Psyllid ID: psy15668

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----

MTYYMGGDPCSPNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRCVDVCAGQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVINMVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNYKCANPCASGACAPTAQCEVRNHRAVCSCPVGYLGDPYTSCRAECLAHSDCPTDRPSCLGNKCMNPCAGQCGINAKCEVRGATPICSCPRDMTGDPFVRCRPFDKYVAPLINDYLKIYWRYQNNKTIFYVSLVSLNYPYVTPLPDDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYD

cccccccccccccccccccEEcccccccEEEccccccccccccccccccccccccccccccccEEcccccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccEEccccccEEEcccccccccccccccccccccccccccEEccccccccccccEEEccccccccccccccccccccccccccc

cccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccEcccccccccccccEEEcccccEEEEcccccccccccEEEcccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEccccccEEEEccccccccccEcccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccEEcccccccccccEEEEccccccccccccccccccccccEcccc

mtyymggdpcspnpcgsntqcnvasnrpvcsclpghwgnpltycqrgecqdhsdcshskackeyrcvdvcagqcgvnsecnvrnhipvcscppgytgdpltqcrrfdpqelcdrspcgvntrcevinmvptcsclpgytgsplsgcrhecdsdydcgpsqscvnykcanpcasgacaptaqcevrnhravcscpvgylgdpytscraeclahsdcptdrpsclgnkcmnpcagqcginakcevrgatpicscprdmtgdpfvrcrpfdkyvaPLINDYLKIYWRYQNNKTIFYVSLVSlnypyvtplpddlcepnpcgenakcqpgydksgkdrpvctclpgyvgdaltycrrgecqsdaecnyd

*******************QCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRCVDVCAGQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVINMVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNYKCANPCASGACAPTAQCEVRNHRAVCSCPVGYLGDPYTSCRAECLAHSDCPTDRPSCLGNKCMNPCAGQCGINAKCEVRGATPICSCPRDMTGDPFVRCRPFDKYVAPLINDYLKIYWRYQNNKTIFYVSLVSLNYPYVTPLPDDLCEPNPCG**************DRPVCTCLPGYVGDALTYCRRGEC*********

********PCSPNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRG***********KACKEYRCVDVCAGQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVINMVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNYKCANPCASGACAPTAQCEVRNHRAVCSCPVGYLGDPYTSCRAECLAHSDCPTDRPSCLGNKCMNPCAGQCGINAKCEVRGATPICSCPRDMTGDPFVRCRPFDKYVAPLINDYLKIYWRYQNNKTIFYVSLVSLNYPYVTPLPDDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYD

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		365	2.2.26 [Sep-21-2011]
Q9JI71		686	Delta-like protein 4 OS=M	yes	N/A	0.468	0.249	0.259	0.0002
Q9QXX0		1218	Protein jagged-1 OS=Mus m	no	N/A	0.545	0.163	0.261	0.0003
Q63722		1219	Protein jagged-1 OS=Rattu	yes	N/A	0.545	0.163	0.261	0.0003
O00548		723	Delta-like protein 1 OS=H	yes	N/A	0.452	0.228	0.276	0.0004
P07207		2703	Neurogenic locus Notch pr	no	N/A	0.482	0.065	0.284	0.0005
P78504		1218	Protein jagged-1 OS=Homo	no	N/A	0.545	0.163	0.261	0.0006
Q8NFT8		737	Delta and Notch-like epid	no	N/A	0.487	0.241	0.273	0.0006
Q6DI48		772	Delta-like protein A OS=D	no	N/A	0.443	0.209	0.280	0.0008

>sp\|Q9JI71\|DLL4_MOUSE Delta-like protein 4 OS=Mus musculus GN=Dll4 PE=2 SV=2	Back alignment and function desciption

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 76/216 (35%), Gaps = 45/216 (20%)

Query: 5   MGGDPCSPNPCGSNTQCNVASNRPVCSCLPGHWG----NPLTYCQRGECQDHSDCSHSKA 60
           +G   C+ NPC +   C    N   C C PG++G    +    C    C +   C     
Sbjct: 324 LGLSKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHCEHSTLTCADSPCFNGGSCRERNQ 383

Query: 61  CKEYRC--------------VDVCAGQ-CGVNSECNVRNHIPVCSCPPGYTGDPLTQCRR 105
              Y C              VD C    C    +C  R     C C PG+TG   T C  
Sbjct: 384 GSSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCQNRGPSRTCRCRPGFTG---THCEL 440

Query: 106 FDPQELCDRSPCGVNTRCEVINMVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNY 165
                 C RSPC     C  +   P C+C  G++G                   + C   
Sbjct: 441 HISD--CARSPCAHGGTCHDLENGPVCTCPAGFSG-------------------RRCEVR 479

Query: 166 KCANPCASGACAPTAQC--EVRNHRAVCSCPVGYLG 199
              + CASG C   A C   +  +  VC+CP G++G
Sbjct: 480 ITHDACASGPCFNGATCYTGLSPNNFVCNCPYGFVG 515

Plays a role in the Notch signaling pathway. Activates Notch-1 and Notch-4.
Mus musculus (taxid: 10090)

>sp\|Q9QXX0\|JAG1_MOUSE Protein jagged-1 OS=Mus musculus GN=Jag1 PE=1 SV=1	Back alignment and function description

>sp\|Q63722\|JAG1_RAT Protein jagged-1 OS=Rattus norvegicus GN=Jag1 PE=1 SV=2	Back alignment and function description

>sp\|O00548\|DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens GN=DLL1 PE=2 SV=2	Back alignment and function description

>sp\|P07207\|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3	Back alignment and function description

>sp\|P78504\|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 PE=1 SV=3	Back alignment and function description

>sp\|Q8NFT8\|DNER_HUMAN Delta and Notch-like epidermal growth factor-related receptor OS=Homo sapiens GN=DNER PE=1 SV=1	Back alignment and function description

>sp\|Q6DI48\|DLLA_DANRE Delta-like protein A OS=Danio rerio GN=dla PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		365
328700379		417	PREDICTED: neurogenic locus notch homolo	0.873	0.764	0.654	1e-127
242010907		387	conserved hypothetical protein [Pediculu	0.879	0.829	0.590	1e-112
91085479		475	PREDICTED: similar to CG9572 CG9572-PA i	0.854	0.656	0.552	1e-106
270008367		328	hypothetical protein TcasGA2_TC014865 [T	0.854	0.951	0.552	1e-105
347969091		414	AGAP003027-PA [Anopheles gambiae str. PE	0.863	0.760	0.558	1e-99
157136701		469	hypothetical protein AaeL_AAEL013612 [Ae	0.871	0.678	0.532	1e-98
195438713		951	GK16269 [Drosophila willistoni] gi\|19416	0.854	0.328	0.543	7e-98
195131587		400	GI15819 [Drosophila mojavensis] gi\|19390	0.854	0.78	0.543	5e-95
195394021		388	GJ18671 [Drosophila virilis] gi\|19415015	0.854	0.804	0.538	7e-95
332373608		509	unknown [Dendroctonus ponderosae]	0.857	0.614	0.501	3e-94

>gi\|328700379\|ref\|XP_001944803.2\| PREDICTED: neurogenic locus notch homolog protein 1-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  462 bits (1188), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 267/359 (74%), Gaps = 40/359 (11%)

Query: 8   DPCSPNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRCV 67
           DPCSP+PCGSNTQC VA  RPVCSCLPGHWGNP  YCQRGEC+ + DC++SKAC+ Y+C 
Sbjct: 36  DPCSPSPCGSNTQCRVAEGRPVCSCLPGHWGNPTNYCQRGECEVNQDCANSKACRNYKCE 95

Query: 68  DVCAGQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVIN 127
           DVC+GQCG N++C+ RNH+ VCSCP  + GDP   CR+ DPQELC  SPCG NT+CEVIN
Sbjct: 96  DVCSGQCGRNADCSPRNHVAVCSCPARHVGDPSVSCRQMDPQELCYPSPCGQNTKCEVIN 155

Query: 128 MVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNYKCANPCASGACAPTAQCEVRNH 187
            VP C+CLPGY GSP SGCRHECDSDYDCGPSQ C  YKC + C+ G CAPTA C+V NH
Sbjct: 156 DVPVCTCLPGYIGSPSSGCRHECDSDYDCGPSQMCQQYKCTSACSPGTCAPTAICDVHNH 215

Query: 188 RAVCSCPVGYLGDPYTSCRAECLAHSDCPTDRPSCLGNKCMNPCAGQ-CGINAKCEVRGA 246
           RA CSCP GY GDPYTSCRAECL+H+DCP DRP+CLG +C+NPC+G  CG+NA CE RGA
Sbjct: 216 RASCSCPKGYFGDPYTSCRAECLSHADCPADRPACLGERCVNPCSGSGCGVNANCEARGA 275

Query: 247 TPICSCPRDMTGDPFVRCRPFDKYVAPLINDYLKIYWRYQNNKTIFYVSLVSLNYPYVTP 306
           TPICSCPR MTGDPFVRCRPF+                                      
Sbjct: 276 TPICSCPRTMTGDPFVRCRPFE-------------------------------------- 297

Query: 307 LPDDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYD 365
            P DLCEPNPCGENA+CQPG+D +GK+RPVCTCLPGY GDALT CRRGEC  D EC +D
Sbjct: 298 -PADLCEPNPCGENARCQPGHDVTGKERPVCTCLPGYTGDALTRCRRGECSVDDECRHD 355

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242010907\|ref\|XP_002426199.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212510250\|gb\|EEB13461.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|91085479\|ref\|XP_975880.1\| PREDICTED: similar to CG9572 CG9572-PA isoform 2 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|270008367\|gb\|EFA04815.1\| hypothetical protein TcasGA2_TC014865 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|347969091\|ref\|XP_311849.4\| AGAP003027-PA [Anopheles gambiae str. PEST] gi\|333467703\|gb\|EAA07856.5\| AGAP003027-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|157136701\|ref\|XP_001656882.1\| hypothetical protein AaeL_AAEL013612 [Aedes aegypti] gi\|108869890\|gb\|EAT34115.1\| AAEL013612-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|195438713\|ref\|XP_002067277.1\| GK16269 [Drosophila willistoni] gi\|194163362\|gb\|EDW78263.1\| GK16269 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|195131587\|ref\|XP_002010232.1\| GI15819 [Drosophila mojavensis] gi\|193908682\|gb\|EDW07549.1\| GI15819 [Drosophila mojavensis]	Back alignment and taxonomy information

>gi\|195394021\|ref\|XP_002055644.1\| GJ18671 [Drosophila virilis] gi\|194150154\|gb\|EDW65845.1\| GJ18671 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|332373608\|gb\|AEE61945.1\| unknown [Dendroctonus ponderosae]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		365
FB\|FBgn0053196		22	dp "dumpy" [Drosophila melanog	0.939	15.59	0.374	1.6e-57
UNIPROTKB\|F1NZ70		2548	Gga.54229 "Uncharacterized pro	0.887	0.127	0.258	5.6e-15
UNIPROTKB\|B4DYR1		1059	JAG1 "Delta-like protein" [Hom	0.841	0.289	0.281	2.6e-14
UNIPROTKB\|P78504		1218	JAG1 "Protein jagged-1" [Homo	0.841	0.252	0.281	3.2e-14
WB\|WBGene00013416		1714	Y64G10A.7 [Caenorhabditis eleg	0.616	0.131	0.285	1.2e-11
UNIPROTKB\|F1Q2J4		2057	NOTCH3 "Uncharacterized protei	0.621	0.110	0.294	9.8e-14
RGD\|2318639		232	LOC100365646 "hypothetical pro	0.539	0.849	0.273	4.8e-14
MGI\|MGI:107471		1964	Notch4 "notch 4" [Mus musculus	0.6	0.111	0.278	5.8e-13
UNIPROTKB\|J9PA37		1672	NOTCH4 "Uncharacterized protei	0.832	0.181	0.261	5.1e-14
UNIPROTKB\|E2QUR0		1218	JAG1 "Delta-like protein" [Can	0.843	0.252	0.277	7e-14

FB\|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 618 (222.6 bits), Expect = 1.6e-57, P = 1.6e-57
 Identities = 143/382 (37%), Positives = 192/382 (50%)

Query:     9 PCSPNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRCVD 68
             PC+P+PCG+N  C   +    CSCLP + G+P T C R EC  +SDCS ++AC   +C D
Sbjct: 10554 PCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTEC-RPECVLNSDCSKNRACLNNKCRD 10612

Query:    69 VCAGQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFD----PQELCDRSPCGVNTRCE 124
              C G CGV++EC+V NH P CSCP G+TG+P   CR       P E C  SPCG  ++C 
Sbjct: 10613 PCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCR 10672

Query:   125 VINMVPTCSCLPGYTGSPLSGCRHECDSDYDCGPSQSCVNYKCANPCASGACAPTAQCEV 184
              +N    CSC+  Y G+P   CR EC    +C   ++CVN +CA+PC  G C   A C+V
Sbjct: 10673 EVNGHAVCSCVTNYIGTP-PACRPECSVSSECAQDRACVNQRCADPCP-GTCGNEAICKV 10730

Query:   185 RNHRAVCSCPVGYLGDPYTSCRAECLAHSDCPTDRPSCLGNKCMNPCA-GQCGINAKCEV 243
              NH  +CSCP GY GDP+      C    + P ++P    N+  NPC    CG N++C V
Sbjct: 10731 TNHNPICSCPAGYSGDPFV----RCAPWQEEP-EQPK--SNE--NPCVPSPCGRNSQCRV 10781

Query:   244 RGATPICSCPRDMTGDPFVRCRPFDKYVAPLINDYLKIYWRYQN---NKTIFYVSLVSLN 300
              G T +CSC  +  G     CRP          +   I  R Q+       F      +N
Sbjct: 10782 VGETGVCSCLPNFVGRA-PNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVN 10840

Query:   301 YPYV-------TPLPDDLCEPNPCG---EN-AKCQP---GYDKSGKDRP---VCTCLPGY 343
             +  +       T  P   C P P     E    CQP   G +   ++R     CTCLP Y
Sbjct: 10841 HSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEY 10900

Query:   344 VGDALTYCRRGECQSDAECNYD 365
              GD  + CR  EC  +++C+ D
Sbjct: 10901 FGDPYSGCRP-ECVVNSDCSRD 10921

GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP

GO:0005578 "proteinaceous extracellular matrix" evidence=NAS

GO:0007424 "open tracheal system development" evidence=IMP

GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA

GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA

GO:0004519 "endonuclease activity" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP

GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP

GO:0031012 "extracellular matrix" evidence=ISM

GO:0005201 "extracellular matrix structural constituent" evidence=ISM

GO:0046331 "lateral inhibition" evidence=IMP

UNIPROTKB\|F1NZ70 Gga.54229 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DYR1 JAG1 "Delta-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P78504 JAG1 "Protein jagged-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

WB\|WBGene00013416 Y64G10A.7 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q2J4 NOTCH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|2318639 LOC100365646 "hypothetical protein LOC100365646" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:107471 Notch4 "notch 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PA37 NOTCH4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QUR0 JAG1 "Delta-like protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		365
KOG4289\|consensus		2531		99.74
KOG1214\|consensus		1289		99.62
KOG1214\|consensus		1289		99.56
KOG4289\|consensus		2531		99.5
KOG1217\|consensus		487		99.49
KOG1219\|consensus		4289		99.41
KOG1219\|consensus		4289		99.39
KOG1217\|consensus		487		99.33
KOG1225\|consensus		525		98.93
KOG0994\|consensus		1758		98.91
KOG1225\|consensus		525		98.88
KOG4260\|consensus		350		98.79
KOG0994\|consensus		1758		98.74
KOG4260\|consensus		350		98.46
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	98.38
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	98.27
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	98.19
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	98.12
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	97.92
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	97.89
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	97.85
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.8
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.67
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.61
KOG1836\|consensus		1705		97.6
cd00053		36	EGF Epidermal growth factor domain, found in epide	97.35
KOG1226\|consensus		783		97.31
smart00181		35	EGF Epidermal growth factor-like domain.	97.3
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	97.22
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	97.2
KOG1226\|consensus		783		97.16
PF12662		24	cEGF: Complement Clr-like EGF-like	97.15
KOG1836\|consensus		1705		97.06
cd00053		36	EGF Epidermal growth factor domain, found in epide	96.65
PF12662		24	cEGF: Complement Clr-like EGF-like	96.36
smart00181		35	EGF Epidermal growth factor-like domain.	96.35
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	96.16
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	96.14
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	94.84
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	94.49
PF12661		13	hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E	94.23
PF12946		37	EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730	91.47
PF12946		37	EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730	87.35
KOG3512\|consensus		592		86.45
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	85.35
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	81.61
smart00051		63	DSL delta serrate ligand.	80.51

>KOG4289\|consensus	Back alignment and domain information

Probab=99.74  E-value=5e-17  Score=163.42  Aligned_cols=108  Identities=31%  Similarity=0.749  Sum_probs=89.3

Q ss_pred             cCCCCCCCCCCCCCCeeeec----------------------CCCceeeCCCCCccCCCCCccCCCccCCCCCCCCCccc
Q psy15668          5 MGGDPCSPNPCGSNTQCNVA----------------------SNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACK   62 (365)
Q Consensus         5 ~did~C~~~~C~~~~~C~~~----------------------~~~~~C~C~~G~~g~~~~~C~~~~C~~~~~C~~~~~C~   62 (365)
                      .|-+.|...||.+..+|+.+                      .+++.|.||+||+|+   .|+.    .           
T Consensus      1177 fdDniClrEPCenymkCvsvlrFdssapf~~s~s~lfRpi~pvnglrCrCPpGFTgd---~CeT----e----------- 1238 (2531)
T KOG4289|consen 1177 FDDNICLREPCENYMKCVSVLRFDSSAPFLASDSVLFRPIHPVNGLRCRCPPGFTGD---YCET----E----------- 1238 (2531)
T ss_pred             ccCchhhcchhHHHHhhhhheeecccCccccccceeeeeccccCceeEeCCCCCCcc---cccc----h-----------
Confidence            45677999999998889743                      468899999999999   6653    2           


Q ss_pred             CCccccccccC-CCCCCeeeecCCCceeeCCCCCccCCCCCcccCCCCCCCCCCCCCCCCeeeeC-CCCceeeCCCC
Q psy15668         63 EYRCVDVCAGQ-CGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVI-NMVPTCSCLPG  137 (365)
Q Consensus        63 ~~~C~~~C~~~-C~~~~~C~~~~g~~~C~C~~G~~g~~~~~C~~~~~~~~C~~~~C~~~~~C~~~-~~~~~C~C~~G  137 (365)
                          +|.|... |+++++|...+|+|.|.|.+||+|.   .|+.......|.+..|.++++|++. .+++.|.|+.|
T Consensus      1239 ----iDlCYs~pC~nng~C~srEggYtCeCrpg~tGe---hCEvs~~agrCvpGvC~nggtC~~~~nggf~c~Cp~g 1308 (2531)
T KOG4289|consen 1239 ----IDLCYSGPCGNNGRCRSREGGYTCECRPGFTGE---HCEVSARAGRCVPGVCKNGGTCVNLLNGGFCCHCPYG 1308 (2531)
T ss_pred             ----hHhhhcCCCCCCCceEEecCceeEEecCCcccc---ceeeecccCccccceecCCCEEeecCCCceeccCCCc
Confidence                4444444 8999999999999999999999999   9986644466888999999999987 57888999987

>KOG1214\|consensus	Back alignment and domain information

>KOG1214\|consensus	Back alignment and domain information

>KOG4289\|consensus	Back alignment and domain information

>KOG1217\|consensus	Back alignment and domain information

>KOG1219\|consensus	Back alignment and domain information

>KOG1219\|consensus	Back alignment and domain information

>KOG1217\|consensus	Back alignment and domain information

>KOG1225\|consensus	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>KOG1225\|consensus	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>KOG1836\|consensus	Back alignment and domain information

>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium

Back alignment and domain information

>KOG1226\|consensus	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>KOG1226\|consensus	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>KOG1836\|consensus	Back alignment and domain information

Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A	Back alignment and domain information

>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein	Back alignment and domain information

>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein	Back alignment and domain information

>KOG3512\|consensus	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>smart00051 DSL delta serrate ligand	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		365
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	2e-05
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	4e-04
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	9e-04

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687	Back alignment and structure

 Score = 45.5 bits (107), Expect = 2e-05
 Identities = 38/209 (18%), Positives = 50/209 (23%), Gaps = 31/209 (14%)

Query: 8   DPCSPNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRC- 66
                +       C   +N  +CS L          C  G+C  H+     K      C 
Sbjct: 462 QTQGRSSQELEGSCRKDNNSIICSGLGD--------CVCGQCLCHTSDVPGKLIYGQYCE 513

Query: 67  VDVCAGQCGVNSECNVRNHIP----VCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTR 122
            D    +      C            C C PG+ G      R  +      R  C    R
Sbjct: 514 CDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGR 573

Query: 123 CEVINMVPTCSCLPGYTG---SPLSGCRHECDSDYDCGPSQSCV--------NYKCANPC 171
           C        C C  GY         GC   C     C               +  C    
Sbjct: 574 CR----CNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQ 629

Query: 172 ASGACAPTAQCEVRNHRAVCSCPVGYLGD 200
            S        C+ R+      C V Y  +
Sbjct: 630 LSNNPVKGRTCKERD---SEGCWVAYTLE 655

PyMOL of 3k6s

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		365
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.84
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.83
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.82
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.81
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.79
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.76
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.75
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.74
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.74
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.72
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.67
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	99.65
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.64
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.64
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	99.63
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.62
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.61
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.6
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	99.59
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	99.53
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.53
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.5
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.46
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.39
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.37
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.32
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	99.27
1aut_L		114	Activated protein C; serine proteinase, plasma cal	99.27
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.27
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.26
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.24
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	99.21
1aut_L		114	Activated protein C; serine proteinase, plasma cal	99.17
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	99.17
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	99.16
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	99.15
2vh0_B		134	Activated factor XA light chain; serine protease,	99.14
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	99.13
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.1
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.09
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.04
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	98.96
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	98.96
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	98.95
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	98.93
2vh0_B		134	Activated factor XA light chain; serine protease,	98.9
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	98.9
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.89
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	98.88
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.85
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	98.82
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.73
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	98.72
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	98.7
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.68
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.62
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.56
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	98.53
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.48
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	98.45
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.43
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	98.42
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.42
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.41
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.4
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	98.36
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	98.31
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	98.31
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	98.3
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	98.17
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.02
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	98.02
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	98.0
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	97.99
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	97.91
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.9
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	97.79
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	97.7
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	97.7
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	97.63
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	97.55
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.54
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	97.5
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	97.4
1ob1_C		99	Major merozoite surface protein; immune system, im	97.38
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	97.33
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.3
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	97.29
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.23
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	97.21
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	97.15
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	97.15
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	96.99
1ob1_C		99	Major merozoite surface protein; immune system, im	96.97
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	96.92
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	96.85
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	96.81
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	96.8
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	96.75
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	96.6
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	96.56
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	96.52
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	96.43
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	96.36
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	96.24
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	96.18
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	96.02
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	95.85
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	95.58
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	95.56
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	95.55
2wph_E		59	Coagulation factor IXA light chain; serine proteas	95.13
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	94.54
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	94.33
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	94.0
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	93.74
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	93.56
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	93.52
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	93.35
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	93.33
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	93.32
4aqt_A		375	Laminin subunit gamma-1; cell adhesion; HET: NAG B	93.12
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	92.94
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	92.34
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	92.23
2wph_E		59	Coagulation factor IXA light chain; serine proteas	92.02
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	91.9
1oig_A		26	Dumpy, CG33196-PB; structural protein; NMR {Drosop	91.67
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	91.52
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	91.46
3f1s_B		283	Vitamin K-dependent protein Z; PZ, ZPI, complex, s	91.1
3qcw_A		1245	Neurexin-1-alpha; synaptic adhesion molecule, cell	90.92
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	90.84
2y38_A		403	Laminin subunit alpha-5; structural protein, cell	90.55
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	90.39
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	89.55
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	88.72
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	88.67
1szb_A		170	Mannose binding lectin-associated serine protease-	87.79
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	87.67
3qcw_A		1245	Neurexin-1-alpha; synaptic adhesion molecule, cell	87.43
1szb_A		170	Mannose binding lectin-associated serine protease-	87.32
3fby_A		551	COMP, cartilage oligomeric matrix protein; signatu	82.23
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	81.47

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

Probab=99.84  E-value=1.2e-20  Score=151.45  Aligned_cols=117  Identities=32%  Similarity=0.666  Sum_probs=99.5

Q ss_pred             ecCCCCCC--CCCCCCCCeeeecCCCceeeCCCCCccCCCCCccCCCccCCCCCCCCCcccCCccccccccCCCCCCeee
Q psy15668          4 YMGGDPCS--PNPCGSNTQCNVASNRPVCSCLPGHWGNPLTYCQRGECQDHSDCSHSKACKEYRCVDVCAGQCGVNSECN   81 (365)
Q Consensus         4 ~~did~C~--~~~C~~~~~C~~~~~~~~C~C~~G~~g~~~~~C~~~~C~~~~~C~~~~~C~~~~C~~~C~~~C~~~~~C~   81 (365)
                      .+|||||+  .+||.++|+|+++.++|+|.|++||+|.   .|+    .++++|...              .|.++++|+
T Consensus         2 c~dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~---~C~----~~~~~C~~~--------------~C~~~~~C~   60 (135)
T 2vj3_A            2 AQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP---RCE----IDVNECVSN--------------PCQNDATCL   60 (135)
T ss_dssp             -CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEEST---TSC----EECCTTTTC--------------CCCSSCEEE
T ss_pred             CcccccccCCCCCCCCCCEeECCCCCEEEECCCCCcCC---ccc----ccCccCCCC--------------CCCCCCEEe
Confidence            36899998  7899999999999999999999999998   554    244555432              167789999


Q ss_pred             ecCCCceeeCCCCCccCCCCCcccCCCCCCCCCCCCCCCCeeeeCCCCceeeCCCCCCCCCCCCCCCCCCCC
Q psy15668         82 VRNHIPVCSCPPGYTGDPLTQCRRFDPQELCDRSPCGVNTRCEVINMVPTCSCLPGYTGSPLSGCRHECDSD  153 (365)
Q Consensus        82 ~~~g~~~C~C~~G~~g~~~~~C~~~~~~~~C~~~~C~~~~~C~~~~~~~~C~C~~G~~g~~~~~~~~~C~~~  153 (365)
                      +..++|+|.|++||+|.   .|+...  ++|...+|.++++|++..++|+|.|++||+|.       .|+..
T Consensus        61 ~~~g~~~C~C~~G~~G~---~C~~~~--~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~-------~C~~~  120 (135)
T 2vj3_A           61 DQIGEFQCICMPGYEGV---HCEVNT--DECASSPCLHNGRCLDKINEFQCECPTGFTGH-------LCQVD  120 (135)
T ss_dssp             ECSSCEEEECCTTEESS---SSCEEC--CTTTTCCSTTTCEEEECSSCEEEECCTTEESS-------SSCEE
T ss_pred             CCCCCceeeCCCCCcCC---cceecC--CcccCCCcCCCCEeECCCCCeEEECCCCCcCC-------ccCcc
Confidence            99999999999999998   897432  88998999999999999999999999999998       78754

PyMOL of 2vj3

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ...

Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus}	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens}	Back alignment and structure

>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A*	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus}	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A*	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens}	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		365
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	99.12
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	99.05
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	99.04
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	99.04
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.87
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.87
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.75
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.72
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.7
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.67
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.61
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.6
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.59
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.58
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.57
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.53
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	98.51
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	98.49
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.49
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	98.41
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.4
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	98.39
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.35
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	98.31
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	98.25
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.24
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	98.2
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	98.18
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.1
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.1
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	98.09
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	98.09
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	98.04
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	98.04
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	97.95
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	97.94
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	97.94
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	97.91
d1szba2		45	Mannose-binding protein associated serine protease	97.9
d1nt0a3		45	Mannose-binding protein associated serine protease	97.87
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.83
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.81
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	97.78
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	97.73
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	97.68
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.63
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	97.61
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	97.59
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	97.5
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.44
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	97.43
d1szba2		45	Mannose-binding protein associated serine protease	97.29
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	97.29
d1nt0a3		45	Mannose-binding protein associated serine protease	97.28
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.13
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	96.81
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	96.49
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	96.47
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	96.18
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	96.05
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	95.72
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	95.5
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	95.32
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	94.8
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	94.52
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	94.49
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	94.33
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	94.16
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	93.7
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	93.47
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	93.23
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	93.21
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	93.12
d1dx5i1		43	Thrombomodulin, different EGF-like domains {Human	92.35
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	91.51
d1rfnb_		57	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	91.0
d1kloa1		55	Laminin gamma1 chain {Mouse (Mus musculus) [TaxId:	90.6
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	89.89
d1dx5i1		43	Thrombomodulin, different EGF-like domains {Human	88.88
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	86.44
d1kloa1		55	Laminin gamma1 chain {Mouse (Mus musculus) [TaxId:	85.34
d2bz6l1		53	Coagulation factor VIIa {Human (Homo sapiens) [Tax	85.31
d1rfnb_		57	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	84.95

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.12  E-value=2.9e-11  Score=71.77  Aligned_cols=35  Identities=34%  Similarity=0.694  Sum_probs=34.0

Q ss_pred             cCCCCCCCCCCCCCCeeeecCCCceeeCCCCCccC
Q psy15668          5 MGGDPCSPNPCGSNTQCNVASNRPVCSCLPGHWGN   39 (365)
Q Consensus         5 ~did~C~~~~C~~~~~C~~~~~~~~C~C~~G~~g~   39 (365)
                      +|+|+|.++||.++|+|++..++|+|.|++||+|.
T Consensus         1 id~d~C~~~PC~ngg~C~~~~~~y~C~C~~g~~G~   35 (39)
T d1edmb_           1 VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGK   35 (39)
T ss_dssp             CCCCTTTTCCCCTTCEEEEETTEEEEECCTTCCST
T ss_pred             CccccCCCCCCCCCcEEEcCCCCEEEECCCCCCCC
Confidence            58999999999999999999999999999999999

PyMOL of d1edmb_

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure