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-37
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 8e-22
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 6e-15
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 5e-13
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 5e-11
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-08
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 1e-06
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 3e-05
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 6e-05
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 4e-04
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
 Score =  238 bits (609), Expect = 2e-77
 Identities = 102/247 (41%), Positives = 150/247 (60%), Gaps = 27/247 (10%)

Query: 88  LRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQ 147
           +R AL+    YR IDTA+ YGNE  +G A+K    +  + RE++FIT+K+ P   G  + 
Sbjct: 34  VRAALELG--YRLIDTAEIYGNEEEVGEAIK----ESGVPREELFITTKVWPSDLGYDET 87

Query: 148 VKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLK 207
           +K+L   +LK LG  Y+DL+LIHWP         P +       W AL EL +   G ++
Sbjct: 88  LKAL-EASLKRLGLDYVDLYLIHWPV--------PNKYVVIEETWKALEELVD--EGLIR 136

Query: 208 SIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLG-- 265
           +IGVSN+  +HL  L+  +KV PAVNQ+E+HP +L+  EL+  C ++ IA++AY+ L   
Sbjct: 137 AIGVSNFGVEHLEELLSLAKVKPAVNQIEYHP-YLRQPELLPFCQRHGIAVEAYSPLAKG 195

Query: 266 ------STSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNI-ALDFELSPEE 318
                     +IAK +  +PAQV LRW +Q   ++IPKS TPERI +N+ A DFELS E+
Sbjct: 196 GKLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEED 255

Query: 319 VKAIENI 325
           + AI+ +
Sbjct: 256 MAAIDAL 262


Length = 280

>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
KOG1577|consensus300 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575|consensus336 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
PLN02587314 L-galactose dehydrogenase 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG1576|consensus342 100.0
KOG1577|consensus300 99.81
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 99.8
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 99.48
KOG1575|consensus336 99.45
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.44
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.2
PRK10625346 tas putative aldo-keto reductase; Provisional 99.18
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.17
PRK10376290 putative oxidoreductase; Provisional 99.16
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.15
COG4989298 Predicted oxidoreductase [General function predict 99.06
PLN02587314 L-galactose dehydrogenase 99.06
PRK14863292 bifunctional regulator KidO; Provisional 98.97
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 98.95
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 98.81
KOG3023|consensus285 98.67
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 96.13
PRK10558 256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 89.08
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 88.64
PRK10128 267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 87.34
TIGR03239 249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 86.75
cd01973 454 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -li 83.3
TIGR02311 249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 80.52
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 80.24
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.8e-59  Score=414.12  Aligned_cols=237  Identities=43%  Similarity=0.701  Sum_probs=221.9

Q ss_pred             HHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhcCCCc
Q psy15666         84 AQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTY  163 (339)
Q Consensus        84 ~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L~~d~  163 (339)
                      +...+..|++  .|+|+||||..||||+.+|+|+++.    +++|+++||+||+|+...++ +.+.+++++||++||+||
T Consensus        30 ~~~av~~Al~--~Gyr~IDTA~~YgnE~~VG~aI~~s----~v~ReelFittKvw~~~~~~-~~~~~a~e~Sl~rLg~dy  102 (280)
T COG0656          30 AVRAVRAALE--LGYRLIDTAEIYGNEEEVGEAIKES----GVPREELFITTKVWPSDLGY-DETLKALEASLKRLGLDY  102 (280)
T ss_pred             HHHHHHHHHH--hCcceEecHhHhcCHHHHHHHHHhc----CCCHHHeEEEeecCCccCCc-chHHHHHHHHHHHhCCCc
Confidence            7789999999  9999999999999999999999986    89999999999999998888 999999999999999999


Q ss_pred             ccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCCCCCC
Q psy15666        164 LDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQ  243 (339)
Q Consensus       164 iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~~~  243 (339)
                      ||||+||||...      ...  ...++|++||+++++  |+||+||||||+.++++++++..++.|++||++||++.++
T Consensus       103 vDLyLiHwP~~~------~~~--~~~etw~alE~l~~~--G~ir~IGVSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q  172 (280)
T COG0656         103 VDLYLIHWPVPN------KYV--VIEETWKALEELVDE--GLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQ  172 (280)
T ss_pred             eeEEEECCCCCc------cCc--cHHHHHHHHHHHHhc--CCccEEEeeCCCHHHHHHHHHhcCCCCceEEEEeccCCCc
Confidence            999999999321      011  168999999999999  9999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHhCCceEEEecchhH--------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC-CCCC
Q psy15666        244 PQELIDVCNQNKIALQAYASLGS--------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFEL  314 (339)
Q Consensus       244 ~~~l~~~~~~~gi~v~~~~~l~~--------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~-~~~L  314 (339)
                       .+++++|+++||.+++||||++        .+.+||++||.|++|++|||++++|+++||++++++|++||+++ ++.|
T Consensus       173 -~el~~~~~~~gI~v~AysPL~~g~~l~~~~~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~~~~ri~eN~~~~~f~L  251 (280)
T COG0656         173 -PELLPFCQRHGIAVEAYSPLAKGGKLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFEL  251 (280)
T ss_pred             -HHHHHHHHHcCCEEEEECCcccccccccChHHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCCCHHHHHHHHhhhcCCC
Confidence             6799999999999999999994        78999999999999999999999999999999999999999999 9999


Q ss_pred             CHHHHHHHhcCCCCC---CcccCCCCC
Q psy15666        315 SPEEVKAIENIPNKQ---KYCWNPDKI  338 (339)
Q Consensus       315 ~~~~~~~l~~~~~~~---r~~~~~~~~  338 (339)
                      |++||++|+++....   +..++|..+
T Consensus       252 s~ed~~~i~~l~~~~~~~~~~~~p~~~  278 (280)
T COG0656         252 SEEDMAAIDALDRGYGRTRVGPDPEFF  278 (280)
T ss_pred             CHHHHHHHHhhccccCcccccCCcccc
Confidence            999999999999987   567787643



>KOG1577|consensus Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>KOG1575|consensus Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576|consensus Back     alignment and domain information
>KOG1577|consensus Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>KOG1575|consensus Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>KOG3023|consensus Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>cd01973 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -like: Nitrogenase VFe protein, beta subunit like Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 3e-37
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 1e-36
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-35
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 1e-35
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 2e-35
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 2e-35
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 2e-35
2alr_A324 Aldehyde Reductase Length = 324 3e-35
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 3e-35
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 7e-35
3f7j_A276 B.Subtilis Yvgn Length = 276 3e-34
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 3e-34
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 4e-34
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 8e-34
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 1e-33
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 1e-33
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 1e-33
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 2e-33
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 2e-33
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 3e-33
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 4e-33
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 5e-33
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-32
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 4e-32
3b3d_A314 B.Subtilis Ytbe Length = 314 1e-31
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 4e-31
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 4e-31
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 3e-30
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 8e-30
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 3e-29
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 3e-29
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 3e-29
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 8e-29
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 8e-29
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 8e-29
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 8e-29
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 9e-29
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 9e-29
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 9e-29
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 1e-28
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 1e-28
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 1e-28
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 2e-28
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 2e-28
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 2e-28
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 2e-28
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 2e-28
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 2e-28
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 2e-28
2ipw_A315 Crystal Structure Of C298a W219y Aldose Reductase C 2e-28
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 2e-28
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 2e-28
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 2e-28
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 2e-28
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 2e-28
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 2e-28
2r24_A316 Human Aldose Reductase Structure Length = 316 2e-28
3q67_A316 Human Aldose Reductase C298s Mutant In Complex With 3e-28
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 3e-28
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 3e-28
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 3e-28
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 3e-28
1abn_A315 The Crystal Structure Of The Aldose Reductase Nadph 3e-28
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 4e-28
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 4e-28
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 4e-28
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 4e-28
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 1e-27
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 1e-27
1xgd_A315 Apo R268a Human Aldose Reductase Length = 315 2e-27
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 9e-27
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 1e-26
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 1e-26
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 5e-26
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 6e-26
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 7e-26
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 7e-26
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 1e-24
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-24
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 3e-24
1c9w_A315 Cho Reductase With Nadp+ Length = 315 3e-24
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-24
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-24
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 4e-24
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 4e-24
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 2e-23
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 9e-23
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 6e-22
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 7e-22
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 7e-22
3ln3_A324 Crystal Structure Of Putative Reductase (Np_038806. 1e-16
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 5e-09
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 8e-06
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 1e-05
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 2e-05
3uyi_A337 Crystal Structure Of Perakine Reductase, Founder Me 2e-05
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 2e-05
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 1e-04
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 1e-04
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 3e-04
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure

Iteration: 1

Score = 152 bits (383), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 94/263 (35%), Positives = 149/263 (56%), Gaps = 38/263 (14%) Query: 88 LRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQ 147 +RWA++ YR IDTA Y NE +G+ ++ + + RE++++T+K+ +N + Sbjct: 44 VRWAIEAG--YRHIDTAYIYSNERGVGQGIR----ESGVPREEVWVTTKV---WNSDQGY 94 Query: 148 VKSLVA--QTLKDLGTTYLDLFLIHWPGTFG-VDSSSPQQISNRHTLWNALTELYNPNNG 204 K+L A ++ + LG Y+DL+LIHWPG VD+ W AL +LY Sbjct: 95 EKTLAAFERSRELLGLEYIDLYLIHWPGKKKFVDT------------WKALEKLYEEKK- 141 Query: 205 PLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASL 264 +++IGVSN+ HL L ++ K+ P VNQVE HP F Q + L + C Q+ IA+ A++ L Sbjct: 142 -VRAIGVSNFEPHHLTELFKSCKIRPMVNQVELHPLF-QQRTLREFCKQHNIAITAWSPL 199 Query: 265 GSTS----------TQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFE 313 GS +IAK H+ SPAQV++RW +Q + IPKS RI +N + DF+ Sbjct: 200 GSGEEAGILKNHVLGEIAKKHNKSPAQVVIRWDIQHGIVTIPKSTNKGRIQENFNVWDFK 259 Query: 314 LSPEEVKAIENIPNKQKYCWNPD 336 L+ EE++ I+ + ++ +PD Sbjct: 260 LTEEEMRQIDELNEDKRIGADPD 282
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-93
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 4e-16
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 7e-91
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 3e-16
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 8e-91
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 4e-16
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 3e-90
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 7e-16
4gie_A290 Prostaglandin F synthase; structural genomics, nia 9e-90
4gie_A290 Prostaglandin F synthase; structural genomics, nia 1e-17
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 3e-89
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 8e-16
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 2e-88
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 5e-19
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 2e-88
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 2e-16
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 3e-88
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 5e-18
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 3e-87
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 7e-16
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 3e-87
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 3e-15
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 4e-87
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 8e-18
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 2e-86
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 8e-18
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-85
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-14
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-85
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 4e-15
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-84
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-17
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 2e-84
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 1e-15
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 3e-84
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 3e-18
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 4e-84
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 4e-18
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 4e-84
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 4e-18
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-83
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-17
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 3e-83
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 9e-18
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 7e-83
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 1e-17
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-81
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 1e-17
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 3e-61
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 1e-11
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 3e-28
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 3e-24
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 4e-24
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 6e-21
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 8e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-15
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 1e-14
3erp_A353 Putative oxidoreductase; funded by the national in 1e-14
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 1e-13
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 2e-13
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 2e-13
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 3e-12
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 6e-11
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
 Score =  278 bits (714), Expect = 2e-93
 Identities = 89/249 (35%), Positives = 135/249 (54%), Gaps = 19/249 (7%)

Query: 98  YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
           YR IDTA  Y NE S+G  L+       + RED+FIT+KL     G  +   +   ++ +
Sbjct: 49  YRHIDTAAIYKNEESVGAGLR----ASGVPREDVFITTKLWNTEQG-YESTLAAFEESRQ 103

Query: 158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
            LG  Y+DL+LIHWP   G D  S +      + W A  +LY      +++IGVSN+   
Sbjct: 104 KLGVDYIDLYLIHWP--RGKDILSKEGKKYLDS-WRAFEQLYK--EKKVRAIGVSNFHIH 158

Query: 218 HLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGS-------TSTQ 270
           HL +++    V P VNQVE HP   Q  +L   C+  +I ++A++ LG          + 
Sbjct: 159 HLEDVLAMCTVTPMVNQVELHPLNNQ-ADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSA 217

Query: 271 IAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFELSPEEVKAIENIPNKQ 329
           I   ++ + AQV+LRW +Q+N + IPKSV  ERI +N  + DFEL  E+V +I+ +    
Sbjct: 218 IGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALNTNS 277

Query: 330 KYCWNPDKI 338
           +Y  +PD+ 
Sbjct: 278 RYGPDPDEA 286


>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 99.59
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 99.58
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 99.57
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 99.56
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 99.56
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 99.56
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 99.56
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 99.56
4gie_A290 Prostaglandin F synthase; structural genomics, nia 99.55
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 99.55
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 99.55
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 99.55
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 99.55
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 99.54
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 99.54
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 99.54
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 99.54
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 99.54
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 99.53
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 99.53
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 99.52
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 99.52
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 99.51
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 99.51
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 99.49
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 99.45
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 99.44
3erp_A353 Putative oxidoreductase; funded by the national in 99.42
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 99.41
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 99.41
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 99.4
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 99.39
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 99.39
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 99.35
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 99.35
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 99.35
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 99.33
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.32
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 99.29
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.26
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.84
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-55  Score=399.72  Aligned_cols=243  Identities=37%  Similarity=0.649  Sum_probs=222.5

Q ss_pred             chHHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhcCC
Q psy15666         82 SPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGT  161 (339)
Q Consensus        82 ~n~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L~~  161 (339)
                      +++..++..|++  .|+|+||||+.||+|+.+|++|++.    +++|+++||+||+++...++ +.+++++++||+|||+
T Consensus        35 ~~~~~~v~~Al~--~G~~~~DTA~~Yg~E~~vG~al~~~----~~~R~~~~I~TK~~~~~~~~-~~i~~~~~~SL~rLg~  107 (288)
T 4f40_A           35 EVTENAVKWALC--AGYRHIDTAAIYKNEESVGAGLRAS----GVPREDVFITTKLWNTEQGY-ESTLAAFEESRQKLGV  107 (288)
T ss_dssp             HHHHHHHHHHHH--TTCCEEECCGGGTCHHHHHHHHHHH----TCCGGGCEEEEEECGGGCSH-HHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHH--cCCCeEECcccccCHHHHHHHHHhc----CCChhhEEEEEecCCCcCCH-HHHHHHHHHHHHHhCC
Confidence            667789999999  9999999999999999999999986    77899999999999877666 9999999999999999


Q ss_pred             CcccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCCCC
Q psy15666        162 TYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHF  241 (339)
Q Consensus       162 d~iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~  241 (339)
                      ||||+|++|||+....   .........++|++|++|+++  ||||+||||||++++++++++.+.++|+++|++||++.
T Consensus       108 dyiDl~llH~p~~~~~---~~~~~~~~~e~~~al~~l~~~--Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~Q~~~~~~~  182 (288)
T 4f40_A          108 DYIDLYLIHWPRGKDI---LSKEGKKYLDSWRAFEQLYKE--KKVRAIGVSNFHIHHLEDVLAMCTVTPMVNQVELHPLN  182 (288)
T ss_dssp             SCEEEEEECCCCCHHH---HHHHCCHHHHHHHHHHHHHHT--TSEEEEEEESCCHHHHHHHHTTCSSCCCEEEEECBTTB
T ss_pred             CcEEEEEEecCCCCcc---cccccccHHHHHHHHHHHHHc--CCccEEEeccCCHHHHHHHHHhCCCCCeEEeccCcccc
Confidence            9999999999932100   000012378999999999999  99999999999999999999998889999999999999


Q ss_pred             CCcHHHHHHHHhCCceEEEecchhH-------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC-CCC
Q psy15666        242 LQPQELIDVCNQNKIALQAYASLGS-------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFE  313 (339)
Q Consensus       242 ~~~~~l~~~~~~~gi~v~~~~~l~~-------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~-~~~  313 (339)
                      ++ .+++++|+++||++++|+||++       .+.++|+++|+|++|+||+|++++|+++|||+++++|+++|+++ +++
T Consensus       183 ~~-~~l~~~~~~~gi~v~a~spl~~G~l~~~~~l~~ia~~~g~t~aqvaL~w~l~~~~~~i~g~~~~~~l~en~~~~~~~  261 (288)
T 4f40_A          183 NQ-ADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSAIGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFE  261 (288)
T ss_dssp             CC-HHHHHHHHHTTCEEEEESTTC--CGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCSSHHHHHHHHCCSSCC
T ss_pred             CC-HHHHHHHHHCCCEEEEecCCCCCcccccHHHHHHHHHhCCCHHHHHHHHHHhCCCeEeeCCCCHHHHHHHhhhcCCC
Confidence            98 8999999999999999999987       78999999999999999999999999999999999999999999 999


Q ss_pred             CCHHHHHHHhcCCCCCCcccCCCC
Q psy15666        314 LSPEEVKAIENIPNKQKYCWNPDK  337 (339)
Q Consensus       314 L~~~~~~~l~~~~~~~r~~~~~~~  337 (339)
                      ||+++++.|+++.++.|++|||..
T Consensus       262 L~~ee~~~i~~l~~~~r~~~~p~~  285 (288)
T 4f40_A          262 LGAEDVMSIDALNTNSRYGPDPDE  285 (288)
T ss_dssp             CCHHHHHHHHTTCCCCCSSCCTTT
T ss_pred             CCHHHHHHHHhhccCCcccCCCCc
Confidence            999999999999999999999975



>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-39
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 1e-05
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-37
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 6e-06
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 7e-37
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-33
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 2e-05
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-33
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 6e-05
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-33
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-04
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-33
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 7e-05
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 3e-32
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 4e-04
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-32
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 8e-26
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 4e-25
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 0.003
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 9e-22
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 4e-18
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 4e-15
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 1e-12
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 2e-12
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  138 bits (349), Expect = 3e-39
 Identities = 91/268 (33%), Positives = 131/268 (48%), Gaps = 33/268 (12%)

Query: 98  YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
           YR ID A  Y NE  +G A++  L +  +KRE++FI SKL   Y+      K    +TL 
Sbjct: 40  YRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLV-KGACQKTLS 98

Query: 158 DLGTTYLDLFLIHWPGTF---------GVDSSSPQQISNRHTLWNALTELYNPNNGPLKS 208
           DL   YLDL+LIHWP  F             +     +N    W A+ EL +   G +K+
Sbjct: 99  DLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD--EGLVKA 156

Query: 209 IGVSNYTAKHLVNLIQNS--KVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLG- 265
           IG+SN+    +  ++     K  PAVNQ+E HP+  Q + LI  C    I + AY+ LG 
Sbjct: 157 IGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEK-LIQYCQSKGIVVTAYSPLGS 215

Query: 266 ----------------STSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNI- 308
                                IA  H+ + AQVL+R+ +Q N ++IPKSVTPERI +N  
Sbjct: 216 PDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFK 275

Query: 309 ALDFELSPEEVKAIENIPNKQKYCWNPD 336
             DFELS +++  + +     + C    
Sbjct: 276 VFDFELSSQDMTTLLSYNRNWRVCALLS 303


>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 99.33
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 99.28
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 99.27
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.25
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.23
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 99.21
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 99.19
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 99.18
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.17
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 99.0
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 98.91
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 98.87
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 98.83
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 98.8
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 98.76
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 98.0
d1dxea_ 253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 93.05
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: 2,5-diketo-D-gluconic acid reductase A
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=3e-48  Score=349.08  Aligned_cols=238  Identities=35%  Similarity=0.627  Sum_probs=219.7

Q ss_pred             CCchHHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhc
Q psy15666         80 SVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDL  159 (339)
Q Consensus        80 ~~~n~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L  159 (339)
                      ..+++..++..|++  .|+|+||||+.||||+.+|++|++.    +..|++++|+||.....  . +.+.+++++||+||
T Consensus        25 ~~~ea~~~l~~A~d--~Gin~~DTA~~YgsE~~lG~~l~~~----~~~~~~~~i~tk~~~~~--~-~~~~~~~~~Sl~rL   95 (274)
T d1mzra_          25 SNEEVITAIQKALE--VGYRSIDTAAAYKNEEGVGKALKNA----SVNREELFITTKLWNDD--H-KRPREALLDSLKKL   95 (274)
T ss_dssp             CHHHHHHHHHHHHH--HTCCEEECCGGGTCHHHHHHHHHHS----CSCGGGCEEEEEECGGG--T-TCHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHH--cCCCEEECcCccCCHHHHHHHhhcc----ccccccccccccccccc--c-hhHHHHHHHHHHhc
Confidence            34667789999999  9999999999999999999999987    77899999999997763  3 56999999999999


Q ss_pred             CCCcccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCC
Q psy15666        160 GTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHP  239 (339)
Q Consensus       160 ~~d~iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~  239 (339)
                      |+||||+|++|+|+.        .. ....++|++|++|+++  |+||+||+|||+.+++.++++..++++.++|.++++
T Consensus        96 ~~d~iDl~~lH~~~~--------~~-~~~~~~~~~l~~l~~~--G~i~~iGvs~~~~~~~~~~~~~~~i~~~~~~~~~~~  164 (274)
T d1mzra_          96 QLDYIDLYLMHWPVP--------AI-DHYVEAWKGMIELQKE--GLIKSIGVCNFQIHHLQRLIDETGVTPVINQIELHP  164 (274)
T ss_dssp             TCSCEEEEEESCCCT--------TT-CCHHHHHHHHHHHHHT--TSEEEEEEESCCHHHHHHHHHHHSCCCSEEEEECBT
T ss_pred             CCCeEEEEEecCCCc--------cc-hhHHHHHHHHHHHHHC--CCEEEEeeccccchHHHHHHHhcCCCceeeehhhcc
Confidence            999999999999832        11 1367899999999999  999999999999999999999999999999999988


Q ss_pred             CCCCcHHHHHHHHhCCceEEEecchhH---------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC
Q psy15666        240 HFLQPQELIDVCNQNKIALQAYASLGS---------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL  310 (339)
Q Consensus       240 ~~~~~~~l~~~~~~~gi~v~~~~~l~~---------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~  310 (339)
                      ..++ ..++++|+++||++++|+|+++         .+.++|+++|.|++|+||+|++++|+++|+|+++++|+++|+++
T Consensus       165 ~~~~-~~~~~~~~~~~i~v~a~~pl~~G~~~~~~~~~l~~ia~~~g~t~aq~Al~w~l~~~~v~I~G~~~~~~l~en~~a  243 (274)
T d1mzra_         165 LMQQ-RQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDV  243 (274)
T ss_dssp             TBCC-HHHHHHHHHTTCEEEEESTTTTTCTTTTTSHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCCCHHHHHHTTCC
T ss_pred             cccc-hhhhhhhhhcceeEEEcChhhcCCCccchhHHHHHHHHHhCCCHHHHHHHHHhcCCCEEEECCCCHHHHHHHHHh
Confidence            8877 8899999999999999999986         79999999999999999999999999999999999999999999


Q ss_pred             -CCCCCHHHHHHHhcCCCCCCcccCCCCC
Q psy15666        311 -DFELSPEEVKAIENIPNKQKYCWNPDKI  338 (339)
Q Consensus       311 -~~~L~~~~~~~l~~~~~~~r~~~~~~~~  338 (339)
                       +++||++++++|+++.++.|+++||.++
T Consensus       244 ~~~~L~~e~~~~i~~l~~~~r~~~~p~~~  272 (274)
T d1mzra_         244 WDFRLDKDELGEIAKLDQGKRLGPDPDQF  272 (274)
T ss_dssp             SSCCCCHHHHHHHHTTCCCCCCSCCTTTT
T ss_pred             cCCCCCHHHHHHHhCcccCCCCCCCcccc
Confidence             9999999999999999999999999876



>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure