Psyllid ID: psy15697

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MTPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEIHDDEAEDDGEEEAVDDPDEIDEEEQPRQDRNNPGTQRLARLLNYFR
ccHHHHHHHHcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEEcccEEEEEcccccccccccccccccEEEEEEEcccccEEEEEcccccccccHHHHHccHHHHHHHcccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHcc
ccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEEEccEEEEEEccccHcHHcccccccEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHcHHcccHHHHHHHHHHHHHHHHHHcc
MTPFAFKEAFRLSATQVEFILEEiapalttpternVALSAKEKVLSCLHwmgvgspyhiigathgpskssicrsiheVVPVIVDTFFQRMVkwpeenlndipmtflrkggfpnvagcvdgtmvlidapnehedqfvnrngdhaLNVMaicgpnykfyavnanwpgsvhDARVMRNSmvyrkfdeegwrpfpdavilgdsayplkewlipprtrnpdaaaDQRFLRCHKRTRRLIENSFGIlkekfpclnymrlspqFAGMVVLASTTLhnialtidrdnenqnveihddeaeddgeeeavddpdeideeeqprqdrnnpgtQRLARLLNYFR
MTPFAFKEAFRLSATQVEFILEEiapalttpterNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKfdeegwrpfPDAVILGDSAYPLKEwlipprtrnpdaaadqrFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIAltidrdnenqnveihddeaeddgeeEAVDDpdeideeeqprqdrnnpgtqrlARLLNYFR
MTPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVeihddeaeddgeeeavddpdeideeeQPRQDRNNPGTQRLARLLNYFR
****AFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRN*DAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTID********************************************************
MTPFAFKEAFRLSATQVEFILEEIAPALT********LSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEIHDDEAEDDGE**************************RLARLLNYFR
MTPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEIH*******************************PGTQRLARLLNYFR
*TPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRD*********D*************DPDEIDEEEQPRQDRNNPGTQRLARLLNYFR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDTFFQRMVKWPEENLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEIHDDEAEDDGEEEAVDDPDEIDEEEQPRQDRNNPGTQRLARLLNYFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q6AZB8349 Putative nuclease HARBI1 no N/A 0.867 0.825 0.278 5e-33
Q96MB7349 Putative nuclease HARBI1 yes N/A 0.789 0.750 0.311 1e-32
Q8BR93349 Putative nuclease HARBI1 yes N/A 0.897 0.853 0.301 6e-32
Q17QR8349 Putative nuclease HARBI1 yes N/A 0.777 0.739 0.296 2e-31
B0BN95349 Putative nuclease HARBI1 yes N/A 0.897 0.853 0.295 2e-31
Q5U538347 Putative nuclease HARBI1 N/A N/A 0.792 0.757 0.281 2e-27
>sp|Q6AZB8|HARB1_DANRE Putative nuclease HARBI1 OS=Danio rerio GN=harbi1 PE=2 SV=1 Back     alignment and function desciption
 Score =  141 bits (356), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 153/320 (47%), Gaps = 32/320 (10%)

Query: 1   MTPFAFKEAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHII 60
           +  F F   F      + +++E +  +L   T+R+ A+S   ++L+ L +   GS    +
Sbjct: 36  LNTFGFPREF------IYYLVELLKDSLLRRTQRSRAISPDVQILAALGFYTSGSFQSKM 89

Query: 61  GATHGPSKSSICRSIHEVVPVIVDTF-----FQRMVKWPEENLNDIPMTFLRKGGFPNVA 115
           G   G S++S+ R +  V   +++       F R     E         F R  G PNV 
Sbjct: 90  GDAIGISQASMSRCVSNVTKALIEKAPEFIGFTR----DEATKQQFKDEFYRIAGIPNVT 145

Query: 116 GCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRN 175
           G VD   + I APN  +  +VN+ G H++N   +C       +   +WPGS+ D  V + 
Sbjct: 146 GVVDCAHIAIKAPNADDSSYVNKKGFHSINCQLVCDARGLLLSAETHWPGSLTDRAVFKQ 205

Query: 176 SMVYRKF-----DEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRT 230
           S V + F     D+EGW       +LGD+ YPLK+WL+ P  ++P++ AD R+   H  T
Sbjct: 206 SNVAKLFEEQENDDEGW-------LLGDNRYPLKKWLMTP-VQSPESPADYRYNLAHTTT 257

Query: 231 RRLIENSFGILKEKFPCLN----YMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEI 286
             +++ +F  ++ +F CL+    Y++ SP+    ++ A   LHNI+L    D        
Sbjct: 258 HEIVDRTFRAIQTRFRCLDGAKGYLQYSPEKCSHIIQACCVLHNISLQSGLDAWTFERTE 317

Query: 287 HDDEAEDDGEEEAVDDPDEI 306
             D++ +D +    DDP+ +
Sbjct: 318 ATDQSGEDIDPSDTDDPEAL 337
Transposase-derived protein that may have nuclease activity (Potential). Does not have transposase activity.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q96MB7|HARB1_HUMAN Putative nuclease HARBI1 OS=Homo sapiens GN=HARBI1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BR93|HARB1_MOUSE Putative nuclease HARBI1 OS=Mus musculus GN=Harbi1 PE=2 SV=1 Back     alignment and function description
>sp|Q17QR8|HARB1_BOVIN Putative nuclease HARBI1 OS=Bos taurus GN=HARBI1 PE=2 SV=1 Back     alignment and function description
>sp|B0BN95|HARB1_RAT Putative nuclease HARBI1 OS=Rattus norvegicus GN=Harbi1 PE=2 SV=1 Back     alignment and function description
>sp|Q5U538|HARB1_XENLA Putative nuclease HARBI1 OS=Xenopus laevis GN=harbi1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
432955674345 PREDICTED: putative nuclease HARBI1-like 0.825 0.794 0.341 6e-39
326668947344 PREDICTED: putative nuclease HARBI1-like 0.795 0.767 0.344 1e-38
432950594346 PREDICTED: putative nuclease HARBI1-like 0.828 0.794 0.334 4e-38
326675671344 PREDICTED: putative nuclease HARBI1-like 0.795 0.767 0.340 5e-38
432850588326 PREDICTED: putative nuclease HARBI1-like 0.786 0.800 0.340 4e-37
326675400344 PREDICTED: putative nuclease HARBI1-like 0.849 0.819 0.329 5e-37
326680520 494 PREDICTED: putative nuclease HARBI1-like 0.849 0.570 0.326 2e-36
166157907371 uncharacterized protein LOC100135188 [Xe 0.870 0.778 0.315 4e-36
148225801371 uncharacterized protein LOC734400 [Xenop 0.876 0.784 0.312 6e-36
328713516358 PREDICTED: putative nuclease HARBI1-like 0.945 0.877 0.322 1e-35
>gi|432955674|ref|XP_004085595.1| PREDICTED: putative nuclease HARBI1-like [Oryzias latipes] Back     alignment and taxonomy information
 Score =  167 bits (423), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 153/284 (53%), Gaps = 10/284 (3%)

Query: 8   EAFRLSATQVEFILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPS 67
           E +R S   + +I   I P ++  +    AL++++ + + L +   GS  + IG     S
Sbjct: 45  ERYRFSLQSITYIHNLIQPFISNISHHGRALTSEQILCAALRFFANGSFLYNIGDAEHIS 104

Query: 68  KSSICRSIHEVVPVIVDTFFQRMVKWP-EENLNDIPMTFLRKGGFPNVAGCVDGTMVLID 126
           K+++CR++ +V  + +  F    + +P  + L  I   F R  GFPNV GC+DGT + I 
Sbjct: 105 KATVCRAVRKVC-LALKRFLHIFIVFPGHKPLRPIKEEFHRIAGFPNVVGCIDGTHIPII 163

Query: 127 APNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEG 186
           APNE+E  +VNR   H++NV  IC   +    V A WPGSVHD+R+ R S +  + +   
Sbjct: 164 APNENEADYVNRKSIHSINVQIICDAAH-ITNVEAKWPGSVHDSRIFRESTLSNRLECGE 222

Query: 187 WRPFPDAVILGDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFP 246
                D  +LGD  YP +  L+ P    P+    QRF   H RTR  +E + G+LK +F 
Sbjct: 223 I----DGFLLGDRGYPCQPKLLTPYP-EPEQGPQQRFNWAHSRTRARVEMTIGLLKARFQ 277

Query: 247 CLNYMRLSPQFAGMVVLASTTLHNIALTIDRDNENQNVEIHDDE 290
           CL ++R++P+ A  +++A   LHNIA  I R  ++  + I D E
Sbjct: 278 CLRHLRVTPERACDIIVACVVLHNIA--ILRGEQHPALHIQDPE 319

Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|326668947|ref|XP_003198900.1| PREDICTED: putative nuclease HARBI1-like [Danio rerio] Back     alignment and taxonomy information
>gi|432950594|ref|XP_004084518.1| PREDICTED: putative nuclease HARBI1-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|326675671|ref|XP_003200405.1| PREDICTED: putative nuclease HARBI1-like [Danio rerio] Back     alignment and taxonomy information
>gi|432850588|ref|XP_004066823.1| PREDICTED: putative nuclease HARBI1-like, partial [Oryzias latipes] Back     alignment and taxonomy information
>gi|326675400|ref|XP_003200346.1| PREDICTED: putative nuclease HARBI1-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680520|ref|XP_003201537.1| PREDICTED: putative nuclease HARBI1-like [Danio rerio] Back     alignment and taxonomy information
>gi|166157907|ref|NP_001107363.1| uncharacterized protein LOC100135188 [Xenopus (Silurana) tropicalis] gi|163916031|gb|AAI57215.1| LOC100135188 protein [Xenopus (Silurana) tropicalis] gi|213624369|gb|AAI71002.1| LOC100135188 protein [Xenopus (Silurana) tropicalis] gi|213625629|gb|AAI71004.1| LOC100135188 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|148225801|ref|NP_001089350.1| uncharacterized protein LOC734400 [Xenopus laevis] gi|62185695|gb|AAH92316.1| MGC115312 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|328713516|ref|XP_003245100.1| PREDICTED: putative nuclease HARBI1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
UNIPROTKB|E1BQ99348 HARBI1 "Uncharacterized protei 0.753 0.718 0.302 1.6e-31
UNIPROTKB|Q96MB7349 HARBI1 "Putative nuclease HARB 0.759 0.722 0.319 3.3e-31
UNIPROTKB|E2RCW9349 HARBI1 "Uncharacterized protei 0.759 0.722 0.315 5.4e-31
UNIPROTKB|F1SIA2349 HARBI1 "Uncharacterized protei 0.759 0.722 0.311 1.1e-30
ZFIN|ZDB-GENE-040608-1349 harbi1 "harbinger transposase 0.746 0.710 0.294 1.1e-30
MGI|MGI:2443194349 Harbi1 "harbinger transposase 0.759 0.722 0.319 2.3e-30
RGD|1584007349 Harbi1 "harbinger transposase 0.759 0.722 0.315 4.9e-30
UNIPROTKB|Q17QR8349 HARBI1 "Putative nuclease HARB 0.759 0.722 0.307 7.9e-30
TAIR|locus:2143104502 AT5G12010 [Arabidopsis thalian 0.795 0.525 0.260 2e-21
ZFIN|ZDB-GENE-081022-77394 zgc:194221 "zgc:194221" [Danio 0.792 0.667 0.265 3e-21
UNIPROTKB|E1BQ99 HARBI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 1.6e-31, P = 1.6e-31
 Identities = 79/261 (30%), Positives = 142/261 (54%)

Query:    19 FILEEIAPALTTPTERNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEV 78
             ++++ +  +L+ PT+R+ A+S + +VL+ L +   GS    +G   G S++S+ R +  V
Sbjct:    48 YLVDLLGASLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANV 107

Query:    79 VPVIVDTFFQRMVKWPEEN--LNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFV 136
                +V+   Q  + +PE+   +  +   F    G P V G VD T V I APN  +  +V
Sbjct:   108 TEALVERAPQ-FIHFPEDEAAVQSLKDDFYALAGMPGVLGVVDCTHVAIKAPNAEDLSYV 166

Query:   137 NRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMRNSMVYRKFDEEGWRPFPDAVIL 196
             NR G H+LN + +C       +   +WPGS+ D  V++ + +  +F+ E ++   D  +L
Sbjct:   167 NRKGLHSLNCLMVCDARGALLSAETHWPGSMPDCNVLQQAALTSQFENELYK---DGWLL 223

Query:   197 GDSAYPLKEWLIPPRTRNPDAAADQRFLRCHKRTRRLIENSFGILKEKFPCLN----YMR 252
             GDS++ L+ WL+ P    P+  A+ R+   H  T  +IE +F  ++ +F CL+     ++
Sbjct:   224 GDSSFFLRTWLMTP-LHIPETPAEYRYNMAHSATHNVIERTFRTIRSRFRCLDGSKGTLQ 282

Query:   253 LSPQFAGMVVLASTTLHNIAL 273
              SP+ +  ++LA   LHNI+L
Sbjct:   283 YSPEKSSHIILACCVLHNISL 303
GO:0005737 "cytoplasm" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
UNIPROTKB|Q96MB7 HARBI1 "Putative nuclease HARBI1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCW9 HARBI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIA2 HARBI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040608-1 harbi1 "harbinger transposase derived 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2443194 Harbi1 "harbinger transposase derived 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1584007 Harbi1 "harbinger transposase derived 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QR8 HARBI1 "Putative nuclease HARBI1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2143104 AT5G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081022-77 zgc:194221 "zgc:194221" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96MB7HARB1_HUMAN3, ., 1, ., -, ., -0.31180.78910.7507yesN/A
B0BN95HARB1_RAT3, ., 1, ., -, ., -0.29550.89750.8538yesN/A
Q8BR93HARB1_MOUSE3, ., 1, ., -, ., -0.30180.89750.8538yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
pfam13359155 pfam13359, DDE_4, DDE superfamily endonuclease 1e-33
>gnl|CDD|222071 pfam13359, DDE_4, DDE superfamily endonuclease Back     alignment and domain information 
 Score =  121 bits (305), Expect = 1e-33
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 16/162 (9%)

Query: 118 VDGTMVLIDAPN---EHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWPGSVHDARVMR 174
           +DGT + I+ P    E    +      + L V+ +  P+ +   V+  WPGSV D R++ 
Sbjct: 1   IDGTEIPIERPKSLEEQAQTYSGYKKHNTLKVLIVVDPDGRIIFVSVGWPGSVSDKRILE 60

Query: 175 NSMVYRKFDEEGWRPFPDAVILGDSAYPLKEWLIPPRTRNPDAA----ADQRFLRCHKRT 230
           NS +  K     +       +L D  +PL + L+ P  + P  A     +  F R     
Sbjct: 61  NSGLLEKLPPGDY-------VLADRGFPLSDSLLAPPAKKPGGAQLTEEEVEFNRRIASA 113

Query: 231 RRLIENSFGILKEKFPCLN-YMRLS-PQFAGMVVLASTTLHN 270
           R  +E   G LK +F  L   +R+S       +VL    LHN
Sbjct: 114 RIHVERVIGRLKGRFRILRGRLRISKLTTLDKIVLVCCALHN 155

This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Length = 155

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
KOG4585|consensus326 100.0
PF13359158 DDE_Tnp_4: DDE superfamily endonuclease 100.0
PF04827205 Plant_tran: Plant transposon protein; InterPro: IP 100.0
PF13612155 DDE_Tnp_1_3: Transposase DDE domain 99.15
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 99.12
PF01609213 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR00 97.79
PF1358688 DDE_Tnp_1_2: Transposase DDE domain 97.66
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 96.74
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 96.4
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 96.29
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 96.03
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 95.54
PF0220936 VHP: Villin headpiece domain; InterPro: IPR003128 95.3
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 95.15
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 95.03
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 94.72
PF1351852 HTH_28: Helix-turn-helix domain 94.67
smart0015336 VHP Villin headpiece domain. 94.6
smart00351125 PAX Paired Box domain. 94.42
PF1334075 DUF4096: Putative transposase of IS4/5 family (DUF 94.38
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 94.1
cd00131128 PAX Paired Box domain 93.77
PRK09413121 IS2 repressor TnpA; Reviewed 93.59
COG3415138 Transposase and inactivated derivatives [DNA repli 93.29
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 93.11
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 93.03
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 92.51
PRK00118104 putative DNA-binding protein; Validated 92.43
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 92.14
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 92.12
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 91.63
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 91.62
PRK12529178 RNA polymerase sigma factor; Provisional 91.36
PRK04217110 hypothetical protein; Provisional 91.23
PRK09639166 RNA polymerase sigma factor SigX; Provisional 90.65
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 90.38
PRK09047161 RNA polymerase factor sigma-70; Validated 89.89
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 89.86
PHA0054282 putative Cro-like protein 89.17
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 89.09
PRK12547164 RNA polymerase sigma factor; Provisional 88.94
PHA0067578 hypothetical protein 88.81
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 88.6
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 88.5
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 88.4
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 88.37
PRK08301234 sporulation sigma factor SigE; Reviewed 88.35
PRK12520191 RNA polymerase sigma factor; Provisional 88.22
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 88.1
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 88.04
PRK12532195 RNA polymerase sigma factor; Provisional 87.95
TIGR0284480 spore_III_D sporulation transcriptional regulator 87.9
PRK15320251 transcriptional activator SprB; Provisional 87.9
PF07374100 DUF1492: Protein of unknown function (DUF1492); In 87.86
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 87.79
PRK12530189 RNA polymerase sigma factor; Provisional 87.74
PF00872381 Transposase_mut: Transposase, Mutator family; Inte 87.71
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 87.62
PRK12533216 RNA polymerase sigma factor; Provisional 87.48
PRK12519194 RNA polymerase sigma factor; Provisional 87.34
PRK12511182 RNA polymerase sigma factor; Provisional 87.3
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 87.25
TIGR02846227 spore_sigmaK RNA polymerase sigma-K factor. The sp 87.18
TIGR02392270 rpoH_proteo alternative sigma factor RpoH. A sigma 87.1
PRK11924179 RNA polymerase sigma factor; Provisional 87.06
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 86.99
PRK03975141 tfx putative transcriptional regulator; Provisiona 86.94
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 86.9
PRK12514179 RNA polymerase sigma factor; Provisional 86.89
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 86.8
PRK05803233 sporulation sigma factor SigK; Reviewed 86.68
PRK12516187 RNA polymerase sigma factor; Provisional 86.64
PRK12524196 RNA polymerase sigma factor; Provisional 86.44
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 86.31
PRK12528161 RNA polymerase sigma factor; Provisional 86.07
PRK12512184 RNA polymerase sigma factor; Provisional 86.06
PRK09415179 RNA polymerase factor sigma C; Reviewed 86.06
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 85.98
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 85.67
PRK09638176 RNA polymerase sigma factor SigY; Reviewed 85.55
PRK09641187 RNA polymerase sigma factor SigW; Provisional 85.22
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 85.19
PRK12544206 RNA polymerase sigma factor; Provisional 85.18
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 85.02
PRK12531194 RNA polymerase sigma factor; Provisional 85.01
PRK12515189 RNA polymerase sigma factor; Provisional 84.94
PRK12540182 RNA polymerase sigma factor; Provisional 84.91
PRK06596284 RNA polymerase factor sigma-32; Reviewed 84.9
PRK12522173 RNA polymerase sigma factor; Provisional 84.84
PRK09645173 RNA polymerase sigma factor SigL; Provisional 84.79
PRK08583257 RNA polymerase sigma factor SigB; Validated 84.79
PRK06030124 hypothetical protein; Provisional 84.78
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 84.76
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 84.72
PRK06759154 RNA polymerase factor sigma-70; Validated 84.56
PRK12537182 RNA polymerase sigma factor; Provisional 84.51
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 84.5
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 84.47
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 84.3
PRK12525168 RNA polymerase sigma factor; Provisional 84.17
TIGR02835234 spore_sigmaE RNA polymerase sigma-E factor. Member 84.14
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 84.11
PRK12523172 RNA polymerase sigma factor; Reviewed 84.01
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 83.99
PRK12534187 RNA polymerase sigma factor; Provisional 83.95
PF13610140 DDE_Tnp_IS240: DDE domain 83.92
PF1373055 HTH_36: Helix-turn-helix domain 83.78
PRK05572252 sporulation sigma factor SigF; Validated 83.78
PRK12539184 RNA polymerase sigma factor; Provisional 83.68
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 83.67
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 83.64
PRK12546188 RNA polymerase sigma factor; Provisional 83.6
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 83.59
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 83.54
PRK05602186 RNA polymerase sigma factor; Reviewed 83.48
TIGR02885231 spore_sigF RNA polymerase sigma-F factor. Members 83.41
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 83.38
PRK12536181 RNA polymerase sigma factor; Provisional 83.37
PF13551112 HTH_29: Winged helix-turn helix 83.26
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 83.25
PRK06811189 RNA polymerase factor sigma-70; Validated 83.22
COG2963116 Transposase and inactivated derivatives [DNA repli 83.18
PF13751125 DDE_Tnp_1_6: Transposase DDE domain 83.16
PRK03573144 transcriptional regulator SlyA; Provisional 82.99
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 82.91
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 82.74
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 82.71
PRK08215258 sporulation sigma factor SigG; Reviewed 82.51
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 82.5
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 82.34
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 82.31
PRK13919186 putative RNA polymerase sigma E protein; Provision 82.29
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 82.2
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 82.04
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 82.01
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 81.96
PF0534465 DUF746: Domain of Unknown Function (DUF746); Inter 81.95
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 81.91
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 81.8
TIGR02850254 spore_sigG RNA polymerase sigma-G factor. Members 81.64
PRK12545201 RNA polymerase sigma factor; Provisional 81.43
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 81.42
PRK12535196 RNA polymerase sigma factor; Provisional 81.39
TIGR02997298 Sig70-cyanoRpoD RNA polymerase sigma factor, cyano 81.32
PRK12543179 RNA polymerase sigma factor; Provisional 81.16
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 81.14
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 80.87
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 80.77
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 80.73
PRK06930170 positive control sigma-like factor; Validated 80.64
PF0829970 Bac_DnaA_C: Bacterial dnaA protein helix-turn-heli 80.43
PRK12541161 RNA polymerase sigma factor; Provisional 80.4
TIGR02941255 Sigma_B RNA polymerase sigma-B factor. This sigma 80.23
PRK15418318 transcriptional regulator LsrR; Provisional 80.16
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 80.12
>KOG4585|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.4e-38  Score=285.58  Aligned_cols=258  Identities=26%  Similarity=0.444  Sum_probs=211.9

Q ss_pred             HhcCCHHHHHHHHHHhccCcCCCCC--CCCC-CCHHHHHHHHHhhhccCCcccccccccCCChhhHHhHHhHhHHHHHHh
Q psy15697          9 AFRLSATQVEFILEEIAPALTTPTE--RNVA-LSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEVVPVIVDT   85 (332)
Q Consensus         9 ~frms~~~F~~L~~~L~~~~~~~~~--~~~~-~~~~~~l~~~L~~L~~g~~~~~l~~~fgis~sTv~r~~~~v~~~l~~~   85 (332)
                      .+++++.+|..++............  .... ++....+++.++.++++.+.+.++..||...+|+     .+...... 
T Consensus         7 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~i~~~fg~~~~~~-----~~~~~~~~-   80 (326)
T KOG4585|consen    7 EFRKSYTTFDKICSLVQSLNVVKNSGFMLSSLLPADTLVAVALWRLKTGESLRTVEKKFGLGQSTC-----KFLEEKED-   80 (326)
T ss_pred             HHHHHHHHHHHHhhhhhhhhhhcccchhhhccccHHhhhhhhhccccccchHHHHHHHcCCcchhh-----hHHHhhhc-
Confidence            6888999999999886654322111  1111 2288899999999999999999999999999998     44444444 


Q ss_pred             hhccccCCCcc-cccchhhhhhhcCCCCCceeeecceEEEEeCCCCCcccccccCCccccceeeeccCCcceEEeeccCC
Q psy15697         86 FFQRMVKWPEE-NLNDIPMTFLRKGGFPNVAGCVDGTMVLIDAPNEHEDQFVNRNGDHALNVMAICGPNYKFYAVNANWP  164 (332)
Q Consensus        86 l~~~~I~~P~~-~~~~~~~~f~~~~~~p~~~G~iDgt~i~i~~P~~~~~~y~~~k~~~s~~~~~v~d~~g~~~~v~~~~~  164 (332)
                      +++.++.||.. .+..+.+.++.   +|+|+|++|+||+++..|+.....|.|+  .++.|+|+|||.+++|++|.+|||
T Consensus        81 ~~~~~~~~p~~~~~~~i~~~~~~---~~~~~g~~d~~hi~~~~~~~~~~~~~n~--~~~~Nvlav~n~d~~f~~v~vg~~  155 (326)
T KOG4585|consen   81 LAPHFLKWPSRRILYEIRERFES---LPNCVGAIDTTHIPIRVPPKSGSVYFNK--EQSKNLLAVCNFDMRFIYVDVGWP  155 (326)
T ss_pred             ccchhhcCchhhhhhhhcccccc---ccchhccccccccceecCcccccccccc--ccchhhhheecCCceEEEEEccCC
Confidence            99999999998 77788887765   9999999999999999999999999988  888899999999999999999999


Q ss_pred             ccccchhhhccccccccccccCCCCC----------CCceEecCCCCCCCCcCCCCccCCC-CChHHHHHHHHHHHHHHH
Q psy15697        165 GSVHDARVMRNSMVYRKFDEEGWRPF----------PDAVILGDSAYPLKEWLIPPRTRNP-DAAADQRFLRCHKRTRRL  233 (332)
Q Consensus       165 Gs~~D~~v~~~s~l~~~l~~~~~~~~----------~~~~llgD~gY~~~~~l~~P~~~~~-~~~~~~~fN~~~s~~R~~  233 (332)
                      ||.||+.|+..+.+.... .... +.          -..+++|+.+||..+++++| +.++ .+..++.||++|+.+|.+
T Consensus       156 Gs~~D~kvl~~~~~~~~~-~~~~-~~k~yl~d~~~~~~~~~~g~~~~~~~~~~~~~-~~~~~~~~~~elFN~rh~~~r~v  232 (326)
T KOG4585|consen  156 GSAHDTKVLQDSLLYKRN-FPHP-PLKYYLVDSGYPLRPGLLGPIGFPLYSLLMFP-YGGPQPTNSQELFNKRHSSLRSV  232 (326)
T ss_pred             CCccHHHHHHhhcccccc-cccC-CccccccccCcccccccccccccccchhhhcc-cCCCCCCchHHHHhhhhhhHHHH
Confidence            999999999999887766 3331 11          02344555555555556666 5555 367888999999999999


Q ss_pred             HHHHHHHHhhhcccc-cccccCcccHHHHHHHHHHHHhhcccCCCCCC
Q psy15697        234 IENSFGILKEKFPCL-NYMRLSPQFAGMVVLASTTLHNIALTIDRDNE  280 (332)
Q Consensus       234 vE~~fg~LK~rf~~L-~~~~~~~~~~~~ii~a~~~LhN~~~~~~~~~~  280 (332)
                      +|++||+||.||+|| +.......+..+||.|||+|||++++..+.++
T Consensus       233 ~e~~fg~lk~rw~il~~~~~~~~~~~~~iV~a~caLHN~~~~~~~~~~  280 (326)
T KOG4585|consen  233 AERAFGVLKAKWRILQRREKYDLKKLPKIVTACCALHNIIRDSDEEDP  280 (326)
T ss_pred             HHHHHHHhhhhhHHHhhcccccccchHHHHHHHHHHHHHHHhhccccc
Confidence            999999999999999 55778899999999999999999998888766

>PF13359 DDE_Tnp_4: DDE superfamily endonuclease Back     alignment and domain information
>PF04827 Plant_tran: Plant transposon protein; InterPro: IPR006912 This entry represents a putative Harbinger transposase-derived nuclease, which is thought to have nuclease activity Back     alignment and domain information
>PF13612 DDE_Tnp_1_3: Transposase DDE domain Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>PF01609 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR002559 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element Back     alignment and domain information
>PF13586 DDE_Tnp_1_2: Transposase DDE domain Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>PF02209 VHP: Villin headpiece domain; InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>smart00153 VHP Villin headpiece domain Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF00872 Transposase_mut: Transposase, Mutator family; InterPro: IPR001207 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor Back     alignment and domain information
>TIGR02392 rpoH_proteo alternative sigma factor RpoH Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>PRK09638 RNA polymerase sigma factor SigY; Reviewed Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06596 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>PRK06030 hypothetical protein; Provisional Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02835 spore_sigmaE RNA polymerase sigma-E factor Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF13610 DDE_Tnp_IS240: DDE domain Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13751 DDE_Tnp_1_6: Transposase DDE domain Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PRK08215 sporulation sigma factor SigG; Reviewed Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>TIGR02850 spore_sigG RNA polymerase sigma-G factor Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02997 Sig70-cyanoRpoD RNA polymerase sigma factor, cyanobacterial RpoD-like family Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>PF08299 Bac_DnaA_C: Bacterial dnaA protein helix-turn-helix; InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02941 Sigma_B RNA polymerase sigma-B factor Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 96.36
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 96.06
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 95.98
1wy3_A35 Villin; structural protein; HET: NLE; 0.95A {Synth 95.45
1und_A37 Advillin, P92; actin binding, F-actin binding, cyt 95.17
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 95.03
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 94.75
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 94.63
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 94.58
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 94.58
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 94.47
1jhg_A101 Trp operon repressor; complex (regulatory protein- 93.94
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 93.42
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 93.26
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 93.02
2jrt_A95 Uncharacterized protein; solution, structure, NESG 92.71
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 92.63
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 92.18
1qzp_A68 Dematin; villin headpiece, actin binding domain, p 92.14
1u78_A141 TC3 transposase, transposable element TC3 transpos 91.99
1u78_A141 TC3 transposase, transposable element TC3 transpos 91.89
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 91.77
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 91.68
1yu8_X67 Villin; alpha helix, 3-10 helix, structural protei 91.67
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 91.51
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 91.23
3c57_A95 Two component transcriptional regulatory protein; 91.21
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 91.05
2k6m_S67 Supervillin; SVHP, HP, headpiece, archvillin, acti 90.94
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 90.83
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 90.55
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 90.47
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 90.4
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 90.25
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 90.12
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 90.05
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 89.57
1ujs_A88 Actin-binding LIM protein homologue; VHP domain, s 89.45
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 89.09
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 88.67
2k27_A159 Paired box protein PAX-8; paired domain, solution 88.0
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 87.63
1iuf_A144 Centromere ABP1 protein; riken structural genomics 87.36
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 86.46
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 85.52
3frw_A107 Putative Trp repressor protein; structural genomic 85.25
3pvv_A101 Chromosomal replication initiator protein DNAA; he 85.04
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 84.29
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; tr 83.7
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 82.55
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 82.31
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 82.09
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 81.62
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 81.57
3ech_A142 MEXR, multidrug resistance operon repressor; winge 81.49
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 81.29
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 81.1
1l0o_C243 Sigma factor; bergerat fold, helix-turn-helix, pro 80.81
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 80.69
4aik_A151 Transcriptional regulator SLYA; transcription, tra 80.26
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 80.19
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
Probab=96.36  E-value=0.0019  Score=40.57  Aligned_cols=43  Identities=16%  Similarity=0.108  Sum_probs=33.8

Q ss_pred             CCCCCHHHHHHHHHhhhccCCcccccccccCCChhhHHhHHhHh
Q psy15697         35 NVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSIHEV   78 (332)
Q Consensus        35 ~~~~~~~~~l~~~L~~L~~g~~~~~l~~~fgis~sTv~r~~~~v   78 (332)
                      ...++++++..+... +..|.++.++|..+|||.+||.+++.+.
T Consensus         3 ~~~l~~~~~~~i~~~-~~~g~s~~~IA~~lgis~~Tv~~~~~~~   45 (51)
T 1tc3_C            3 GSALSDTERAQLDVM-KLLNVSLHEMSRKISRSRHCIRVYLKDP   45 (51)
T ss_dssp             SCCCCHHHHHHHHHH-HHTTCCHHHHHHHHTCCHHHHHHHHHCS
T ss_pred             CCCCCHHHHHHHHHH-HHcCCCHHHHHHHHCcCHHHHHHHHhhH
Confidence            356777777555444 4678999999999999999999998753
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1wy3_A Villin; structural protein; HET: NLE; 0.95A {Synthetic} PDB: 1wy4_A 1yri_A* 1yrf_A* 2f4k_A* 1vii_A 3trv_A* 3trw_A 3tjw_B* 3trv_B* 3try_A* 2ppz_A 2jm0_A* 3tjw_A* 3iur_B* Back     alignment and structure
>1und_A Advillin, P92; actin binding, F-actin binding, cytoskeleton, headpiece subdomain; NMR {Homo sapiens} SCOP: a.14.1.1 Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1qzp_A Dematin; villin headpiece, actin binding domain, protein binding; NMR {Homo sapiens} SCOP: a.14.1.1 PDB: 1zv6_A Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1yu8_X Villin; alpha helix, 3-10 helix, structural protein; 1.45A {Gallus gallus} SCOP: a.14.1.1 PDB: 1qqv_A 1yu5_X 2rjx_A 2rjy_A 1yu7_X 2rjv_A 2rjw_A 3nkj_A 3myc_A 3mya_A 3mye_X 1unc_A Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2k6m_S Supervillin; SVHP, HP, headpiece, archvillin, actin capping, actin-binding, alternative splicing, calcium, cytoplasm, cytoskeleton, membrane; NMR {Homo sapiens} PDB: 2k6n_A Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>1ujs_A Actin-binding LIM protein homologue; VHP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} SCOP: a.14.1.1 PDB: 2l3x_A Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1l0o_C Sigma factor; bergerat fold, helix-turn-helix, protein binding; HET: ADP; 2.90A {Geobacillus stearothermophilus} SCOP: a.4.13.2 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 97.19
d1hlva166 DNA-binding domain of centromere binding protein B 96.31
d1unda_36 Advillin {Human (Homo sapiens) [TaxId: 9606]} 95.21
d1yu8x135 Villin {Chicken (Gallus gallus) [TaxId: 9031]} 95.16
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 95.03
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 94.89
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 93.88
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 93.85
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 93.45
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 93.21
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 92.39
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 91.44
d1qzpa_68 Dematin {Human (Homo sapiens) [TaxId: 9606]} 91.3
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 91.25
d1yu5x167 Villin {Chicken (Gallus gallus) [TaxId: 9031]} 91.15
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 90.73
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 90.63
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 89.48
d1i5za169 Catabolite gene activator protein (CAP), C-termina 89.16
d1yioa170 Response regulatory protein StyR, C-terminal domai 88.75
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 87.95
d1ujsa_88 Actin-binding LIM protein homologue KIAA0843 {Huma 87.0
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 86.57
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 86.27
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 85.95
d2ofya182 Putative transcriptional regulator RHA1_ro04071 {R 85.65
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 84.67
d2p7vb168 Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 84.17
d1zyba173 Probable transcription regulator BT4300, C-termina 84.08
d1ttya_87 Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 84.07
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 83.69
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 83.08
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 82.98
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 82.7
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 81.74
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 80.84
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 80.21
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Recombinase DNA-binding domain
domain: HIN recombinase (DNA-binding domain)
species: Synthetic

Probab=97.19  E-value=8.1e-05  Score=45.43  Aligned_cols=41  Identities=17%  Similarity=0.228  Sum_probs=35.3

Q ss_pred             CCCCCCHHHHHHHHHhhhccCCcccccccccCCChhhHHhHH
Q psy15697         34 RNVALSAKEKVLSCLHWMGVGSPYHIIGATHGPSKSSICRSI   75 (332)
Q Consensus        34 ~~~~~~~~~~l~~~L~~L~~g~~~~~l~~~fgis~sTv~r~~   75 (332)
                      |.+.+++ +|+..+...++.|.+..+||..||||++|++|++
T Consensus         2 R~~~lt~-~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~   42 (47)
T d1ijwc_           2 RPRAINK-HEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF   42 (47)
T ss_dssp             CCCSSCH-HHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred             CCCcCCH-HHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence            3455665 6788888999999999999999999999999986
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unda_ a.14.1.1 (A:) Advillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yu8x1 a.14.1.1 (X:42-76) Villin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1qzpa_ a.14.1.1 (A:) Dematin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yu5x1 a.14.1.1 (X:10-76) Villin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ujsa_ a.14.1.1 (A:) Actin-binding LIM protein homologue KIAA0843 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure