Psyllid ID: psy15708


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
ADQDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKISTQQIEFMEMMTGD
cccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEHHHHHHHHHHcccccccccccHHHHHHHHHHccc
ccccccHHHHcccccEcHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEcccccHHHHHcccccccccEEcccEEEHHHHcccc
adqdldqeqinshgyiptsSLREILAALDEQLTPDQLDEMIEEidtdasgtvdfdgefderqaagsipargkisTQQIEFMEMMTGD
adqdldqeqinshgyiptsSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDErqaagsipargkistqQIEFMEMMTGD
ADQDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKISTQQIEFMEMMTGD
***********************ILA*************************************************************
***DLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQA***********TQQIEFMEMMT**
ADQDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKISTQQIEFMEMMTGD
****LDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKISTQQIEFMEMMT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ADQDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKISTQQIEFMEMMTGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
P47948155 Troponin C, isoform 2 OS= yes N/A 0.597 0.335 0.52 2e-11
P15159153 Troponin C OS=Tachypleus N/A N/A 0.586 0.333 0.513 7e-11
P47949155 Troponin C, isoform 3 OS= no N/A 0.597 0.335 0.493 1e-10
P21798151 Troponin C, isoform 2 OS= N/A N/A 0.586 0.337 0.486 7e-10
P47947154 Troponin C, isoform 1 OS= no N/A 0.586 0.331 0.5 9e-10
Q09665160 Troponin C, isoform 2 OS= yes N/A 0.597 0.325 0.453 2e-09
P06708150 Troponin C, isotype gamma N/A N/A 0.574 0.333 0.465 4e-08
P29289150 Troponin C, isoform 1 OS= N/A N/A 0.586 0.34 0.405 1e-07
P21797158 Troponin C, isoform 1 OS= N/A N/A 0.586 0.322 0.445 3e-07
P29290150 Troponin C, isoform 2A OS N/A N/A 0.586 0.34 0.418 4e-07
>sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 23/75 (30%)

Query: 13  HGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGK 72
           +GYIPTS L+EIL  LD+QLT  +LD MIEEID+D SGTVDFD                 
Sbjct: 104 NGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFD----------------- 146

Query: 73  ISTQQIEFMEMMTGD 87
                 EFMEMMTG+
Sbjct: 147 ------EFMEMMTGE 155





Drosophila melanogaster (taxid: 7227)
>sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 Back     alignment and function description
>sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 Back     alignment and function description
>sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilis PE=1 SV=2 Back     alignment and function description
>sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 Back     alignment and function description
>sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 Back     alignment and function description
>sp|P06708|TNNC2_PONLE Troponin C, isotype gamma OS=Pontastacus leptodactylus PE=1 SV=1 Back     alignment and function description
>sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 Back     alignment and function description
>sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilis PE=1 SV=1 Back     alignment and function description
>sp|P29290|TNNCA_HOMAM Troponin C, isoform 2A OS=Homarus americanus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
389609153151 troponin C [Papilio xuthus] 0.597 0.344 0.64 2e-15
35762343693 troponin C type IIb [Danaus plexippus] 0.597 0.559 0.626 5e-15
58585256148 troponin C type IIb [Apis mellifera] gi| 0.597 0.351 0.6 6e-14
380022635147 PREDICTED: troponin C-like [Apis florea] 0.597 0.353 0.6 6e-14
350426349147 PREDICTED: troponin C-like [Bombus impat 0.597 0.353 0.6 7e-14
156545581147 PREDICTED: troponin C-like [Nasonia vitr 0.586 0.346 0.594 4e-13
383857471147 PREDICTED: troponin C-like [Megachile ro 0.597 0.353 0.573 6e-13
189240428 241 PREDICTED: similar to troponin C type II 0.597 0.215 0.573 7e-13
270011447134 hypothetical protein TcasGA2_TC005470 [T 0.597 0.388 0.573 1e-12
219815476153 troponin C [Tyrophagus putrescentiae] 0.597 0.339 0.573 2e-12
>gi|389609153|dbj|BAM18188.1| troponin C [Papilio xuthus] Back     alignment and taxonomy information
 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 51/75 (68%), Gaps = 23/75 (30%)

Query: 13  HGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGK 72
           +GYIPTSSLREILAALD+QLTPDQL+EMI EIDTDASGTVDFD                 
Sbjct: 100 NGYIPTSSLREILAALDDQLTPDQLNEMIAEIDTDASGTVDFD----------------- 142

Query: 73  ISTQQIEFMEMMTGD 87
                 EFMEMMTGD
Sbjct: 143 ------EFMEMMTGD 151




Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357623436|gb|EHJ74587.1| troponin C type IIb [Danaus plexippus] Back     alignment and taxonomy information
>gi|58585256|ref|NP_001011654.1| troponin C type IIb [Apis mellifera] gi|38639841|tpg|DAA01877.1| TPA_inf: troponin C type IIb [Apis mellifera] Back     alignment and taxonomy information
>gi|380022635|ref|XP_003695145.1| PREDICTED: troponin C-like [Apis florea] Back     alignment and taxonomy information
>gi|350426349|ref|XP_003494412.1| PREDICTED: troponin C-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156545581|ref|XP_001607807.1| PREDICTED: troponin C-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383857471|ref|XP_003704228.1| PREDICTED: troponin C-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|189240428|ref|XP_971170.2| PREDICTED: similar to troponin C type IIb [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270011447|gb|EFA07895.1| hypothetical protein TcasGA2_TC005470 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|219815476|gb|ACL36923.1| troponin C [Tyrophagus putrescentiae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
FB|FBgn0010423155 TpnC47D "Troponin C at 47D" [D 0.540 0.303 0.708 6.4e-12
FB|FBgn0010424155 TpnC73F "Troponin C at 73F" [D 0.540 0.303 0.666 3.5e-11
FB|FBgn0013348154 TpnC41C "Troponin C at 41C" [D 0.597 0.337 0.641 3.5e-11
FB|FBgn0031692149 TpnC25D "Troponin C at 25D" [D 0.574 0.335 0.647 4.5e-11
WB|WBGene00006583160 tnc-2 [Caenorhabditis elegans 0.540 0.293 0.625 4.1e-10
FB|FBgn0033027153 TpnC4 "Troponin C isoform 4" [ 0.505 0.287 0.577 8.7e-08
WB|WBGene00006861156 cal-5 [Caenorhabditis elegans 0.551 0.307 0.367 1.6e-07
UNIPROTKB|E2R9U4161 TNNC1 "Uncharacterized protein 0.505 0.273 0.511 6.1e-07
MGI|MGI:98779161 Tnnc1 "troponin C, cardiac/slo 0.505 0.273 0.511 6.1e-07
RGD|1309921161 Tnnc1 "troponin C type 1 (slow 0.505 0.273 0.511 6.1e-07
FB|FBgn0010423 TpnC47D "Troponin C at 47D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 6.4e-12, P = 6.4e-12
 Identities = 34/48 (70%), Positives = 39/48 (81%)

Query:    13 HGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDE 60
             +GYIPTS L+EIL  LD+QLT  +LD MIEEID+D SGTVDFD EF E
Sbjct:   104 NGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFD-EFME 150


GO:0005509 "calcium ion binding" evidence=IEA;NAS
FB|FBgn0010424 TpnC73F "Troponin C at 73F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013348 TpnC41C "Troponin C at 41C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031692 TpnC25D "Troponin C at 25D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006583 tnc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0033027 TpnC4 "Troponin C isoform 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006861 cal-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9U4 TNNC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98779 Tnnc1 "troponin C, cardiac/slow skeletal" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309921 Tnnc1 "troponin C type 1 (slow)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P47948TNNC2_DROMENo assigned EC number0.520.59770.3354yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-06
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 1e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 5e-05
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 3e-04
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 0.003
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
 Score = 40.6 bits (96), Expect = 2e-06
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 11 NSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDE 60
          +  G I    L+  L +L E L+ +++DEMI E+D D  G +DF+ EF E
Sbjct: 12 DGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFE-EFLE 60


Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers. Length = 63

>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.41
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.4
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.38
KOG0027|consensus151 99.38
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.34
KOG0027|consensus151 99.26
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.25
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.23
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 99.23
cd0005267 EH Eps15 homology domain; found in proteins implic 99.23
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.2
PF1465866 EF-hand_9: EF-hand domain 99.2
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.2
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.15
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 99.08
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.08
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.08
KOG0028|consensus172 99.02
PTZ00184149 calmodulin; Provisional 99.02
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.99
PTZ00183158 centrin; Provisional 98.96
PTZ00183158 centrin; Provisional 98.91
KOG0028|consensus172 98.9
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.88
PTZ00184149 calmodulin; Provisional 98.86
KOG0030|consensus152 98.85
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.83
KOG0037|consensus221 98.81
KOG0034|consensus187 98.78
KOG0031|consensus171 98.78
KOG0031|consensus171 98.76
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 98.75
KOG0041|consensus244 98.73
KOG0030|consensus152 98.7
KOG0036|consensus 463 98.47
PLN02964 644 phosphatidylserine decarboxylase 98.43
KOG0044|consensus193 98.4
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.34
KOG0377|consensus631 98.33
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.29
KOG0044|consensus193 98.29
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.26
KOG0038|consensus189 98.25
PLN02964 644 phosphatidylserine decarboxylase 98.24
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.15
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.15
KOG0037|consensus221 98.12
KOG0036|consensus 463 97.96
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.8
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.78
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.66
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.66
KOG4223|consensus325 97.56
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.39
KOG0046|consensus 627 97.35
KOG0034|consensus187 97.34
KOG4223|consensus325 97.33
KOG4065|consensus144 97.33
KOG0040|consensus2399 97.11
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.73
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.51
KOG2243|consensus 5019 96.49
KOG2643|consensus 489 96.49
KOG0042|consensus680 96.28
KOG1955|consensus 737 96.27
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.21
KOG4251|consensus 362 95.72
KOG0377|consensus631 95.6
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.42
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 95.07
KOG2643|consensus489 94.92
KOG1029|consensus 1118 94.56
KOG4578|consensus421 94.39
KOG0169|consensus 746 93.73
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 93.72
KOG2562|consensus 493 93.45
KOG3555|consensus 434 93.43
KOG3866|consensus442 92.71
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 92.31
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 92.24
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 92.2
KOG4666|consensus412 92.18
KOG4251|consensus362 92.11
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 92.01
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 91.54
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 91.19
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 91.13
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 91.06
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 90.23
cd0503088 calgranulins Calgranulins: S-100 domain found in p 89.53
cd0005267 EH Eps15 homology domain; found in proteins implic 88.6
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 88.21
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 88.01
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.56
KOG2562|consensus493 86.63
PRK12309391 transaldolase/EF-hand domain-containing protein; P 85.88
PF0367264 UPF0154: Uncharacterised protein family (UPF0154); 85.78
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 85.65
PRK0052372 hypothetical protein; Provisional 85.38
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 85.23
KOG0998|consensus 847 85.09
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 84.86
KOG4666|consensus412 83.86
PRK0184472 hypothetical protein; Provisional 82.57
COG376371 Uncharacterized protein conserved in bacteria [Fun 81.52
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 81.27
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
Probab=99.41  E-value=3.1e-13  Score=78.25  Aligned_cols=60  Identities=20%  Similarity=0.429  Sum_probs=54.0

Q ss_pred             chhccccc-CCCccccHHHHHHHHHH-hCCCCCH-HHHHHHHHHhCCCCCCceecchHHHHHHh
Q psy15708          3 QDLDQEQI-NSHGYIPTSSLREILAA-LDEQLTP-DQLDEMIEEIDTDASGTVDFDGEFDERQA   63 (87)
Q Consensus         3 ~~f~~~D~-~~~G~I~~~el~~~l~~-~g~~~s~-~ei~~l~~~~d~d~~g~I~~~~ef~~~~~   63 (87)
                      ..|+.||+ +++|+|+..||+.+|.+ +|..++. ++++.+++.+|.|+||.|+|. ||+..+.
T Consensus        12 ~~F~~fd~~~~~g~i~~~ELk~ll~~elg~~ls~~~~v~~mi~~~D~d~DG~I~F~-EF~~l~~   74 (89)
T cd05022          12 SNFHKASVKGGKESLTASEFQELLTQQLPHLLKDVEGLEEKMKNLDVNQDSKLSFE-EFWELIG   74 (89)
T ss_pred             HHHHHHhCCCCCCeECHHHHHHHHHHHhhhhccCHHHHHHHHHHhCCCCCCCCcHH-HHHHHHH
Confidence            56999999 99999999999999999 8877888 999999999999999999999 6664443



S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF03672 UPF0154: Uncharacterised protein family (UPF0154); InterPro: IPR005359 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PRK00523 hypothetical protein; Provisional Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PRK01844 hypothetical protein; Provisional Back     alignment and domain information
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2k2a_A70 Solution Structure Of The Apo C Terminal Domain Of 5e-09
2jnf_A158 Solution Structure Of Fly Troponin C, Isoform F1 Le 6e-09
3tz1_A74 Crystal Structure Of The Ca2+-saturated C-terminal 6e-06
4gjf_A89 Crystal Structure Of The Amino-terminal Domain Of H 1e-05
2jxl_A89 Solution Structure Of Cardiac N-Domain Troponin C M 1e-05
4gjg_A89 Crystal Structure Of The Amino-terminal Domain Of H 1e-05
2kgb_C89 Nmr Solution Of The Regulatory Domain Cardiac F77w- 1e-05
1r2u_A89 Nmr Structure Of The N Domain Of Trout Cardiac Trop 1e-05
1mxl_C89 Structure Of Cardiac Troponin C-troponin I Complex 1e-05
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 1e-05
2ctn_A89 Structure Of Calcium-Saturated Cardiac Troponin C, 1e-05
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 1e-05
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 2e-05
2kfx_T89 Structure Of The N-Terminal Domain Of Human Cardiac 2e-05
2jtz_A161 Solution Structure And Chemical Shift Assignments O 2e-05
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 2e-05
1wrk_A88 Crystal Structure Of The N-Terminal Domain Of Human 2e-05
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 2e-05
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 2e-05
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 3e-05
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 3e-05
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 3e-05
2kz2_A94 Calmodulin, C-Terminal Domain, F92e Mutant Length = 3e-05
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 3e-05
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 3e-05
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 3e-05
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 3e-05
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 4e-05
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 4e-05
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 4e-05
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 4e-05
2ygg_B150 Complex Of Cambr And Cam Length = 150 4e-05
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 4e-05
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 4e-05
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 4e-05
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-05
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 4e-05
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 4e-05
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 4e-05
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 4e-05
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-05
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 4e-05
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 4e-05
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 4e-05
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 4e-05
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 4e-05
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 4e-05
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 4e-05
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 4e-05
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 4e-05
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 4e-05
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 5e-05
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 5e-05
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 5e-05
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 5e-05
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 5e-05
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 5e-05
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 8e-05
1up5_B148 Chicken Calmodulin Length = 148 8e-05
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 9e-05
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 9e-05
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 9e-05
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 1e-04
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 1e-04
2kn2_A92 Solution Structure Of The C-Terminal Domain Of Soyb 1e-04
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 1e-04
2ro9_A69 Solution Structure Of Calcium Bound Soybean Calmodu 1e-04
2rob_A70 Solution Structure Of Calcium Bound Soybean Calmodu 1e-04
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 1e-04
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 1e-04
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 1e-04
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-04
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 1e-04
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-04
3rv5_A89 Crystal Structure Of Human Cardiac Troponin C Regul 2e-04
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 2e-04
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 2e-04
2kxw_A73 Structure Of The C-Domain Fragment Of Apo Calmoduli 2e-04
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-04
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 2e-04
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 2e-04
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 4e-04
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 7e-04
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 7e-04
>pdb|2K2A|A Chain A, Solution Structure Of The Apo C Terminal Domain Of Lethoceru C Isoform F1 Length = 70 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 27/43 (62%), Positives = 33/43 (76%) Query: 13 HGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFD 55 +GYI T +REILA LDE L+ + LD MI+EID D SGTVDF+ Sbjct: 17 NGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFE 59
>pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 Back     alignment and structure
>pdb|3TZ1|A Chain A, Crystal Structure Of The Ca2+-saturated C-terminal Domain Of Akazara Scallop Troponin C In Complex With A Troponin I Fragment Length = 74 Back     alignment and structure
>pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 Back     alignment and structure
>pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 Back     alignment and structure
>pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 Back     alignment and structure
>pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|2CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 89 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|2KFX|T Chain T, Structure Of The N-Terminal Domain Of Human Cardiac Troponin C Bound To Calcium Ion And To The Inhibitor W7 Length = 89 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1WRK|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Cardiac Troponin C In Complex With Trifluoperazine (Orthrombic Crystal Form) Length = 88 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 Back     alignment and structure
>pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|3RV5|A Chain A, Crystal Structure Of Human Cardiac Troponin C Regulatory Domain In Complex With Cadmium And Deoxycholic Acid Length = 89 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 4e-12
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 4e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 6e-12
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-07
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-12
2jnf_A158 Troponin C; stretch activated muscle contraction, 7e-07
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-11
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 7e-07
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 1e-11
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-11
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 3e-11
3fwb_A161 Cell division control protein 31; gene gating, com 3e-11
3fwb_A161 Cell division control protein 31; gene gating, com 3e-07
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 6e-11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 6e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 7e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-07
1exr_A148 Calmodulin; high resolution, disorder, metal trans 7e-11
1exr_A148 Calmodulin; high resolution, disorder, metal trans 8e-07
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 7e-11
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 5e-07
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-11
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-10
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 6e-07
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-10
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-04
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 7e-10
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 4e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 7e-10
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 9e-10
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 1e-07
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-09
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 1e-09
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-09
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-09
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-09
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 4e-09
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 1e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-09
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 6e-09
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 6e-09
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 8e-07
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-08
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-08
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 2e-08
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-08
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 2e-08
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-08
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-08
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 3e-08
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 8e-04
1y1x_A191 Leishmania major homolog of programmed cell death 4e-08
1y1x_A191 Leishmania major homolog of programmed cell death 1e-06
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 4e-08
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 3e-04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 5e-08
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-07
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 7e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 3e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 4e-07
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 9e-07
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 4e-07
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 5e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 3e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-06
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 3e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 6e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 5e-05
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 9e-06
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-05
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-05
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 3e-05
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 4e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 3e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 5e-05
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 5e-05
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 5e-05
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 8e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 8e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 8e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 1e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 4e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 5e-04
3akb_A166 Putative calcium binding protein; EF-hand, metal b 5e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 5e-04
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
 Score = 57.2 bits (139), Expect = 4e-12
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 23/73 (31%)

Query: 14  GYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDERQAAGSIPARGKI 73
           GYI    L+ +L A  E +T D ++E++++ D +  G +D+D                  
Sbjct: 110 GYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYD------------------ 151

Query: 74  STQQIEFMEMMTG 86
                EF+E M G
Sbjct: 152 -----EFLEFMKG 159


>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.62
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.55
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.5
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.49
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.48
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.47
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.47
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.46
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.46
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.45
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.45
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.44
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.44
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.43
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.43
3li6_A66 Calcium-binding protein; calcium signaling protein 99.42
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.42
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.42
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.42
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.42
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.41
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.4
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.4
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.39
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.39
1c07_A95 Protein (epidermal growth factor receptor pathway 99.39
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.39
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.39
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.39
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.39
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.39
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.38
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.38
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.38
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.37
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.37
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.37
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.36
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.36
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.36
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.35
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.35
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.35
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.34
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.34
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.34
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.34
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.33
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.33
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.32
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.32
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.32
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.31
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.31
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.31
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.31
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.31
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.3
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.3
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.29
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.29
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.29
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.29
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.29
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.29
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.28
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.28
3fwb_A161 Cell division control protein 31; gene gating, com 99.28
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.28
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.27
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.27
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.27
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.27
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.26
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.26
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.26
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.26
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.25
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.25
1y1x_A191 Leishmania major homolog of programmed cell death 99.25
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.25
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.25
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.24
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.24
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.24
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.24
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.24
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.23
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.23
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.23
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.23
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.22
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.21
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.21
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.2
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.2
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.19
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.19
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.19
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.18
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.18
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.18
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.18
3fwb_A161 Cell division control protein 31; gene gating, com 99.18
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.17
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.17
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.17
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.17
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.17
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.16
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.16
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.16
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.15
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.15
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.14
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.14
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.13
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.13
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.12
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.12
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.12
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.11
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.1
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.1
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.1
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.1
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.09
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.09
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.09
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.09
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.08
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.08
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.08
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.06
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.06
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.06
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.04
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.04
1y1x_A191 Leishmania major homolog of programmed cell death 99.04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.03
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.03
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.03
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.03
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.02
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.02
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.01
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.0
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.0
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.0
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.99
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.99
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.98
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.98
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.98
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.98
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.98
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.97
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.97
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.97
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.96
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.96
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.96
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.96
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.95
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.95
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.94
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.94
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.94
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.93
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.93
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.92
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.91
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.91
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.91
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.91
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.91
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.9
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.89
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.88
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.88
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.88
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.87
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.87
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.86
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.86
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.86
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.86
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.85
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.85
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.84
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.84
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.84
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.83
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.82
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.82
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.81
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.81
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.8
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.8
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.78
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.76
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.76
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.76
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.75
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.75
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.73
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.73
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.73
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.73
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.73
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.72
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.71
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.7
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.68
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.66
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.65
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.64
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.64
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.61
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.6
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.59
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.55
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.53
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.47
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.45
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.39
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.38
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.35
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.33
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.28
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.27
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.24
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.12
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.1
1nub_A229 Basement membrane protein BM-40; extracellular mod 98.08
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.03
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.01
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.0
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.0
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 97.96
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 97.96
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.95
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 97.87
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.81
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.76
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.75
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.72
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.52
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.12
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.09
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.07
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.07
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.02
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 96.72
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 96.59
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 96.05
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.93
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 95.83
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 95.66
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 95.54
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.5
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 95.34
3li6_A66 Calcium-binding protein; calcium signaling protein 95.26
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 95.07
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.02
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.95
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 94.9
1c07_A95 Protein (epidermal growth factor receptor pathway 94.76
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 94.66
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 94.61
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.6
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 94.58
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.48
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 94.24
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.21
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 94.13
1qjt_A99 EH1, epidermal growth factor receptor substrate su 94.07
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 94.04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 93.8
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 93.72
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 93.71
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 93.67
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 93.66
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.64
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 93.52
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 93.46
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 93.41
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 92.84
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 92.8
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 92.58
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 92.49
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 92.33
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 92.25
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 92.0
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 91.85
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 91.78
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 91.77
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 91.69
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 91.57
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 91.47
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 91.46
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 91.38
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 91.21
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 90.97
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 90.85
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 90.82
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 90.78
2jrf_A184 Tubulin polymerization-promoting protein family me 90.32
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.97
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 89.69
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 89.43
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 89.16
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 88.53
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 88.5
3kev_A 199 Galieria sulfuraria DCUN1 domain-containing prote; 88.0
4gba_A 221 DCN1-like protein 3; E3 ligase, ligase-peptide com 87.79
2jq6_A139 EH domain-containing protein 1; metal binding prot 87.61
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 86.32
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 86.06
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 84.32
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 83.54
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=3.5e-16  Score=91.02  Aligned_cols=58  Identities=24%  Similarity=0.435  Sum_probs=53.9

Q ss_pred             chhcccccCCCccccHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCCCCceecchHHHHH
Q psy15708          3 QDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEFDER   61 (87)
Q Consensus         3 ~~f~~~D~~~~G~I~~~el~~~l~~~g~~~s~~ei~~l~~~~d~d~~g~I~~~~ef~~~   61 (87)
                      +.|+.||.|++|+|+..||+.+|+.+|..++.++++.+++.+|.|++|.|+|+ ||+..
T Consensus        40 ~~F~~~D~d~~G~I~~~El~~~l~~lg~~~~~~ei~~l~~~~D~d~dG~I~~~-EF~~~   97 (100)
T 2lv7_A           40 EAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFE-EFVTL   97 (100)
T ss_dssp             HHHHHTCSSCSSCBCHHHHHHHHHHHTCCCCTTTHHHHHHHHCSSCSSSBCHH-HHHHH
T ss_pred             HHHHHHcCCCCCcCCHHHHHHHHHHhCCCCCHHHHHHHHHHHCCCCCCeEeHH-HHHHH
Confidence            46999999999999999999999999999999999999999999999999999 55543



>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 4e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 5e-05
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 7e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 1e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 1e-04
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 1e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 4e-04
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 5e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 6e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 7e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 8e-04
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 8e-04
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 0.001
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 0.001
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.001
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.001
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.001
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.001
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.001
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.002
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.002
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.002
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.004
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 0.004
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Caltractin (centrin 2)
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
 Score = 39.5 bits (92), Expect = 2e-06
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 11 NSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFDGEF 58
          ++ G I    LR +   L E LT ++L EMI E D +    +D D EF
Sbjct: 21 DNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDED-EF 67


>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.66
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.65
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.63
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.62
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.62
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.61
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.6
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.59
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.57
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.55
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.53
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.48
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.47
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.44
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.44
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.42
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.4
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.4
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.4
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.39
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.39
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.37
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.37
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.36
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.34
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.34
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.33
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.32
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.31
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.3
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.29
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.24
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.24
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.23
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.23
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.21
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.19
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.18
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.17
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.17
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.16
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.15
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.12
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.11
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.08
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.08
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.06
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.05
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.04
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.03
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.01
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.01
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.98
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.97
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.96
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.96
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.95
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.93
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.92
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.92
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.92
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.89
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.88
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.87
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.86
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.86
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.83
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.82
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.81
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.81
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.81
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.79
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 98.78
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.74
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.73
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.72
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.71
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.67
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.66
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.59
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.59
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.59
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.57
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.56
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.49
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.44
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.41
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.4
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.37
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.36
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.32
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.31
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.28
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.16
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.15
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.11
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.98
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.89
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.84
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.82
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.78
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.76
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.69
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.63
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.54
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.44
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.38
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.38
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.37
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.23
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.17
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.99
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.96
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.68
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.64
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.58
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 96.52
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 96.49
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.45
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.37
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.92
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.92
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.74
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 95.69
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.61
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.33
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.21
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 95.14
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 95.1
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 95.01
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 94.93
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 94.79
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.57
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 94.56
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 94.45
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 94.16
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 93.69
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.69
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 93.59
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.23
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 93.01
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 92.93
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 92.8
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 91.99
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 91.99
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 91.3
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 91.14
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 90.9
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 90.59
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 90.28
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 89.03
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 88.79
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 88.25
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 87.44
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 86.19
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.66  E-value=1.2e-16  Score=87.53  Aligned_cols=53  Identities=26%  Similarity=0.537  Sum_probs=51.7

Q ss_pred             chhcccccCCCccccHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCCCCceecc
Q psy15708          3 QDLDQEQINSHGYIPTSSLREILAALDEQLTPDQLDEMIEEIDTDASGTVDFD   55 (87)
Q Consensus         3 ~~f~~~D~~~~G~I~~~el~~~l~~~g~~~s~~ei~~l~~~~d~d~~g~I~~~   55 (87)
                      ..|+.||.+++|+|+..+|+.+|+.+|..++.++++.++..+|.+++|+|+|+
T Consensus        13 ~~F~~fD~~~~G~I~~~el~~~l~~lg~~~~~~e~~~~~~~~D~d~dg~I~~~   65 (75)
T d1jc2a_          13 NCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFD   65 (75)
T ss_dssp             HHHHHHCCSTTSSEEHHHHHHHHHHSSSCCCHHHHHHHHHHHCSSSCSEECHH
T ss_pred             HHHHHHcCCCcCeEcHHHHHHHHHhcCCCccHHHHHHHHHHhCCCCCCcEeHH
Confidence            46999999999999999999999999999999999999999999999999999



>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure