Psyllid ID: psy15838

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MNFNNSQPGLESYGLPSCFASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKKETRRYTSSAVTSIGKCVKI
ccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHccccccccEEEcccccccccccccccccccHHHccccccEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHccccEEEEEccccccccccEEEEEEccccccccHHHccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccHHHHHHHHccccEccccccccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHcEEEEEccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccc
mnfnnsqpglesyglpscfastkhsykkkpknfSEEALNHFNKKyqlynasssyklsdgetwfsqtkwqntqlaptlfshfniktipsikLENFQALKEKLNDVKSNLNHVHLKTWHqhtnfvnrSSKVVQSVKRfikpqlatQAWCKFHEIVHsynivpqqensftsihlceapgAFITSLNHYLKLHHPRMQWDWIAntlnphyegnsfdemisddrlilgthrkwyfgpdntgniLVQNFVSHFKQHIGFLLihdtslaphcthashcflvtadgsfdcqgnpgeqeilVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFtsvdlfkpatskegnseIYVICRDFHSVCSQVWIylnlppvkketrryTSSAVtsigkcvki
mnfnnsqpglesygLPSCFASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTwhqhtnfvnrSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLnlppvkketrrytssavtsigkcvki
MNFNNSQPGLESYGLPSCFASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKKETRRYTSSAVTSIGKCVKI
**************************************NHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKK*******************
*****************************************************YKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKKETRRYTSSAVTSIGKCVKI
*********LESYGLPSCFAS*********KNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKK***********SIGKCVKI
*********LESYGLPSCFASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKKETRRYTSSAVTSIGKCVKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFNNSQPGLESYGLPSCFASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKKETRRYTSSAVTSIGKCVKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query399 2.2.26 [Sep-21-2011]
Q8IYT2 770 FtsJ methyltransferase do yes N/A 0.659 0.341 0.521 2e-75
Q5RAY7 769 FtsJ methyltransferase do yes N/A 0.659 0.342 0.514 2e-74
Q8BWQ4 767 FtsJ methyltransferase do yes N/A 0.621 0.323 0.509 6e-73
Q7ZVS8 743 FtsJ methyltransferase do yes N/A 0.731 0.393 0.440 1e-72
Q9UAS6 700 FtsJ methyltransferase do yes N/A 0.689 0.392 0.422 1e-60
Q5UQ71788 Uncharacterized protein L N/A N/A 0.609 0.308 0.282 2e-21
Q65148424 Probable methyltransferas no N/A 0.679 0.639 0.265 2e-17
P0C968424 Probable methyltransferas no N/A 0.644 0.606 0.256 2e-17
P0C970424 Probable methyltransferas no N/A 0.644 0.606 0.252 6e-17
P0C967424 Probable methyltransferas no N/A 0.644 0.606 0.256 8e-17
>sp|Q8IYT2|FTSJ1_HUMAN FtsJ methyltransferase domain-containing protein 1 OS=Homo sapiens GN=FTSJD1 PE=2 SV=2 Back     alignment and function desciption
 Score =  283 bits (724), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 183/280 (65%), Gaps = 17/280 (6%)

Query: 83  IKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLA 142
           I T    +L  F  LK  LN+VK+ L+   L  WH+HT F N++ K++  V++ +  +L 
Sbjct: 52  IFTCDHTELNAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELC 111

Query: 143 TQAWCKFHEIVHSYNIVPQ---QENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIA 199
           TQAWCKFHEI+ S+ ++PQ   Q     S+HLCEAPGAFI SLNHYLK H     W W+A
Sbjct: 112 TQAWCKFHEILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVA 171

Query: 200 NTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDT 259
           NTLNP++E N    MI DDRLI  T   WYFGPDNTG+I+   F++  +  I       +
Sbjct: 172 NTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFI-------S 224

Query: 260 SLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIF 319
           S+A          LVTADGSFDCQGNPGEQE LV  LHY EV  AL+ L NGG+ V+K+F
Sbjct: 225 SMAT-------VHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMF 277

Query: 320 TIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVIC 359
           T+FE  +I LMYLL C F  V +FKPATSK GNSE+YV+C
Sbjct: 278 TMFEHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVC 317

Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q5RAY7|FTSJ1_PONAB FtsJ methyltransferase domain-containing protein 1 OS=Pongo abelii GN=FTSJD1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BWQ4|FTSJ1_MOUSE FtsJ methyltransferase domain-containing protein 1 OS=Mus musculus GN=Ftsjd1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVS8|FTSJ1_DANRE FtsJ methyltransferase domain-containing protein 1 OS=Danio rerio GN=ftsjd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UAS6|FTSJ1_DROME FtsJ methyltransferase domain-containing protein 1 homolog OS=Drosophila melanogaster GN=aft PE=2 SV=1 Back     alignment and function description
>sp|Q5UQ71|YL511_MIMIV Uncharacterized protein L511 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L511 PE=4 SV=1 Back     alignment and function description
>sp|Q65148|VF424_ASFB7 Probable methyltransferase EP424R OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-055 PE=3 SV=1 Back     alignment and function description
>sp|P0C968|VF424_ASFK5 Probable methyltransferase EP424R OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-067 PE=3 SV=1 Back     alignment and function description
>sp|P0C970|VF424_ASFM2 Probable methyltransferase EP424R OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-063 PE=3 SV=1 Back     alignment and function description
>sp|P0C967|VF424_ASFWA Probable methyltransferase EP424R OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-065 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
149640714 764 PREDICTED: ftsJ methyltransferase domain 0.634 0.331 0.514 5e-75
242014593 668 conserved hypothetical protein [Pediculu 0.734 0.438 0.459 6e-75
224064131 764 PREDICTED: ftsJ methyltransferase domain 0.669 0.349 0.492 5e-74
344290957 775 PREDICTED: ftsJ methyltransferase domain 0.659 0.339 0.525 7e-74
23273317 770 FtsJ methyltransferase domain containing 0.659 0.341 0.521 9e-74
153791865 770 ftsJ methyltransferase domain-containing 0.659 0.341 0.521 1e-73
334313380 764 PREDICTED: ftsJ methyltransferase domain 0.661 0.345 0.505 2e-73
332263869 770 PREDICTED: ftsJ methyltransferase domain 0.659 0.341 0.517 2e-73
194208779 768 PREDICTED: ftsJ methyltransferase domain 0.614 0.319 0.525 2e-73
431912446 766 FtsJ methyltransferase domain-containing 0.639 0.332 0.518 2e-73
>gi|149640714|ref|XP_001506926.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
 Score =  288 bits (736), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 184/270 (68%), Gaps = 17/270 (6%)

Query: 96  ALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHS 155
            LK+ LN+VK+ L+   L  WHQHT+F N++ K++  VK+ +  +L TQAWCKFHEI+ S
Sbjct: 65  VLKDSLNEVKNLLSDKKLDEWHQHTSFTNKAGKIIPHVKKSVNAELCTQAWCKFHEILCS 124

Query: 156 YNIVPQ---QENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFD 212
           + ++PQ   Q     S+HLCEAPGAFI SLNHYLK HH    W+W+ANTLNP++E N   
Sbjct: 125 FPLIPQEAFQNGELNSVHLCEAPGAFIASLNHYLKSHHIPCDWNWVANTLNPYHEANDNV 184

Query: 213 EMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCF 272
            MI DDRLI  T  +WYFGP+NTG+++    +S  ++ +G +              +   
Sbjct: 185 TMIMDDRLIADTLPRWYFGPENTGDVMTLKHLSGLQRFVGDM--------------ATVH 230

Query: 273 LVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYL 332
           LVTADGSFDCQGNPGEQE LV  LHY EV  AL +L +GG+LV+K+FT+FE  ++ L+YL
Sbjct: 231 LVTADGSFDCQGNPGEQEALVSPLHYCEVVTALMILGSGGSLVLKMFTLFEHCSVNLLYL 290

Query: 333 LACLFTSVDLFKPATSKEGNSEIYVICRDF 362
           L C F  V +FKP TSK GNSE+YV+C +F
Sbjct: 291 LNCSFEEVHVFKPGTSKAGNSEVYVVCLNF 320

Source: Ornithorhynchus anatinus

Species: Ornithorhynchus anatinus

Genus: Ornithorhynchus

Family: Ornithorhynchidae

Order: Monotremata

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|242014593|ref|XP_002427971.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512470|gb|EEB15233.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|224064131|ref|XP_002187731.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|344290957|ref|XP_003417203.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1-like [Loxodonta africana] Back     alignment and taxonomy information
>gi|23273317|gb|AAH35005.1| FtsJ methyltransferase domain containing 1 [Homo sapiens] gi|325463439|gb|ADZ15490.1| FtsJ methyltransferase domain containing 1 [synthetic construct] Back     alignment and taxonomy information
>gi|153791865|ref|NP_060818.4| ftsJ methyltransferase domain-containing protein 1 [Homo sapiens] gi|153792086|ref|NP_001093112.1| ftsJ methyltransferase domain-containing protein 1 [Homo sapiens] gi|269849596|sp|Q8IYT2.2|FTSJ1_HUMAN RecName: Full=FtsJ methyltransferase domain-containing protein 1; AltName: Full=Protein adrift homolog gi|21759769|gb|AAH34468.1| FTSJD1 protein [Homo sapiens] Back     alignment and taxonomy information
>gi|334313380|ref|XP_001375930.2| PREDICTED: ftsJ methyltransferase domain-containing protein 1-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|332263869|ref|XP_003280973.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 1 [Nomascus leucogenys] gi|332263871|ref|XP_003280974.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 2 [Nomascus leucogenys] gi|332263873|ref|XP_003280975.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 3 [Nomascus leucogenys] gi|332263875|ref|XP_003280976.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 4 [Nomascus leucogenys] gi|332263877|ref|XP_003280977.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 5 [Nomascus leucogenys] gi|332263879|ref|XP_003280978.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 6 [Nomascus leucogenys] gi|332263881|ref|XP_003280979.1| PREDICTED: ftsJ methyltransferase domain-containing protein 1 isoform 7 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|194208779|ref|XP_001498370.2| PREDICTED: ftsJ methyltransferase domain-containing protein 1-like [Equus caballus] Back     alignment and taxonomy information
>gi|431912446|gb|ELK14580.1| FtsJ methyltransferase domain-containing protein 1 [Pteropus alecto] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
UNIPROTKB|Q8IYT2 770 FTSJD1 "FtsJ methyltransferase 0.659 0.341 0.525 2e-72
UNIPROTKB|I3LUF1 764 FTSJD1 "Uncharacterized protei 0.654 0.341 0.517 6.7e-72
UNIPROTKB|G3MZP6 764 FTSJD1 "Uncharacterized protei 0.656 0.342 0.505 1.6e-70
UNIPROTKB|E2RHJ3 768 FTSJD1 "Uncharacterized protei 0.624 0.324 0.522 1.6e-70
RGD|1309394 767 Ftsjd1 "FtsJ methyltransferase 0.654 0.340 0.5 2.4e-69
UNIPROTKB|E1BZA5 763 FTSJD1 "Uncharacterized protei 0.624 0.326 0.515 3.8e-69
MGI|MGI:2384580 767 Ftsjd1 "FtsJ methyltransferase 0.624 0.324 0.515 3.8e-69
ZFIN|ZDB-GENE-040426-2775 743 ftsjd1 "FtsJ methyltransferase 0.661 0.355 0.469 2.8e-66
FB|FBgn0026309 700 aft "adrift" [Drosophila melan 0.649 0.37 0.440 3.3e-56
WB|WBGene00021502 635 Y40D12A.1 [Caenorhabditis eleg 0.563 0.354 0.352 9e-28
UNIPROTKB|Q8IYT2 FTSJD1 "FtsJ methyltransferase domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 732 (262.7 bits), Expect = 2.0e-72, P = 2.0e-72
 Identities = 147/280 (52%), Positives = 184/280 (65%)

Query:    83 IKTIPSIKLENFQALKEKLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLA 142
             I T    +L  F  LK  LN+VK+ L+   L  WH+HT F N++ K++  V++ +  +L 
Sbjct:    52 IFTCDHTELNAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELC 111

Query:   143 TQAWCKFHEIVHSYNIVPQ---QENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIA 199
             TQAWCKFHEI+ S+ ++PQ   Q     S+HLCEAPGAFI SLNHYLK H     W W+A
Sbjct:   112 TQAWCKFHEILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVA 171

Query:   200 NTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDT 259
             NTLNP++E N    MI DDRLI  T   WYFGPDNTG+I+   F++  +  I       +
Sbjct:   172 NTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFI-------S 224

Query:   260 SLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIF 319
             S+A    H     LVTADGSFDCQGNPGEQE LV  LHY EV  AL+ L NGG+ V+K+F
Sbjct:   225 SMAT--VH-----LVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMF 277

Query:   320 TIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVIC 359
             T+FE  +I LMYLL C F  V +FKPATSK GNSE+YV+C
Sbjct:   278 TMFEHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVC 317
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|I3LUF1 FTSJD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZP6 FTSJD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHJ3 FTSJD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1309394 Ftsjd1 "FtsJ methyltransferase domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZA5 FTSJD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2384580 Ftsjd1 "FtsJ methyltransferase domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2775 ftsjd1 "FtsJ methyltransferase domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0026309 aft "adrift" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00021502 Y40D12A.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IYT2FTSJ1_HUMAN2, ., 1, ., 1, ., -0.52140.65910.3415yesN/A
Q8BWQ4FTSJ1_MOUSE2, ., 1, ., 1, ., -0.50930.62150.3233yesN/A
Q5RAY7FTSJ1_PONAB2, ., 1, ., 1, ., -0.51420.65910.3420yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 6e-24
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 1e-04
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 2e-04
TIGR00754157 TIGR00754, bfr, bacterioferritin 0.002
>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information 
 Score = 97.3 bits (243), Expect = 6e-24
 Identities = 49/218 (22%), Positives = 77/218 (35%), Gaps = 45/218 (20%)

Query: 145 AWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNP 204
           A  K  EI   + + P      T + L  APG F   L               +A  L P
Sbjct: 5   AAYKLLEIDERFGLKP--GKGKTVLDLGAAPGGFSQVLLERGGAGK------VVAVDLGP 56

Query: 205 HYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPH 264
                   E I     +              G+I     +   ++ +             
Sbjct: 57  -------MEPIQGVYFL-------------RGDITDPETLEKLRELLPGK---------- 86

Query: 265 CTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFES 324
                   LV +DG+ +  G       +  +L    + +AL +L  GGN V+K+F  FE 
Sbjct: 87  ------VDLVLSDGAPNVSGIENTDSFISLQLVLAALLLALEVLRPGGNFVVKVFKGFE- 139

Query: 325 DTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDF 362
            ++ L+  L   F  V +FKP  S+  +SE Y++C  F
Sbjct: 140 FSVELLEKLKKGFEKVGIFKPPASRPSSSEEYLVCLGF 177

This family consists of FtsJ from various bacterial and archaeal sources FtsJ is a methyltransferase, but actually has no effect on cell division. FtsJ's substrate is the 23S rRNA. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. This family also includes the N terminus of flaviviral NS5 protein. It has been hypothesised that the N-terminal domain of NS5 is a methyltransferase involved in viral RNA capping. Length = 177
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232976 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|162022 TIGR00754, bfr, bacterioferritin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 399
KOG3674|consensus 696 100.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 100.0
KOG4589|consensus232 100.0
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 100.0
KOG1099|consensus294 100.0
KOG3673|consensus 845 100.0
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.97
KOG1098|consensus 780 99.97
TIGR00438188 rrmJ cell division protein FtsJ. 99.89
PF14314 675 Methyltrans_Mon: Virus-capping methyltransferase 99.57
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 98.37
PF06460299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 98.13
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.94
PTZ00146293 fibrillarin; Provisional 97.92
PRK14902444 16S rRNA methyltransferase B; Provisional 97.44
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 97.15
PRK04266226 fibrillarin; Provisional 97.13
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 97.12
PRK14901434 16S rRNA methyltransferase B; Provisional 97.06
PRK10901427 16S rRNA methyltransferase B; Provisional 96.98
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 96.97
PRK14903431 16S rRNA methyltransferase B; Provisional 96.52
KOG2198|consensus375 96.49
PRK14904445 16S rRNA methyltransferase B; Provisional 96.47
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.33
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.24
PRK00811283 spermidine synthase; Provisional 96.15
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.8
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 95.73
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 95.71
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 95.63
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 95.61
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 95.59
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 95.53
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.49
PRK04457262 spermidine synthase; Provisional 95.44
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 95.36
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 95.26
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 95.22
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.12
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 95.04
PRK14967223 putative methyltransferase; Provisional 94.9
PLN03075296 nicotianamine synthase; Provisional 94.87
PLN02244340 tocopherol O-methyltransferase 94.47
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 94.36
PRK08317241 hypothetical protein; Provisional 94.36
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 94.34
PF06016 1289 Reovirus_L2: Reovirus core-spike protein lambda-2 94.31
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 94.05
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 94.0
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 93.83
KOG1122|consensus460 93.73
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 93.6
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 93.44
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 93.08
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 93.02
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 93.0
COG1092393 Predicted SAM-dependent methyltransferases [Genera 92.85
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 92.7
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 92.59
PRK07402196 precorrin-6B methylase; Provisional 92.4
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 92.38
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 92.18
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 92.16
PRK03612521 spermidine synthase; Provisional 92.15
COG2933358 Predicted SAM-dependent methyltransferase [General 92.08
COG4106257 Tam Trans-aconitate methyltransferase [General fun 91.97
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 91.86
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 91.66
PLN02366308 spermidine synthase 91.64
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 91.64
PLN02336475 phosphoethanolamine N-methyltransferase 91.63
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 91.48
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 91.45
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 91.43
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 91.41
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 91.28
COG0421282 SpeE Spermidine synthase [Amino acid transport and 91.04
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 91.04
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 91.03
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 90.95
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 90.88
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 90.62
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 90.58
PRK11207197 tellurite resistance protein TehB; Provisional 90.41
PRK01581374 speE spermidine synthase; Validated 90.34
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 90.3
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 90.06
TIGR00452314 methyltransferase, putative. Known examples to dat 90.04
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 89.93
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 89.91
PLN02823336 spermine synthase 89.9
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 89.23
PLN02233261 ubiquinone biosynthesis methyltransferase 88.79
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 88.74
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 88.4
TIGR00536284 hemK_fam HemK family putative methylases. The gene 88.39
PLN02490340 MPBQ/MSBQ methyltransferase 87.71
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 87.65
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 87.62
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 86.66
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 85.94
COG4123248 Predicted O-methyltransferase [General function pr 85.89
PLN02336 475 phosphoethanolamine N-methyltransferase 85.83
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 85.49
PRK06922677 hypothetical protein; Provisional 85.07
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 85.04
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 84.92
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 84.8
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 84.25
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 83.75
KOG1975|consensus389 83.5
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 82.9
PLN02476278 O-methyltransferase 82.41
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 82.32
PF12803324 G-7-MTase: mRNA (guanine-7-)methyltransferase (G-7 82.1
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 81.18
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 81.12
PRK12335287 tellurite resistance protein TehB; Provisional 80.98
>KOG3674|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.2e-82  Score=634.80  Aligned_cols=349  Identities=37%  Similarity=0.582  Sum_probs=314.6

Q ss_pred             ccccccccCCCCCCCHHHHHhHHhhhhhcccceeeecCCCCCcccccccccCCCCCCcccccccccCCccchhhHHHHHH
Q psy15838         20 ASTKHSYKKKPKNFSEEALNHFNKKYQLYNASSSYKLSDGETWFSQTKWQNTQLAPTLFSHFNIKTIPSIKLENFQALKE   99 (399)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lk~   99 (399)
                      .++--+..+.|.-|+++..+|+   ++||.|+|.|++|.+++      ||+|++++.       |+|+.++|..++.|+.
T Consensus         4 rk~p~~~~~p~~~fs~~~~~d~---~~lF~k~F~y~kpl~ns------wqlp~Pdq~-------l~~e~yeF~a~~~l~~   67 (696)
T KOG3674|consen    4 RKKPDLDGNPVNLFSEKEIKDY---YNLFIKDFNYCKPLPNS------WQLPNPDQA-------LFSEFYEFSAQTNLLT   67 (696)
T ss_pred             CCCCCCCCCCccccCcchHHHH---HHHHHHhcccCCcCCCc------ccCCCchhh-------hhhhhhhHHHHhhHHH
Confidence            3455566677789999999999   99999999999999988      999984444       4555599999999999


Q ss_pred             HHHHHhhhcCccchhHHHhhhcccCchhhHHHHHHhhcchhhhHHHHHHHHHHHHhCCCCCCCCCCceEEEeccCCChhH
Q psy15838        100 KLNDVKSNLNHVHLKTWHQHTNFVNRSSKVVQSVKRFIKPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFI  179 (399)
Q Consensus       100 ~Ln~~K~~l~~~~~~~w~~ht~~~n~~~~i~~~vk~~~~~e~~trAw~KL~EId~~f~l~~~~~~~~~vlDLceaPGgFs  179 (399)
                      +||+||++|+|+.+++|++||+++|++|.+.+++|+..++|++|.||+||.||++.|++++...-.++++|||||||+||
T Consensus        68 qln~vk~kl~Dk~vdew~~HT~~~~~~g~~~~~l~n~~~ae~~T~AwcKl~Eil~~fpl~~~ea~~inS~HLCEaPGaFI  147 (696)
T KOG3674|consen   68 QLNMVKRKLKDKGVDEWDQHTDMMHDFGRNPRILQNYFIAENVTKAWCKLCEILEVFPLDIFEASSINSFHLCEAPGAFI  147 (696)
T ss_pred             HHHHHHHHhhhccchhHHhhhhhcCccccccHHHHhhHHHHHHHHHHHHHHHHHHhcCccccccccccceeeecCccHHH
Confidence            99999999999999999999999999999999999999999999999999999999999988655689999999999999


Q ss_pred             HHHHHhhhccCCC--CccceeccccCCCcCCCCCCcEEeccccccccCccccCCCccccCCCChHHHHHHHHhhhhhhcc
Q psy15838        180 TSLNHYLKLHHPR--MQWDWIANTLNPHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIH  257 (399)
Q Consensus       180 qaln~yl~~~~~~--~~w~~~a~sLnP~~e~n~~~~vI~dD~~~~~~~~~w~~G~d~tGDI~~~~~i~~i~~~v~~~~~~  257 (399)
                      ++||||++++++.  +.|+|.|+|||||+|+|+...||.||++|.+|+++|.||+|++|||++-..+..+.+.++     
T Consensus       148 aslnhyL~s~r~k~~~~W~W~anTLNPY~E~n~~~~mi~DDr~I~~Tld~WyFgpd~tGdi~~~~~~~~l~~~v~-----  222 (696)
T KOG3674|consen  148 ASLNHYLMSSRGKNMSYWKWGANTLNPYFENNSCFDMIIDDRHIRPTLDQWYFGPDDTGDIEKFTEEYLLKQEVK-----  222 (696)
T ss_pred             HHHHHHHHhccCCccceeeeccCccCcccccchHHHHhccchhhhccccceeeCCCCCccHHHHHHHHHHHHHHH-----
Confidence            9999999987544  999999999999999999999999999999999999999999999999887777777443     


Q ss_pred             CCCCCCCCCCCCcccEEEecCCCCCCCCCchhHHHHHHHHHHHHHHHHhccCCCCEEEEeEccCCCCCHHHHHHHHHhcC
Q psy15838        258 DTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLF  337 (399)
Q Consensus       258 ~~~~~~~~~~~~~vDLV~ADGs~d~sg~~~~qe~~s~~L~~~el~~Al~~Lr~GG~fVlK~F~~~e~~t~~Ll~lL~~~F  337 (399)
                               ..+.||||||||++||+|+|++||+++.+|++||++.|+.+|+.||+||+|||+.|+..+++|||+|+++|
T Consensus       223 ---------~~gtvdLVTADGS~dcqg~pgeqE~iVssL~~aEV~~AL~~L~~gG~filKmft~fe~cS~~lmylLnc~F  293 (696)
T KOG3674|consen  223 ---------LAGTVDLVTADGSTDCQGKPGEQESIVSSLISAEVEVALKLLRRGGRFILKMFTFFEKCSRDLMYLLNCNF  293 (696)
T ss_pred             ---------hhceEEEEecCCccccCCCCccHHHHHHHHHHHHHHHHHHHHhcCCeehHHHHHHHHHhhHHHHHHHHhhH
Confidence                     25789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeeeecCCCCCCCCceEEEEEeeccCCccccccccccccchh-----h----cccccchhhhcccchhc
Q psy15838        338 TSVDLFKPATSKEGNSEIYVICRDFHSVCSQVWIYLNLPPVKK-----E----TRRYTSSAVTSIGKCVK  398 (399)
Q Consensus       338 ~~V~v~KP~aSR~~sSE~YlVc~gf~g~~~~~~~~~~~~~~~~-----~----~~~~~~~~~~~~~~~~~  398 (399)
                      ++|+++||++||++|||+||||.||++.++.-+|.....-..+     |    --.+|.+|+-+.|+||.
T Consensus       294 ~~Vh~fKPatSk~GnSEvYVvCl~yK~~~~l~~Ll~~m~~~~~nd~~~~~LF~~~~IP~dFLmqhe~cc~  363 (696)
T KOG3674|consen  294 SSVHAFKPATSKPGNSEVYVVCLGYKDHPDLPRLLGSMNMDISNDTLVMPLFAKFQIPHDFLMQHEQCCE  363 (696)
T ss_pred             hhhhccccccCCCCCceEEEEecccCCCccchhhhhhhhcccccchhhccccccccCchHHHHHHHHHHH
Confidence            9999999999999999999999999999876433332211111     1    12399999999999984

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>KOG3673|consensus Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF14314 Methyltrans_Mon: Virus-capping methyltransferase Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF06016 Reovirus_L2: Reovirus core-spike protein lambda-2 (L2); InterPro: IPR010311 This family consists of several Reovirus core-spike protein lambda-2 (L2) sequences Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF12803 G-7-MTase: mRNA (guanine-7-)methyltransferase (G-7-MTase); InterPro: IPR024352 The Sendai virus RNA-dependent RNA polymerase complex, which consists of L and P proteins, participates in the synthesis of viral mRNAs that possess a methylated cap structure Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 3e-09
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 3e-09
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 4e-09
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 4e-09
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 1e-06
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
 Score = 55.2 bits (134), Expect = 3e-09
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 273 LVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYL 332
            V +D      G P     +  ++  R ++IA+  L NGGN+++K F      T   + +
Sbjct: 94  DVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQ--GDMTNDFIAI 151

Query: 333 LACLFTSVDLFKPATSKEGNSEIYVICRDF 362
               F+S  + KP  S+  +SEIY++   F
Sbjct: 152 WRKNFSSYKISKPPASRGSSSEIYIMFFGF 181
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 100.0
2px2_A269 Genome polyprotein [contains: capsid protein C (co 100.0
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 100.0
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 99.98
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 99.97
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.92
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 99.91
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.9
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 99.88
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.88
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 99.87
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.87
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.82
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.78
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 99.7
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.32
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 99.18
3trk_A324 Nonstructural polyprotein; hydrolase; 2.40A {Chiku 98.15
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.07
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.95
4gua_A 670 Non-structural polyprotein; viral precursor polypr 97.72
3lpm_A259 Putative methyltransferase; structural genomics, p 97.72
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.67
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.61
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.45
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.07
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.02
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 96.96
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.91
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 96.87
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.84
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.77
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.77
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.77
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.74
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.71
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.66
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.64
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 96.61
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.59
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.51
2b3t_A276 Protein methyltransferase HEMK; translation termin 96.5
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.45
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.39
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.36
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.34
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 96.28
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.28
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.25
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.18
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.15
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.13
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.05
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.01
1jsx_A207 Glucose-inhibited division protein B; methyltransf 95.95
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 95.9
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.88
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 95.84
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 95.8
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.78
3iyl_W 1299 VP1; non-enveloped virus, membrane penetration pro 95.73
2frn_A278 Hypothetical protein PH0793; structural genomics, 95.71
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 95.69
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.65
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 95.6
3hnr_A220 Probable methyltransferase BT9727_4108; structural 95.57
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.49
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.49
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.46
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 95.45
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 95.45
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 95.45
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 95.41
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 95.4
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 95.38
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 95.31
3lcc_A235 Putative methyl chloride transferase; halide methy 95.31
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.28
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 95.27
3dtn_A234 Putative methyltransferase MM_2633; structural gen 95.19
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 95.18
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 95.16
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 95.09
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 95.07
4hg2_A257 Methyltransferase type 11; structural genomics, PS 95.07
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 95.07
3f4k_A257 Putative methyltransferase; structural genomics, P 95.06
3i9f_A170 Putative type 11 methyltransferase; structural gen 95.06
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 95.06
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 95.01
1ej6_A 1289 Lambda2; icosahedral, non-equivalence, dsRNA virus 94.95
2i7c_A283 Spermidine synthase; transferase, structural genom 94.94
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 94.91
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 94.89
2pt6_A321 Spermidine synthase; transferase, structural genom 94.89
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 94.89
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 94.89
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 94.86
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 94.86
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 94.85
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 94.83
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 94.76
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 94.76
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 94.72
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 94.71
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 94.68
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 94.66
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 94.61
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 94.6
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 94.6
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 94.54
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.52
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 94.49
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 94.48
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 94.47
2esr_A177 Methyltransferase; structural genomics, hypothetic 94.44
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 94.32
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 94.26
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 94.26
2b25_A336 Hypothetical protein; structural genomics, methyl 94.25
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 94.23
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 94.21
2b78_A385 Hypothetical protein SMU.776; structure genomics, 94.21
3gu3_A284 Methyltransferase; alpha-beta protein, structural 94.17
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 94.17
1yb2_A275 Hypothetical protein TA0852; structural genomics, 94.16
1vl5_A260 Unknown conserved protein BH2331; putative methylt 94.16
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 94.15
1ws6_A171 Methyltransferase; structural genomics, riken stru 94.13
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 94.02
2avd_A229 Catechol-O-methyltransferase; structural genomics, 94.01
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 93.99
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 93.95
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 93.94
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 93.91
2o07_A304 Spermidine synthase; structural genomics, structur 93.82
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 93.77
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 93.69
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 93.67
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 93.62
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 93.54
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 93.49
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 93.47
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 93.43
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 93.37
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 93.35
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 93.34
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 93.32
3m70_A286 Tellurite resistance protein TEHB homolog; structu 93.32
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 93.3
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 93.27
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 93.26
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 93.23
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 93.22
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 93.21
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 93.2
1wzn_A252 SAM-dependent methyltransferase; structural genomi 93.13
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 93.1
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 93.08
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 93.08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 93.04
3cc8_A230 Putative methyltransferase; structural genomics, j 93.0
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 92.97
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 92.97
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 92.93
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 92.92
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 92.9
2p7i_A250 Hypothetical protein; putative methyltransferase, 92.89
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 92.85
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 92.8
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 92.74
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 92.73
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 92.71
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 92.7
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 92.55
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 92.47
2i62_A265 Nicotinamide N-methyltransferase; structural genom 92.46
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 92.4
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 92.32
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 92.1
1xxl_A239 YCGJ protein; structural genomics, protein structu 91.93
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 91.93
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 91.92
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 91.87
3ege_A261 Putative methyltransferase from antibiotic biosyn 91.79
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 91.75
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 91.7
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 91.67
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 91.51
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 91.48
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 91.22
1vlm_A219 SAM-dependent methyltransferase; possible histamin 91.15
2fyt_A340 Protein arginine N-methyltransferase 3; structural 91.01
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 90.89
2fpo_A202 Methylase YHHF; structural genomics, putative meth 90.75
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 90.58
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 90.54
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 90.31
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 90.29
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 90.27
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 90.18
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 90.15
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 90.14
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 90.1
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 90.03
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 89.93
3ocj_A305 Putative exported protein; structural genomics, PS 89.76
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 89.53
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 89.49
2kw5_A202 SLR1183 protein; structural genomics, northeast st 88.24
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 87.92
3k6r_A278 Putative transferase PH0793; structural genomics, 87.54
1xj5_A334 Spermidine synthase 1; structural genomics, protei 87.32
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 86.68
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 85.55
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 84.34
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 83.98
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 83.68
2cmg_A262 Spermidine synthase; transferase, putrescine amino 83.48
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 83.05
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 82.96
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
Probab=100.00  E-value=2e-34  Score=263.79  Aligned_cols=183  Identities=22%  Similarity=0.293  Sum_probs=144.6

Q ss_pred             chhhhHHHHHHHHHHHHhCCCCCCCCCCceEEEeccCCChhHHHHHHhhhccCCCCccceeccccCCCcCCCCCCcEEec
Q psy15838        138 KPQLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISD  217 (399)
Q Consensus       138 ~~e~~trAw~KL~EId~~f~l~~~~~~~~~vlDLceaPGgFsqaln~yl~~~~~~~~w~~~a~sLnP~~e~n~~~~vI~d  217 (399)
                      ..+||+||+|||.||+++|++++++.   +|||||||||+|++++...        ....+|+++.|.            
T Consensus         2 ~~~yr~Ra~~KL~ei~~~~~~~~~g~---~VLDlG~G~G~~s~~la~~--------~~~V~gvD~~~~------------   58 (191)
T 3dou_A            2 SLQLRSRAAFKLEFLLDRYRVVRKGD---AVIEIGSSPGGWTQVLNSL--------ARKIISIDLQEM------------   58 (191)
T ss_dssp             --CTTSHHHHHHHHHHHHHCCSCTTC---EEEEESCTTCHHHHHHTTT--------CSEEEEEESSCC------------
T ss_pred             CCCCCCcHHHHHHHHHHHcCCCCCCC---EEEEEeecCCHHHHHHHHc--------CCcEEEEecccc------------
Confidence            46899999999999999999988764   9999999999999976442        124566666553            


Q ss_pred             cccccccCccccCCC-ccccCCCChHHHHHHHHhhhhhhccCCCCCCCCCCCCcccEEEecCCCCCCCCCchhHHHHHHH
Q psy15838        218 DRLILGTHRKWYFGP-DNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKL  296 (399)
Q Consensus       218 D~~~~~~~~~w~~G~-d~tGDI~~~~~i~~i~~~v~~~~~~~~~~~~~~~~~~~vDLV~ADGs~d~sg~~~~qe~~s~~L  296 (399)
                           ...+    ++ ..+||+++..+.+.+...+..   .         ..+++|+|+|||+++++|.+..|+..+..+
T Consensus        59 -----~~~~----~v~~~~~D~~~~~~~~~~~~~~~~---~---------~~~~~D~Vlsd~~~~~~g~~~~d~~~~~~l  117 (191)
T 3dou_A           59 -----EEIA----GVRFIRCDIFKETIFDDIDRALRE---E---------GIEKVDDVVSDAMAKVSGIPSRDHAVSYQI  117 (191)
T ss_dssp             -----CCCT----TCEEEECCTTSSSHHHHHHHHHHH---H---------TCSSEEEEEECCCCCCCSCHHHHHHHHHHH
T ss_pred             -----ccCC----CeEEEEccccCHHHHHHHHHHhhc---c---------cCCcceEEecCCCcCCCCCcccCHHHHHHH
Confidence                 1222    22 379999998777766653310   0         013799999999999999999999999999


Q ss_pred             HHHHHHHHHhccCCCCEEEEeEccCCCCCHHHHHHHHHhcCCeeeeecCCCCCCCCceEEEEEeeccCCc
Q psy15838        297 HYREVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHSVC  366 (399)
Q Consensus       297 ~~~el~~Al~~Lr~GG~fVlK~F~~~e~~t~~Ll~lL~~~F~~V~v~KP~aSR~~sSE~YlVc~gf~g~~  366 (399)
                      +..++..|..+|+|||.||+|+|.+.+  +..++..|...|.+|+++||.+||++|+|+|+||+||+...
T Consensus       118 ~~~~l~~a~~~LkpGG~lv~k~~~~~~--~~~~~~~l~~~F~~v~~~kP~asR~~s~E~y~v~~~~~~~~  185 (191)
T 3dou_A          118 GQRVMEIAVRYLRNGGNVLLKQFQGDM--TNDFIAIWRKNFSSYKISKPPASRGSSSEIYIMFFGFKAEG  185 (191)
T ss_dssp             HHHHHHHHHHHEEEEEEEEEEEECSTH--HHHHHHHHGGGEEEEEEECC------CCEEEEEEEEECCC-
T ss_pred             HHHHHHHHHHHccCCCEEEEEEcCCCC--HHHHHHHHHHhcCEEEEECCCCccCCCceEEEEEeeecccc
Confidence            999999999999999999999999965  78999999999999999999999999999999999998654
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3iyl_W VP1; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1ej6_A Lambda2; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_U Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 399
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 3e-15
d2p41a1257 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)- 2e-05
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

 Score = 71.4 bits (174), Expect = 3e-15
 Identities = 34/219 (15%), Positives = 69/219 (31%), Gaps = 45/219 (20%)

Query: 144 QAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLN 203
           +AW K  EI  S  +    +   T + L  APG +   +   +      +  D     ++
Sbjct: 5   RAWFKLDEIQQSDKLF---KPGMTVVDLGAAPGGWSQYVVTQIGGKGRIIACD--LLPMD 59

Query: 204 PHYEGNSFDEMISDDRLILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAP 263
           P    +       D+ ++     +                                    
Sbjct: 60  PIVGVDFLQGDFRDELVMKALLERVGDSKVQ----------------------------- 90

Query: 264 HCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYREVQIALSLLHNGGNLVIKIFTIFE 323
                    +V +D + +  G P         L    +++   +L  GG+ V+K+F    
Sbjct: 91  ---------VVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQ--G 139

Query: 324 SDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDF 362
                 +  +  LFT V + KP +S+  + E+Y++    
Sbjct: 140 EGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGR 178
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 100.0
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 99.94
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.42
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 97.2
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 97.08
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 96.9
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.58
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.5
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 96.32
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.25
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.2
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.18
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 96.08
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.03
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 96.01
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.99
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.94
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 95.88
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 95.81
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 95.76
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 95.71
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.59
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.51
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.45
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 95.42
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.18
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 95.17
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 95.1
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 95.09
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 94.96
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 94.94
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.84
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 94.77
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.6
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 94.6
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 94.4
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 94.31
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 94.21
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 94.02
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 93.94
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 93.7
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 93.66
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 93.65
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 93.6
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 93.51
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 93.31
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 93.23
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 93.03
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 92.94
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 92.85
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 92.64
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 92.38
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 92.25
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 92.13
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 92.0
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 91.15
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 90.61
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 90.53
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 90.32
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 90.09
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 89.78
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 89.63
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 87.92
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 86.35
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 86.08
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 83.57
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 82.06
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.6e-48  Score=351.98  Aligned_cols=180  Identities=21%  Similarity=0.258  Sum_probs=157.7

Q ss_pred             hhhHHHHHHHHHHHHhCCCCCCCCCCceEEEeccCCChhHHHHHHhhhccCCCCccceeccccCCCcCCCCCCcEEeccc
Q psy15838        140 QLATQAWCKFHEIVHSYNIVPQQENSFTSIHLCEAPGAFITSLNHYLKLHHPRMQWDWIANTLNPHYEGNSFDEMISDDR  219 (399)
Q Consensus       140 e~~trAw~KL~EId~~f~l~~~~~~~~~vlDLceaPGgFsqaln~yl~~~~~~~~w~~~a~sLnP~~e~n~~~~vI~dD~  219 (399)
                      +|||||||||.||+++|+|++++.   +|||||||||||+|++.+++..+                      +.++++|+
T Consensus         1 GyrsRaafKL~EI~~k~~l~k~~~---~vlDLg~aPGgw~q~~~~~~~~~----------------------~~v~~vDl   55 (180)
T d1ej0a_           1 GLRSRAWFKLDEIQQSDKLFKPGM---TVVDLGAAPGGWSQYVVTQIGGK----------------------GRIIACDL   55 (180)
T ss_dssp             CCSCHHHHHHHHHHHHHCCCCTTC---EEEEESCTTCHHHHHHHHHHCTT----------------------CEEEEEES
T ss_pred             CchhHHHHHHHHHHHHhCccCCCC---eEEEEeccCCcceEEEEeecccc----------------------ceEEEeec
Confidence            689999999999999999998764   99999999999999887755321                      23566666


Q ss_pred             cccccCccccCCCccccCCCChHHHHHHHHhhhhhhccCCCCCCCCCCCCcccEEEecCCCCCCCCCchhHHHHHHHHHH
Q psy15838        220 LILGTHRKWYFGPDNTGNILVQNFVSHFKQHIGFLLIHDTSLAPHCTHASHCFLVTADGSFDCQGNPGEQEILVGKLHYR  299 (399)
Q Consensus       220 ~~~~~~~~w~~G~d~tGDI~~~~~i~~i~~~v~~~~~~~~~~~~~~~~~~~vDLV~ADGs~d~sg~~~~qe~~s~~L~~~  299 (399)
                      +.+.+.+.+.   ..+|||++..+...+....               ..+++|||||||+||++|+++.||..+.+|+++
T Consensus        56 ~~~~~i~~~~---~~~~d~~~~~~~~~~~~~~---------------~~~~~DlVlSD~ap~~sg~~~~d~~~~~~L~~~  117 (180)
T d1ej0a_          56 LPMDPIVGVD---FLQGDFRDELVMKALLERV---------------GDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVEL  117 (180)
T ss_dssp             SCCCCCTTEE---EEESCTTSHHHHHHHHHHH---------------TTCCEEEEEECCCCCCCSCHHHHHHHHHHHHHH
T ss_pred             ccccccCCce---Eeecccccchhhhhhhhhc---------------cCcceeEEEecccchhcccchhHHHHHHHHHHH
Confidence            6666666433   3899999988888776633               246799999999999999999999999999999


Q ss_pred             HHHHHHhccCCCCEEEEeEccCCCCCHHHHHHHHHhcCCeeeeecCCCCCCCCceEEEEEeeccC
Q psy15838        300 EVQIALSLLHNGGNLVIKIFTIFESDTICLMYLLACLFTSVDLFKPATSKEGNSEIYVICRDFHS  364 (399)
Q Consensus       300 el~~Al~~Lr~GG~fVlK~F~~~e~~t~~Ll~lL~~~F~~V~v~KP~aSR~~sSE~YlVc~gf~g  364 (399)
                      ++.+|+.+|++||+||+|+|++.  .+..|++.|+.+|++|+++||.+||++|+|+|+||+||+.
T Consensus       118 ~l~~a~~~Lk~gG~fV~K~F~g~--~~~~l~~~l~~~F~~V~~~KP~aSR~~SsE~Ylv~~g~Kp  180 (180)
T d1ej0a_         118 ALEMCRDVLAPGGSFVVKVFQGE--GFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP  180 (180)
T ss_dssp             HHHHHHHHEEEEEEEEEEEESST--THHHHHHHHHHHEEEEEEECCTTSCTTCCEEEEEEEEECC
T ss_pred             HHHhhhhccCCCCcEEEEEecCc--cHHHHHHHHHhhcCEEEEECCCCcccCCceEEEEEecCCC
Confidence            99999999999999999999984  4999999999999999999999999999999999999973
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure