Psyllid ID: psy15666
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| 193580022 | 301 | PREDICTED: aldose reductase A-like [Acyr | 0.713 | 0.803 | 0.519 | 2e-68 | |
| 345489139 | 292 | PREDICTED: alcohol dehydrogenase [NADP+] | 0.740 | 0.859 | 0.488 | 2e-60 | |
| 242011603 | 287 | aldo-keto reductase, putative [Pediculus | 0.693 | 0.818 | 0.501 | 2e-57 | |
| 340713261 | 292 | PREDICTED: aldo-keto reductase family 4 | 0.699 | 0.811 | 0.492 | 2e-56 | |
| 170046404 | 295 | aldo-keto reductase [Culex quinquefascia | 0.719 | 0.827 | 0.481 | 2e-56 | |
| 350420298 | 292 | PREDICTED: aldo-keto reductase family 4 | 0.699 | 0.811 | 0.488 | 7e-56 | |
| 357626319 | 377 | putative aldo-keto reductase [Danaus ple | 0.702 | 0.631 | 0.443 | 4e-55 | |
| 157115626 | 292 | aldo-keto reductase [Aedes aegypti] gi|1 | 0.761 | 0.883 | 0.463 | 5e-55 | |
| 380020887 | 292 | PREDICTED: aldo-keto reductase family 4 | 0.707 | 0.821 | 0.466 | 2e-54 | |
| 383856865 | 292 | PREDICTED: aldo-keto reductase family 4 | 0.699 | 0.811 | 0.468 | 5e-54 |
| >gi|193580022|ref|XP_001944716.1| PREDICTED: aldose reductase A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 265 bits (678), Expect = 2e-68, Method: Compositional matrix adjust.
Identities = 132/254 (51%), Positives = 174/254 (68%), Gaps = 12/254 (4%)
Query: 98 YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
YR IDTA Y NE I ALKVLLPK++LKRED+FITSKL+P+ +G+ QV + V ++L
Sbjct: 48 YRLIDTAAVYNNEQYIKEALKVLLPKYHLKREDLFITSKLAPKDHGDEKQVTAAVQRSLD 107
Query: 158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
+LGT+YLDL+LIHWPG +D+ SP+ R+ W L +L++ NG LK+IGVSNYT K
Sbjct: 108 NLGTSYLDLYLIHWPGAGRIDAKSPENSKLRNLTWKTLMKLHDNGNGSLKNIGVSNYTVK 167
Query: 218 HLVNLIQN-SKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGSTS-------- 268
H+ ++ + + +VPAVNQVEFHP+F Q E VC KI LQAY S+G ++
Sbjct: 168 HIKEMLADPTNIVPAVNQVEFHPYFQQSSEFHKVCKNAKIVLQAYCSMGGSAGKNSLLND 227
Query: 269 ---TQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIALDFELSPEEVKAIENI 325
+IAK HS+S AQVLLRWA+Q N+ +IPKSVT ERI N LD EL+ E+V I NI
Sbjct: 228 EVINRIAKKHSISAAQVLLRWAIQRNYAVIPKSVTAERIKTNFDLDTELTKEDVDDINNI 287
Query: 326 PNKQKYCWNPDKIA 339
+ +K+ W P+ IA
Sbjct: 288 KHTEKFAWEPEVIA 301
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345489139|ref|XP_001604710.2| PREDICTED: alcohol dehydrogenase [NADP+]-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242011603|ref|XP_002426538.1| aldo-keto reductase, putative [Pediculus humanus corporis] gi|212510664|gb|EEB13800.1| aldo-keto reductase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340713261|ref|XP_003395163.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|170046404|ref|XP_001850756.1| aldo-keto reductase [Culex quinquefasciatus] gi|167869179|gb|EDS32562.1| aldo-keto reductase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|350420298|ref|XP_003492465.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|357626319|gb|EHJ76449.1| putative aldo-keto reductase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157115626|ref|XP_001658269.1| aldo-keto reductase [Aedes aegypti] gi|108876825|gb|EAT41050.1| AAEL007275-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|380020887|ref|XP_003694308.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383856865|ref|XP_003703927.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| ZFIN|ZDB-GENE-041010-156 | 288 | zgc:101765 "zgc:101765" [Danio | 0.699 | 0.822 | 0.44 | 4e-51 | |
| DICTYBASE|DDB_G0285025 | 289 | alrE "aldo-keto reductase" [Di | 0.722 | 0.847 | 0.389 | 4.2e-47 | |
| DICTYBASE|DDB_G0285027 | 290 | alrD "aldo-keto reductase" [Di | 0.749 | 0.875 | 0.407 | 2.7e-45 | |
| ZFIN|ZDB-GENE-050320-51 | 287 | zgc:110782 "zgc:110782" [Danio | 0.693 | 0.818 | 0.416 | 3.1e-44 | |
| WB|WBGene00016443 | 287 | C35D10.6 [Caenorhabditis elega | 0.719 | 0.850 | 0.391 | 4.5e-43 | |
| DICTYBASE|DDB_G0285023 | 305 | alrF "aldo-keto reductase" [Di | 0.699 | 0.777 | 0.389 | 7.5e-41 | |
| WB|WBGene00009981 | 283 | F53F1.3 [Caenorhabditis elegan | 0.666 | 0.798 | 0.418 | 5.3e-40 | |
| WB|WBGene00009980 | 297 | F53F1.2 [Caenorhabditis elegan | 0.681 | 0.777 | 0.381 | 2.3e-39 | |
| CGD|CAL0000925 | 371 | GRE3 [Candida albicans (taxid: | 0.492 | 0.450 | 0.365 | 1.3e-38 | |
| WB|WBGene00015307 | 287 | C01G5.5 [Caenorhabditis elegan | 0.681 | 0.804 | 0.371 | 3.9e-37 |
| ZFIN|ZDB-GENE-041010-156 zgc:101765 "zgc:101765" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 531 (192.0 bits), Expect = 4.0e-51, P = 4.0e-51
Identities = 110/250 (44%), Positives = 159/250 (63%)
Query: 98 YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
YRA DTA Y NEA +G AL+ LLPK L RED+FITSKL P+ G+ + ++ ++L+
Sbjct: 44 YRAFDTAAVYRNEAHLGHALRCLLPKHGLSREDVFITSKLGPKDQGS--KARNGCQKSLE 101
Query: 158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
LG Y+DL+LIHWPGT G+ + NR W L E Y+ G ++IGVSNYT +
Sbjct: 102 QLGLGYIDLYLIHWPGTQGLPVGDKRNPENRAQSWRVLEEFYS--EGKFRAIGVSNYTVE 159
Query: 218 HLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGS-------TSTQ 270
H+ L+++ KV PAV QVEFHP LQ +L +C + QAY+SLG+ +
Sbjct: 160 HMQELLKSCKVPPAVLQVEFHPKLLQ-NDLRGLCKIRGVCFQAYSSLGTGLLLSNPVVLE 218
Query: 271 IAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFELSPEEVKAIENIPNKQ 329
IAK +PAQVLLRWA+Q++ ++PKS PER+ +N L DFE+S E+++ + + +
Sbjct: 219 IAKECGRTPAQVLLRWAVQQSIAVLPKSSQPERVKENGRLFDFEISEEDMERLSALDCGE 278
Query: 330 KYCWNPDKIA 339
K+CW+P +++
Sbjct: 279 KFCWDPTQVS 288
|
|
| DICTYBASE|DDB_G0285025 alrE "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285027 alrD "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050320-51 zgc:110782 "zgc:110782" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00016443 C35D10.6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285023 alrF "aldo-keto reductase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009981 F53F1.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009980 F53F1.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000925 GRE3 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015307 C01G5.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 2e-77 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 7e-64 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 1e-47 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 3e-42 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 3e-37 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 8e-22 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 6e-15 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 5e-13 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 5e-11 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 3e-08 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 1e-06 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 3e-05 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 6e-05 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 4e-04 |
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Score = 238 bits (609), Expect = 2e-77
Identities = 102/247 (41%), Positives = 150/247 (60%), Gaps = 27/247 (10%)
Query: 88 LRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQ 147
+R AL+ YR IDTA+ YGNE +G A+K + + RE++FIT+K+ P G +
Sbjct: 34 VRAALELG--YRLIDTAEIYGNEEEVGEAIK----ESGVPREELFITTKVWPSDLGYDET 87
Query: 148 VKSLVAQTLKDLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLK 207
+K+L +LK LG Y+DL+LIHWP P + W AL EL + G ++
Sbjct: 88 LKAL-EASLKRLGLDYVDLYLIHWPV--------PNKYVVIEETWKALEELVD--EGLIR 136
Query: 208 SIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLG-- 265
+IGVSN+ +HL L+ +KV PAVNQ+E+HP +L+ EL+ C ++ IA++AY+ L
Sbjct: 137 AIGVSNFGVEHLEELLSLAKVKPAVNQIEYHP-YLRQPELLPFCQRHGIAVEAYSPLAKG 195
Query: 266 ------STSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNI-ALDFELSPEE 318
+IAK + +PAQV LRW +Q ++IPKS TPERI +N+ A DFELS E+
Sbjct: 196 GKLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEED 255
Query: 319 VKAIENI 325
+ AI+ +
Sbjct: 256 MAAIDAL 262
|
Length = 280 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| KOG1577|consensus | 300 | 100.0 | ||
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575|consensus | 336 | 100.0 | ||
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG1576|consensus | 342 | 100.0 | ||
| KOG1577|consensus | 300 | 99.81 | ||
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 99.8 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 99.48 | |
| KOG1575|consensus | 336 | 99.45 | ||
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 99.44 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 99.2 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 99.18 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 99.17 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 99.16 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 99.15 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 99.06 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 99.06 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 98.97 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 98.95 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 98.81 | |
| KOG3023|consensus | 285 | 98.67 | ||
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 96.13 | |
| PRK10558 | 256 | alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro | 89.08 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 88.64 | |
| PRK10128 | 267 | 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | 87.34 | |
| TIGR03239 | 249 | GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co | 86.75 | |
| cd01973 | 454 | Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -li | 83.3 | |
| TIGR02311 | 249 | HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola | 80.52 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 80.24 |
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-59 Score=414.12 Aligned_cols=237 Identities=43% Similarity=0.701 Sum_probs=221.9
Q ss_pred HHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhcCCCc
Q psy15666 84 AQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGTTY 163 (339)
Q Consensus 84 ~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L~~d~ 163 (339)
+...+..|++ .|+|+||||..||||+.+|+|+++. +++|+++||+||+|+...++ +.+.+++++||++||+||
T Consensus 30 ~~~av~~Al~--~Gyr~IDTA~~YgnE~~VG~aI~~s----~v~ReelFittKvw~~~~~~-~~~~~a~e~Sl~rLg~dy 102 (280)
T COG0656 30 AVRAVRAALE--LGYRLIDTAEIYGNEEEVGEAIKES----GVPREELFITTKVWPSDLGY-DETLKALEASLKRLGLDY 102 (280)
T ss_pred HHHHHHHHHH--hCcceEecHhHhcCHHHHHHHHHhc----CCCHHHeEEEeecCCccCCc-chHHHHHHHHHHHhCCCc
Confidence 7789999999 9999999999999999999999986 89999999999999998888 999999999999999999
Q ss_pred ccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCCCCCC
Q psy15666 164 LDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHFLQ 243 (339)
Q Consensus 164 iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~~~ 243 (339)
||||+||||... ... ...++|++||+++++ |+||+||||||+.++++++++..++.|++||++||++.++
T Consensus 103 vDLyLiHwP~~~------~~~--~~~etw~alE~l~~~--G~ir~IGVSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q 172 (280)
T COG0656 103 VDLYLIHWPVPN------KYV--VIEETWKALEELVDE--GLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQ 172 (280)
T ss_pred eeEEEECCCCCc------cCc--cHHHHHHHHHHHHhc--CCccEEEeeCCCHHHHHHHHHhcCCCCceEEEEeccCCCc
Confidence 999999999321 011 168999999999999 9999999999999999999999999999999999999999
Q ss_pred cHHHHHHHHhCCceEEEecchhH--------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC-CCCC
Q psy15666 244 PQELIDVCNQNKIALQAYASLGS--------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFEL 314 (339)
Q Consensus 244 ~~~l~~~~~~~gi~v~~~~~l~~--------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~-~~~L 314 (339)
.+++++|+++||.+++||||++ .+.+||++||.|++|++|||++++|+++||++++++|++||+++ ++.|
T Consensus 173 -~el~~~~~~~gI~v~AysPL~~g~~l~~~~~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~~~~ri~eN~~~~~f~L 251 (280)
T COG0656 173 -PELLPFCQRHGIAVEAYSPLAKGGKLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFEL 251 (280)
T ss_pred -HHHHHHHHHcCCEEEEECCcccccccccChHHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCCCHHHHHHHHhhhcCCC
Confidence 6799999999999999999994 78999999999999999999999999999999999999999999 9999
Q ss_pred CHHHHHHHhcCCCCC---CcccCCCCC
Q psy15666 315 SPEEVKAIENIPNKQ---KYCWNPDKI 338 (339)
Q Consensus 315 ~~~~~~~l~~~~~~~---r~~~~~~~~ 338 (339)
|++||++|+++.... +..++|..+
T Consensus 252 s~ed~~~i~~l~~~~~~~~~~~~p~~~ 278 (280)
T COG0656 252 SEEDMAAIDALDRGYGRTRVGPDPEFF 278 (280)
T ss_pred CHHHHHHHHhhccccCcccccCCcccc
Confidence 999999999999987 567787643
|
|
| >KOG1577|consensus | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1575|consensus | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576|consensus | Back alignment and domain information |
|---|
| >KOG1577|consensus | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >KOG1575|consensus | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >KOG3023|consensus | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase | Back alignment and domain information |
|---|
| >cd01973 Nitrogenase_VFe_beta_like Nitrogenase_VFe_beta -like: Nitrogenase VFe protein, beta subunit like | Back alignment and domain information |
|---|
| >TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 339 | ||||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 3e-37 | ||
| 3h7r_A | 331 | Crystal Structure Of The Plant Stress-Response Enzy | 1e-36 | ||
| 1zua_X | 317 | Crystal Structure Of Akr1b10 Complexed With Nadp+ A | 1e-35 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 1e-35 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 2e-35 | ||
| 3h7u_A | 335 | Crystal Structure Of The Plant Stress-Response Enzy | 2e-35 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 2e-35 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 3e-35 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 3e-35 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 7e-35 | ||
| 3f7j_A | 276 | B.Subtilis Yvgn Length = 276 | 3e-34 | ||
| 3d3f_A | 275 | Crystal Structure Of Yvgn And Cofactor Nadph From B | 3e-34 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 4e-34 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 8e-34 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 1e-33 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 1e-33 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 1e-33 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 2e-33 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 2e-33 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 3e-33 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 4e-33 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 5e-33 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 2e-32 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 4e-32 | ||
| 3b3d_A | 314 | B.Subtilis Ytbe Length = 314 | 1e-31 | ||
| 1a80_A | 277 | Native 2,5-Diketo-D-Gluconic Acid Reductase A From | 4e-31 | ||
| 1hw6_A | 278 | Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red | 4e-31 | ||
| 1m9h_A | 278 | Corynebacterium 2,5-dkgr A And Phe 22 Replaced With | 3e-30 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 8e-30 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 3e-29 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 3e-29 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 3e-29 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 8e-29 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 8e-29 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 8e-29 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 8e-29 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 9e-29 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 9e-29 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 9e-29 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 1e-28 | ||
| 3onb_A | 315 | Bond Breakage And Relocation Of A Covalently Bound | 1e-28 | ||
| 3lqg_A | 316 | Human Aldose Reductase Mutant T113a Complexed With | 1e-28 | ||
| 3ld5_A | 316 | Human Aldose Reductase Mutant T113s Complexed With | 2e-28 | ||
| 2pdi_A | 316 | Human Aldose Reductase Mutant L300a Complexed With | 2e-28 | ||
| 2pdm_A | 316 | Human Aldose Reductase Mutant S302r Complexed With | 2e-28 | ||
| 2pdk_A | 316 | Human Aldose Reductase Mutant L301m Complexed With | 2e-28 | ||
| 2is7_A | 315 | Crystal Structure Of Aldose Reductase Complexed Wit | 2e-28 | ||
| 1pwl_A | 316 | Crystal Structure Of Human Aldose Reductase Complex | 2e-28 | ||
| 3rx2_A | 336 | Crystal Structure Of Human Aldose Reductase Complex | 2e-28 | ||
| 2ipw_A | 315 | Crystal Structure Of C298a W219y Aldose Reductase C | 2e-28 | ||
| 1z3n_A | 319 | Human Aldose Reductase In Complex With Nadp+ And Th | 2e-28 | ||
| 2pdq_A | 316 | Human Aldose Reductase Mutant C303d Complexed With | 2e-28 | ||
| 2agt_A | 319 | Aldose Reductase Mutant Leu 300 Pro Complexed With | 2e-28 | ||
| 1el3_A | 316 | Human Aldose Reductase Complexed With Idd384 Inhibi | 2e-28 | ||
| 2pdf_A | 316 | Human Aldose Reductase Mutant L300p Complexed With | 2e-28 | ||
| 2pdb_A | 316 | Human Aldose Reductase Mutant F121p Complexed With | 2e-28 | ||
| 2r24_A | 316 | Human Aldose Reductase Structure Length = 316 | 2e-28 | ||
| 3q67_A | 316 | Human Aldose Reductase C298s Mutant In Complex With | 3e-28 | ||
| 2pdx_A | 316 | Human Aldose Reductase Double Mutant S302r-C303d Co | 3e-28 | ||
| 1ef3_A | 315 | Fidarestat Bound To Human Aldose Reductase Length = | 3e-28 | ||
| 3lbo_A | 316 | Human Aldose Reductase Mutant T113c Complexed With | 3e-28 | ||
| 2pd5_A | 316 | Human Aldose Reductase Mutant V47i Complexed With Z | 3e-28 | ||
| 1abn_A | 315 | The Crystal Structure Of The Aldose Reductase Nadph | 3e-28 | ||
| 3lz5_A | 316 | Human Aldose Reductase Mutant T113v Complexed With | 4e-28 | ||
| 1ah0_A | 316 | Pig Aldose Reductase Complexed With Sorbinil Length | 4e-28 | ||
| 1dla_A | 314 | Novel Nadph-Binding Domain Revealed By The Crystal | 4e-28 | ||
| 1eko_A | 315 | Pig Aldose Reductase Complexed With Idd384 Inhibito | 4e-28 | ||
| 2acu_A | 315 | Tyrosine-48 Is The Proton Donor And Histidine-110 D | 1e-27 | ||
| 3uzw_A | 346 | Crystal Structure Of 5beta-Reductase (Akr1d1) E120h | 1e-27 | ||
| 1xgd_A | 315 | Apo R268a Human Aldose Reductase Length = 315 | 2e-27 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 9e-27 | ||
| 3bur_A | 326 | Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- | 1e-26 | ||
| 3cmf_A | 346 | Crystal Structure Of Human Liver 5beta-Reductase (A | 1e-26 | ||
| 1q13_A | 323 | Crystal Structure Of Rabbit 20alpha Hyroxysteroid D | 5e-26 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 6e-26 | ||
| 1q5m_A | 322 | Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh | 7e-26 | ||
| 1frb_A | 315 | Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | 7e-26 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 1e-24 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 3e-24 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 3e-24 | ||
| 1c9w_A | 315 | Cho Reductase With Nadp+ Length = 315 | 3e-24 | ||
| 2ipg_A | 319 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 3e-24 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 4e-24 | ||
| 3qkz_A | 316 | Crystal Structure Of Mutant His269arg Akr1b14 Lengt | 4e-24 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 4e-24 | ||
| 3o3r_A | 316 | Crystal Structure Of Akr1b14 In Complex With Nadp L | 2e-23 | ||
| 1zgd_A | 312 | Chalcone Reductase Complexed With Nadp+ At 1.7 Angs | 9e-23 | ||
| 1ral_A | 308 | Three-Dimensional Structure Of Rat Liver 3alpha- Hy | 6e-22 | ||
| 1lwi_A | 322 | 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO | 7e-22 | ||
| 1afs_A | 323 | Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr | 7e-22 | ||
| 3ln3_A | 324 | Crystal Structure Of Putative Reductase (Np_038806. | 1e-16 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 5e-09 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 8e-06 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 1e-05 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-05 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-05 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-05 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 1e-04 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 1e-04 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-04 |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
|
| >pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 | Back alignment and structure |
| >pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 | Back alignment and structure |
| >pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 | Back alignment and structure |
| >pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 | Back alignment and structure |
| >pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 | Back alignment and structure |
| >pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 | Back alignment and structure |
| >pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 | Back alignment and structure |
| >pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 | Back alignment and structure |
| >pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 | Back alignment and structure |
| >pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 | Back alignment and structure |
| >pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 | Back alignment and structure |
| >pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 | Back alignment and structure |
| >pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 | Back alignment and structure |
| >pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 | Back alignment and structure |
| >pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 | Back alignment and structure |
| >pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 | Back alignment and structure |
| >pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 | Back alignment and structure |
| >pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 | Back alignment and structure |
| >pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 | Back alignment and structure |
| >pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 | Back alignment and structure |
| >pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 | Back alignment and structure |
| >pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 | Back alignment and structure |
| >pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 | Back alignment and structure |
| >pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 | Back alignment and structure |
| >pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 | Back alignment and structure |
| >pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 | Back alignment and structure |
| >pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 | Back alignment and structure |
| >pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 | Back alignment and structure |
| >pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 | Back alignment and structure |
| >pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 | Back alignment and structure |
| >pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 | Back alignment and structure |
| >pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 | Back alignment and structure |
| >pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 2e-93 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 4e-16 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 7e-91 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 3e-16 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 8e-91 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 4e-16 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 3e-90 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 7e-16 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 9e-90 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 1e-17 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 3e-89 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 8e-16 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 2e-88 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 5e-19 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 2e-88 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 2e-16 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 3e-88 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 5e-18 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 3e-87 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 7e-16 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 3e-87 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 3e-15 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 4e-87 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 8e-18 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 2e-86 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 8e-18 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 2e-85 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 2e-14 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 2e-85 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 4e-15 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 1e-84 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 1e-17 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 2e-84 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 1e-15 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 3e-84 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 3e-18 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 4e-84 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 4e-18 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 4e-84 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 4e-18 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 1e-83 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 1e-17 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 3e-83 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 9e-18 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 7e-83 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 1e-17 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 3e-81 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 1e-17 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 3e-61 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 1e-11 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 3e-28 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 3e-24 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 4e-24 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 6e-21 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 8e-19 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 1e-15 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 1e-14 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 1e-14 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 1e-13 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 2e-13 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 2e-13 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 3e-12 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 6e-11 |
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
Score = 278 bits (714), Expect = 2e-93
Identities = 89/249 (35%), Positives = 135/249 (54%), Gaps = 19/249 (7%)
Query: 98 YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
YR IDTA Y NE S+G L+ + RED+FIT+KL G + + ++ +
Sbjct: 49 YRHIDTAAIYKNEESVGAGLR----ASGVPREDVFITTKLWNTEQG-YESTLAAFEESRQ 103
Query: 158 DLGTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAK 217
LG Y+DL+LIHWP G D S + + W A +LY +++IGVSN+
Sbjct: 104 KLGVDYIDLYLIHWP--RGKDILSKEGKKYLDS-WRAFEQLYK--EKKVRAIGVSNFHIH 158
Query: 218 HLVNLIQNSKVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLGS-------TSTQ 270
HL +++ V P VNQVE HP Q +L C+ +I ++A++ LG +
Sbjct: 159 HLEDVLAMCTVTPMVNQVELHPLNNQ-ADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSA 217
Query: 271 IAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFELSPEEVKAIENIPNKQ 329
I ++ + AQV+LRW +Q+N + IPKSV ERI +N + DFEL E+V +I+ +
Sbjct: 218 IGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALNTNS 277
Query: 330 KYCWNPDKI 338
+Y +PD+
Sbjct: 278 RYGPDPDEA 286
|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 99.59 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 99.58 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 99.57 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 99.56 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 99.56 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 99.56 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 99.56 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 99.56 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 99.55 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 99.55 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 99.55 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 99.55 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 99.55 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 99.54 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 99.54 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 99.54 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 99.54 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 99.54 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 99.53 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 99.53 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 99.52 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 99.52 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 99.51 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 99.51 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 99.49 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 99.45 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 99.44 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 99.42 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 99.41 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 99.41 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 99.4 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 99.39 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 99.39 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 99.35 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 99.35 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 99.35 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 99.33 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 99.32 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 99.29 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 99.26 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.84 |
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.7e-55 Score=399.72 Aligned_cols=243 Identities=37% Similarity=0.649 Sum_probs=222.5
Q ss_pred chHHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhcCC
Q psy15666 82 SPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDLGT 161 (339)
Q Consensus 82 ~n~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L~~ 161 (339)
+++..++..|++ .|+|+||||+.||+|+.+|++|++. +++|+++||+||+++...++ +.+++++++||+|||+
T Consensus 35 ~~~~~~v~~Al~--~G~~~~DTA~~Yg~E~~vG~al~~~----~~~R~~~~I~TK~~~~~~~~-~~i~~~~~~SL~rLg~ 107 (288)
T 4f40_A 35 EVTENAVKWALC--AGYRHIDTAAIYKNEESVGAGLRAS----GVPREDVFITTKLWNTEQGY-ESTLAAFEESRQKLGV 107 (288)
T ss_dssp HHHHHHHHHHHH--TTCCEEECCGGGTCHHHHHHHHHHH----TCCGGGCEEEEEECGGGCSH-HHHHHHHHHHHHHHTC
T ss_pred HHHHHHHHHHHH--cCCCeEECcccccCHHHHHHHHHhc----CCChhhEEEEEecCCCcCCH-HHHHHHHHHHHHHhCC
Confidence 667789999999 9999999999999999999999986 77899999999999877666 9999999999999999
Q ss_pred CcccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCCCC
Q psy15666 162 TYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHPHF 241 (339)
Q Consensus 162 d~iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~~~ 241 (339)
||||+|++|||+.... .........++|++|++|+++ ||||+||||||++++++++++.+.++|+++|++||++.
T Consensus 108 dyiDl~llH~p~~~~~---~~~~~~~~~e~~~al~~l~~~--Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~Q~~~~~~~ 182 (288)
T 4f40_A 108 DYIDLYLIHWPRGKDI---LSKEGKKYLDSWRAFEQLYKE--KKVRAIGVSNFHIHHLEDVLAMCTVTPMVNQVELHPLN 182 (288)
T ss_dssp SCEEEEEECCCCCHHH---HHHHCCHHHHHHHHHHHHHHT--TSEEEEEEESCCHHHHHHHHTTCSSCCCEEEEECBTTB
T ss_pred CcEEEEEEecCCCCcc---cccccccHHHHHHHHHHHHHc--CCccEEEeccCCHHHHHHHHHhCCCCCeEEeccCcccc
Confidence 9999999999932100 000012378999999999999 99999999999999999999998889999999999999
Q ss_pred CCcHHHHHHHHhCCceEEEecchhH-------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC-CCC
Q psy15666 242 LQPQELIDVCNQNKIALQAYASLGS-------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL-DFE 313 (339)
Q Consensus 242 ~~~~~l~~~~~~~gi~v~~~~~l~~-------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~-~~~ 313 (339)
++ .+++++|+++||++++|+||++ .+.++|+++|+|++|+||+|++++|+++|||+++++|+++|+++ +++
T Consensus 183 ~~-~~l~~~~~~~gi~v~a~spl~~G~l~~~~~l~~ia~~~g~t~aqvaL~w~l~~~~~~i~g~~~~~~l~en~~~~~~~ 261 (288)
T 4f40_A 183 NQ-ADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSAIGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFE 261 (288)
T ss_dssp CC-HHHHHHHHHTTCEEEEESTTC--CGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCSSHHHHHHHHCCSSCC
T ss_pred CC-HHHHHHHHHCCCEEEEecCCCCCcccccHHHHHHHHHhCCCHHHHHHHHHHhCCCeEeeCCCCHHHHHHHhhhcCCC
Confidence 98 8999999999999999999987 78999999999999999999999999999999999999999999 999
Q ss_pred CCHHHHHHHhcCCCCCCcccCCCC
Q psy15666 314 LSPEEVKAIENIPNKQKYCWNPDK 337 (339)
Q Consensus 314 L~~~~~~~l~~~~~~~r~~~~~~~ 337 (339)
||+++++.|+++.++.|++|||..
T Consensus 262 L~~ee~~~i~~l~~~~r~~~~p~~ 285 (288)
T 4f40_A 262 LGAEDVMSIDALNTNSRYGPDPDE 285 (288)
T ss_dssp CCHHHHHHHHTTCCCCCSSCCTTT
T ss_pred CCHHHHHHHHhhccCCcccCCCCc
Confidence 999999999999999999999975
|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 339 | ||||
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 3e-39 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-05 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 1e-37 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 6e-06 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 7e-37 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 1e-33 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 2e-05 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 2e-33 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 6e-05 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-33 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-04 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 2e-33 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 7e-05 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 3e-32 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 4e-04 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 8e-32 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 8e-26 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 4e-25 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 0.003 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 9e-22 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 4e-18 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 4e-15 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 1e-12 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 2e-12 |
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Aldose reductase (aldehyde reductase) species: Human (Homo sapiens) [TaxId: 9606]
Score = 138 bits (349), Expect = 3e-39
Identities = 91/268 (33%), Positives = 131/268 (48%), Gaps = 33/268 (12%)
Query: 98 YRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLK 157
YR ID A Y NE +G A++ L + +KRE++FI SKL Y+ K +TL
Sbjct: 40 YRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLV-KGACQKTLS 98
Query: 158 DLGTTYLDLFLIHWPGTF---------GVDSSSPQQISNRHTLWNALTELYNPNNGPLKS 208
DL YLDL+LIHWP F + +N W A+ EL + G +K+
Sbjct: 99 DLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD--EGLVKA 156
Query: 209 IGVSNYTAKHLVNLIQNS--KVVPAVNQVEFHPHFLQPQELIDVCNQNKIALQAYASLG- 265
IG+SN+ + ++ K PAVNQ+E HP+ Q + LI C I + AY+ LG
Sbjct: 157 IGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEK-LIQYCQSKGIVVTAYSPLGS 215
Query: 266 ----------------STSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNI- 308
IA H+ + AQVL+R+ +Q N ++IPKSVTPERI +N
Sbjct: 216 PDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFK 275
Query: 309 ALDFELSPEEVKAIENIPNKQKYCWNPD 336
DFELS +++ + + + C
Sbjct: 276 VFDFELSSQDMTTLLSYNRNWRVCALLS 303
|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 99.33 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 99.28 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 99.27 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 99.25 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 99.23 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 99.21 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 99.19 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 99.18 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 99.17 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 99.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 98.91 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 98.87 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 98.83 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 98.8 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 98.76 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 98.0 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 93.05 |
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: 2,5-diketo-D-gluconic acid reductase A species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3e-48 Score=349.08 Aligned_cols=238 Identities=35% Similarity=0.627 Sum_probs=219.7
Q ss_pred CCchHHHHHHHHhhhccCcccccccccccCHHHHHHHHHhhcccCCCCCCceEEEeccCCCCCCCHHHHHHHHHHHHHhc
Q psy15666 80 SVSPAQVLLRWALQENFCYRAIDTAQEYGNEASIGRALKVLLPKFNLKREDIFITSKLSPQYNGNADQVKSLVAQTLKDL 159 (339)
Q Consensus 80 ~~~n~~~~~~~al~~~~g~~~iDta~~y~~E~~lG~al~~~~~~~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~sL~~L 159 (339)
..+++..++..|++ .|+|+||||+.||||+.+|++|++. +..|++++|+||..... . +.+.+++++||+||
T Consensus 25 ~~~ea~~~l~~A~d--~Gin~~DTA~~YgsE~~lG~~l~~~----~~~~~~~~i~tk~~~~~--~-~~~~~~~~~Sl~rL 95 (274)
T d1mzra_ 25 SNEEVITAIQKALE--VGYRSIDTAAAYKNEEGVGKALKNA----SVNREELFITTKLWNDD--H-KRPREALLDSLKKL 95 (274)
T ss_dssp CHHHHHHHHHHHHH--HTCCEEECCGGGTCHHHHHHHHHHS----CSCGGGCEEEEEECGGG--T-TCHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHH--cCCCEEECcCccCCHHHHHHHhhcc----ccccccccccccccccc--c-hhHHHHHHHHHHhc
Confidence 34667789999999 9999999999999999999999987 77899999999997763 3 56999999999999
Q ss_pred CCCcccEEEeecCCCCCCCCCCCcccccHHHHHHHHHHhhCCCCCCccEEEecCCCHHHHHHHHHcCCCceeEeccccCC
Q psy15666 160 GTTYLDLFLIHWPGTFGVDSSSPQQISNRHTLWNALTELYNPNNGPLKSIGVSNYTAKHLVNLIQNSKVVPAVNQVEFHP 239 (339)
Q Consensus 160 ~~d~iDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~G~ir~iGvS~~~~~~l~~~~~~~~~~~~~~q~~~~~ 239 (339)
|+||||+|++|+|+. .. ....++|++|++|+++ |+||+||+|||+.+++.++++..++++.++|.++++
T Consensus 96 ~~d~iDl~~lH~~~~--------~~-~~~~~~~~~l~~l~~~--G~i~~iGvs~~~~~~~~~~~~~~~i~~~~~~~~~~~ 164 (274)
T d1mzra_ 96 QLDYIDLYLMHWPVP--------AI-DHYVEAWKGMIELQKE--GLIKSIGVCNFQIHHLQRLIDETGVTPVINQIELHP 164 (274)
T ss_dssp TCSCEEEEEESCCCT--------TT-CCHHHHHHHHHHHHHT--TSEEEEEEESCCHHHHHHHHHHHSCCCSEEEEECBT
T ss_pred CCCeEEEEEecCCCc--------cc-hhHHHHHHHHHHHHHC--CCEEEEeeccccchHHHHHHHhcCCCceeeehhhcc
Confidence 999999999999832 11 1367899999999999 999999999999999999999999999999999988
Q ss_pred CCCCcHHHHHHHHhCCceEEEecchhH---------HHHHHHHHcCCCHHHHHHHHHhhCCcEEecCCCCHHHHHHhhcC
Q psy15666 240 HFLQPQELIDVCNQNKIALQAYASLGS---------TSTQIAKVHSVSPAQVLLRWALQENFLIIPKSVTPERIVQNIAL 310 (339)
Q Consensus 240 ~~~~~~~l~~~~~~~gi~v~~~~~l~~---------~l~~la~~~~~s~~~~al~~~l~~~~~~i~g~~~~~~l~enl~~ 310 (339)
..++ ..++++|+++||++++|+|+++ .+.++|+++|.|++|+||+|++++|+++|+|+++++|+++|+++
T Consensus 165 ~~~~-~~~~~~~~~~~i~v~a~~pl~~G~~~~~~~~~l~~ia~~~g~t~aq~Al~w~l~~~~v~I~G~~~~~~l~en~~a 243 (274)
T d1mzra_ 165 LMQQ-RQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDV 243 (274)
T ss_dssp TBCC-HHHHHHHHHTTCEEEEESTTTTTCTTTTTSHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCCCHHHHHHTTCC
T ss_pred cccc-hhhhhhhhhcceeEEEcChhhcCCCccchhHHHHHHHHHhCCCHHHHHHHHHhcCCCEEEECCCCHHHHHHHHHh
Confidence 8877 8899999999999999999986 79999999999999999999999999999999999999999999
Q ss_pred -CCCCCHHHHHHHhcCCCCCCcccCCCCC
Q psy15666 311 -DFELSPEEVKAIENIPNKQKYCWNPDKI 338 (339)
Q Consensus 311 -~~~L~~~~~~~l~~~~~~~r~~~~~~~~ 338 (339)
+++||++++++|+++.++.|+++||.++
T Consensus 244 ~~~~L~~e~~~~i~~l~~~~r~~~~p~~~ 272 (274)
T d1mzra_ 244 WDFRLDKDELGEIAKLDQGKRLGPDPDQF 272 (274)
T ss_dssp SSCCCCHHHHHHHHTTCCCCCCSCCTTTT
T ss_pred cCCCCCHHHHHHHhCcccCCCCCCCcccc
Confidence 9999999999999999999999999876
|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|