Psyllid ID: psy15843

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MLEEKVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITEELKTQ
cccHHHHHHHHHHHHHHHccccEEEEccccEEEEccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHcccccHHHHHHHHcccccccccEEEEccccEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHccc
cccccccHHHHHHHHHHHHcccccEEEEEEEEEEEcHHHHHHHHcccHcccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHccEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHHHHHHccccccccccHccccEEEccEEcccccEEEEEEEEEccccccccccccccHHHccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcc
MLEEKVILANILRRFRVEAVDRREDLTLLGElilrpqdgirpilnnsrtihkssdycyiepwlgnglltsaghiwhqrrKILTPAFHFRILEDFVEVFQEQSEVLVRRLGevgvgesinvFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLInripgptslpvlgnsiecnvdneetamgrkinaqddsnsEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASerhnlsdeniREEVDtfmfeghdttSAAICWTLLLLGSNQEIQNKVYEEILVTSFKAlhkpfttrsLNSMKYLEACIKEALRlypsvpfiarklsedvplpdyvlprdtEVIIVVYNlhrdpevfprpelydpdrflsenvagrnpyayipfsagprncigeseILEREQRKVatysanntfnvSVFSCQWITEELKTQ
MLEEKVILAnilrrfrveavdrredltllgelilrpqdgirpilnnSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLgevgvgesinvfpYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLinripgptslpvlgnSIECNVDNEETAMGrkinaqddsnsEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTlhsfsykvinerkaDLKARRNIEEtmedsaedvkkRPAFLDLLIEAserhnlsdenIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLsedvplpdyvlpRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYayipfsagprnCIGESEILEREQRKVatysanntfnvsvFSCQWITEELKTQ
MLEEKVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSevlvrrlgevgvgeSINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITEELKTQ
*****VILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNV*******************EYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINE***************************FLDLLIE***********IREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWIT******
**EEKVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSM*********SKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINER*********************KKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITEEL***
MLEEKVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIE**********KKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITEELKTQ
****KVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKA****************KRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEEKVILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVATYSANNTFNVSVFSCQWITEELKTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query517 2.2.26 [Sep-21-2011]
Q9VA27535 Cytochrome P450 4c3 OS=Dr yes N/A 0.543 0.525 0.559 5e-85
P29981511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.514 0.520 0.540 2e-76
Q9DBW0525 Cytochrome P450 4V2 OS=Mu yes N/A 0.539 0.531 0.478 2e-68
Q6ZWL3525 Cytochrome P450 4V2 OS=Ho yes N/A 0.516 0.508 0.492 4e-68
A2RRT9525 Cytochrome P450 4V2 OS=Ra yes N/A 0.539 0.531 0.471 7e-68
Q5RCN6525 Cytochrome P450 4V2 OS=Po yes N/A 0.516 0.508 0.488 2e-67
Q964T1501 Cytochrome P450 4c21 OS=B N/A N/A 0.539 0.556 0.462 3e-65
Q9VYY4574 Cytochrome P450 4g15 OS=D no N/A 0.787 0.709 0.334 5e-59
O16805512 Cytochrome P450 4d1 OS=Dr N/A N/A 0.529 0.535 0.413 3e-54
P33269512 Cytochrome P450 4d1 OS=Dr no N/A 0.529 0.535 0.413 4e-54
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function desciption
 Score =  315 bits (807), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 161/288 (55%), Positives = 203/288 (70%), Gaps = 7/288 (2%)

Query: 213 ETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTL 272
           ETAMGR+I AQ +S SEYVKAVY IGSI+Q RQAKI LQ DF+F L++ YK HQ  +NTL
Sbjct: 210 ETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTL 269

Query: 273 HSFSYKVINERKADLKARRNIEETMEDSAEDV------KKRPAFLDLLIEASERHN-LSD 325
           H FS  VI ERKA+L   +       ++A D       KKR AFLDLLI+AS+    LS+
Sbjct: 270 HGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEGTVLSN 329

Query: 326 ENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSL 385
           E+IREEVDTFMFEGHDTTSAAI WTL LLG + E Q +V EE+          P T ++L
Sbjct: 330 EDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNL 389

Query: 386 NSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPR 445
             M+YLE CIK++LRL+PSVP +AR + EDV +   ++P  T+ II+ Y LHR+P VFP+
Sbjct: 390 MDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPK 449

Query: 446 PELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVAT 493
           PE ++PD FL EN AGR+P+AYIPFSAGPRNCIG+   +  E+  ++T
Sbjct: 450 PEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIST 497
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 Back     alignment and function description
>sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 Back     alignment and function description
>sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 Back     alignment and function description
>sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 Back     alignment and function description
>sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 Back     alignment and function description
>sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
157117537544 cytochrome P450 [Aedes aegypti] gi|10887 0.518 0.492 0.578 3e-86
347963352554 AGAP000194-PA [Anopheles gambiae str. PE 0.518 0.483 0.560 7e-86
195113187533 GI22127 [Drosophila mojavensis] gi|19391 0.543 0.527 0.583 1e-85
170064449538 cytochrome P450 [Culex quinquefasciatus] 0.518 0.498 0.585 4e-85
195390897535 GJ24249 [Drosophila virilis] gi|19415218 0.543 0.525 0.576 5e-85
170069726538 cytochrome P450 [Culex quinquefasciatus] 0.518 0.498 0.585 5e-85
195452830533 GK14161 [Drosophila willistoni] gi|19416 0.543 0.527 0.573 1e-83
17864130535 cytochrome P450-4c3 [Drosophila melanoga 0.543 0.525 0.559 3e-83
195505316535 GE10910 [Drosophila yakuba] gi|194185552 0.543 0.525 0.559 8e-83
195575193535 GD21551 [Drosophila simulans] gi|1942014 0.543 0.525 0.559 8e-83
>gi|157117537|ref|XP_001658815.1| cytochrome P450 [Aedes aegypti] gi|108876007|gb|EAT40232.1| AAEL008017-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  325 bits (833), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/287 (57%), Positives = 203/287 (70%), Gaps = 19/287 (6%)

Query: 213 ETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTL 272
           ETAMGR I+AQ +S+S+YVKAVY+IGSI+Q RQ KI LQPDF+F+ +  Y+NHQRCL+ L
Sbjct: 207 ETAMGRLIHAQKNSDSDYVKAVYQIGSIVQNRQQKIWLQPDFIFKRTEDYRNHQRCLSIL 266

Query: 273 HSFSYKVINERKADLKARRN-------------IEETMEDSAEDV-----KKRPAFLDLL 314
           H FS +VI ERK +++ ++              +E  + D   +      KKR AFLDLL
Sbjct: 267 HEFSNRVIRERKEEIRKQKQSNNNTINGNANNAVEANILDGNNNAEEFGRKKRLAFLDLL 326

Query: 315 IEASERHN-LSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSF 373
           IEAS+    LS+E+IREEVDTFMFEGHDTTSAAI W LLLLG+   IQ+++ EEI     
Sbjct: 327 IEASQDGTVLSNEDIREEVDTFMFEGHDTTSAAISWILLLLGAEPAIQDRIVEEIDHIMG 386

Query: 374 KALHKPFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVV 433
               +  T + LN MKYLE CIKE LRLYPSVP IARKL EDV + DY +P  T  +IVV
Sbjct: 387 GDRDRFPTMKELNDMKYLECCIKEGLRLYPSVPLIARKLVEDVQIEDYTIPAGTTAMIVV 446

Query: 434 YNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGE 480
           Y LHRDP VFP P+ ++PD FL EN  GR+PYAYIPFSAGPRNCIG+
Sbjct: 447 YQLHRDPAVFPNPDKFNPDNFLPENCRGRHPYAYIPFSAGPRNCIGQ 493

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347963352|ref|XP_310940.5| AGAP000194-PA [Anopheles gambiae str. PEST] gi|333467240|gb|EAA06490.5| AGAP000194-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195113187|ref|XP_002001150.1| GI22127 [Drosophila mojavensis] gi|193917744|gb|EDW16611.1| GI22127 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|170064449|ref|XP_001867529.1| cytochrome P450 [Culex quinquefasciatus] gi|167881859|gb|EDS45242.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195390897|ref|XP_002054103.1| GJ24249 [Drosophila virilis] gi|194152189|gb|EDW67623.1| GJ24249 [Drosophila virilis] Back     alignment and taxonomy information
>gi|170069726|ref|XP_001869328.1| cytochrome P450 [Culex quinquefasciatus] gi|167865613|gb|EDS28996.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195452830|ref|XP_002073519.1| GK14161 [Drosophila willistoni] gi|194169604|gb|EDW84505.1| GK14161 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|17864130|ref|NP_524598.1| cytochrome P450-4c3 [Drosophila melanogaster] gi|12643918|sp|Q9VA27.1|CP4C3_DROME RecName: Full=Cytochrome P450 4c3; AltName: Full=CYPIVC3 gi|7301993|gb|AAF57098.1| cytochrome P450-4c3 [Drosophila melanogaster] gi|33589621|gb|AAQ22577.1| GH05994p [Drosophila melanogaster] gi|220951508|gb|ACL88297.1| Cyp4c3-PA [synthetic construct] gi|220959726|gb|ACL92406.1| Cyp4c3-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195505316|ref|XP_002099451.1| GE10910 [Drosophila yakuba] gi|194185552|gb|EDW99163.1| GE10910 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195575193|ref|XP_002105564.1| GD21551 [Drosophila simulans] gi|194201491|gb|EDX15067.1| GD21551 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query517
FB|FBgn0015032535 Cyp4c3 "Cytochrome P450-4c3" [ 0.555 0.536 0.559 3.1e-108
UNIPROTKB|E1BYW5530 CYP4V2 "Uncharacterized protei 0.516 0.503 0.490 1e-86
UNIPROTKB|F1PNR5523 CYP4V2 "Uncharacterized protei 0.529 0.523 0.485 3.5e-86
UNIPROTKB|Q6ZWL3525 CYP4V2 "Cytochrome P450 4V2" [ 0.529 0.521 0.482 9.2e-86
UNIPROTKB|Q5RCN6525 CYP4V2 "Cytochrome P450 4V2" [ 0.529 0.521 0.478 3.1e-85
ZFIN|ZDB-GENE-061103-601513 cyp4v8 "cytochrome P450, famil 0.566 0.571 0.442 5e-85
MGI|MGI:2142763525 Cyp4v3 "cytochrome P450, famil 0.539 0.531 0.478 2.2e-84
ZFIN|ZDB-GENE-061103-88510 cyp4v7 "cytochrome P450, famil 0.564 0.572 0.445 5.7e-84
UNIPROTKB|F1N3Z7527 CYP4V2 "Uncharacterized protei 0.537 0.527 0.474 7.3e-84
RGD|708530525 Cyp4v3 "cytochrome P450, famil 0.539 0.531 0.471 1.9e-83
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 791 (283.5 bits), Expect = 3.1e-108, Sum P(2) = 3.1e-108
 Identities = 165/295 (55%), Positives = 208/295 (70%)

Query:   207 CNVDNE-ETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNH 265
             C +D   ETAMGR+I AQ +S SEYVKAVY IGSI+Q RQAKI LQ DF+F L++ YK H
Sbjct:   203 CTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLH 262

Query:   266 QRCLNTLHSFSYKVINERKADL----KARRNIEETMEDSAEDV--KKRPAFLDLLIEASE 319
             Q  +NTLH FS  VI ERKA+L    +   N      D+ +DV  KKR AFLDLLI+AS+
Sbjct:   263 QSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASK 322

Query:   320 RHN-LSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHK 378
                 LS+E+IREEVDTFMFEGHDTTSAAI WTL LLG + E Q +V EE+          
Sbjct:   323 EGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKET 382

Query:   379 PFTTRSLNSMKYLEACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHR 438
             P T ++L  M+YLE CIK++LRL+PSVP +AR + EDV +   ++P  T+ II+ Y LHR
Sbjct:   383 PATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHR 442

Query:   439 DPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCIGESEILEREQRKVAT 493
             +P VFP+PE ++PD FL EN AGR+P+AYIPFSAGPRNCIG+   +  E+  ++T
Sbjct:   443 NPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIST 497
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNR5 CYP4V2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZWL3 CYP4V2 "Cytochrome P450 4V2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCN6 CYP4V2 "Cytochrome P450 4V2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-601 cyp4v8 "cytochrome P450, family 4, subfamily V, polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2142763 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3Z7 CYP4V2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|708530 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VA27CP4C3_DROME1, ., 1, 4, ., -, ., -0.55900.54350.5252yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
pfam00067461 pfam00067, p450, Cytochrome P450 3e-78
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-38
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-30
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-27
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-24
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-23
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 1e-22
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 7e-22
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-21
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-20
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-20
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-18
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 3e-18
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 8e-18
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-17
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-17
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 9e-17
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-16
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 4e-15
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-14
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 9e-14
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-12
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 5e-11
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 8e-11
pfam00067461 pfam00067, p450, Cytochrome P450 1e-10
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 4e-09
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 8e-07
PLN02648480 PLN02648, PLN02648, allene oxide synthase 3e-05
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 9e-05
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 0.003
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  252 bits (645), Expect = 3e-78
 Identities = 96/263 (36%), Positives = 138/263 (52%), Gaps = 20/263 (7%)

Query: 223 QDDSNSEYVKAVYEIGSIIQKRQAKIHLQ-PDFLFRLSSLYKNHQRCLNTLHSFSYKVIN 281
           +D    E VKAV E+ S++     ++    P   +      +  +R    +     K+I 
Sbjct: 166 EDPKFLELVKAVQELSSLLSSPSPQLLDLFPILKYFPGPHGRKLKRARKKIKDLLDKLIE 225

Query: 282 ERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHN---LSDENIREEVDTFMFE 338
           ER+  L                 K    FLD L+ A E  +   L+DE +R  V    F 
Sbjct: 226 ERRETL-------------DSAKKSPRDFLDALLLAKEEEDGSKLTDEELRATVLELFFA 272

Query: 339 GHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEA 398
           G DTTS+ + W L  L  + E+Q K+ EEI         +  T   L +M YL+A IKE 
Sbjct: 273 GTDTTSSTLSWALYELAKHPEVQEKLREEIDEV--IGDKRSPTYDDLQNMPYLDAVIKET 330

Query: 399 LRLYPSVPF-IARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSE 457
           LRL+P VP  + R++++D  +P Y++P+ T VI+ +Y LHRDPEVFP PE +DP+RFL E
Sbjct: 331 LRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDE 390

Query: 458 NVAGRNPYAYIPFSAGPRNCIGE 480
           N   R  +A++PF AGPRNC+GE
Sbjct: 391 NGKFRKSFAFLPFGAGPRNCLGE 413

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 517
KOG0157|consensus497 100.0
KOG0158|consensus499 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
KOG0156|consensus489 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
KOG0159|consensus519 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
KOG0684|consensus486 100.0
>KOG0157|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.2e-64  Score=545.64  Aligned_cols=409  Identities=40%  Similarity=0.645  Sum_probs=341.2

Q ss_pred             HHHHHHhhcccccccCccceEEEEEEEeecccccccccccc-ccccCchhhh-cchhhhcCccccCCcchHHhhccccCC
Q psy15843          7 ILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNS-RTIHKSSDYC-YIEPWLGNGLLTSAGHIWHQRRKILTP   84 (517)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~vvv~dp~~i~~il~~~-~~~~k~~~~~-~~~~~~g~gl~~~~g~~wr~~Rk~l~p   84 (517)
                      +...+..+...++..+...++..+.|+++||+.+++|+.++ ....|.+.|. .+.+++|+|+++++|+.|+++||+++|
T Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~~dp~~~~~Il~~~~~~~~k~~~~~~~~~~~lG~gll~~~g~~W~~~Rk~~~~  138 (497)
T KOG0157|consen   59 ILDFVTELLSRYGPIFKTWLGGKPTVVTTDPELIEEILKSSNENYPKGPDYPESLKPWLGDGLLFSDGEKWHKHRKLLTP  138 (497)
T ss_pred             HHHHHHHHHHHcCchhhhhhcCeeEEEEcCHHHHHHHHhcCcccCCCchhHHHHHHHHhcCccccCCchHHHHHHhhccH
Confidence            33444444455555555666766799999999999999653 4566777666 788999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHhccCCCceeechhhhhhhhhhhhhhhHHHHHHHHhHhhhcchhhhhhhhhHHHHH
Q psy15843         85 AFHFRILEDFVEVFQEQSEVLVRRLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFR  164 (517)
Q Consensus        85 aFs~~~l~~~~~~i~~~~~~lv~~L~~~~~g~~v~v~~~~~~~t~dii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (517)
                      +||.+.++++.+.+.+.+..++..+.....++.||+.+++.++|+|++                                
T Consensus       139 ~f~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~vd~~~~~~~~tld~i--------------------------------  186 (497)
T KOG0157|consen  139 AFHFEILKSFVPVFIESSLILLLLLELAASGEEVDLQDLLKRLTLDII--------------------------------  186 (497)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHhhcCCeEcHHHHHHHHHHHHH--------------------------------
Confidence            999999999999999999998888877554555999999999999999                                


Q ss_pred             HHHHHhhhhhhHHHHhhhhhHHHhhhcCCCCCCCCCcCCcccccCCcccccccccc-ccCCCCChHHHHHHHHHHHHHHH
Q psy15843        165 TIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKI-NAQDDSNSEYVKAVYEIGSIIQK  243 (517)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~~~~~  243 (517)
                                                                |     .++||... +.+.....++.+++..+...+..
T Consensus       187 ------------------------------------------~-----~~~~G~~~~~~~~~~~~~~~~a~~~~~~~~~~  219 (497)
T KOG0157|consen  187 ------------------------------------------C-----KTAMGPESLDAEGPELFEYVQAFDDLTELISK  219 (497)
T ss_pred             ------------------------------------------H-----HHhcCCccccccCCcccHHHHHHHHHHHHHHH
Confidence                                                      8     99999332 33444467899999888888887


Q ss_pred             hhhhcccchhHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhhhhhcCCchHHHHHHHHHhcCCC
Q psy15843        244 RQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNL  323 (517)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~~~l  323 (517)
                      +...|. ...+++.+. ..++.+++.+.+++++.++|++|+++...+...         ..+...|+++.+..... ..+
T Consensus       220 ~~~~p~-~~~~~~~~~-~~~~~~~a~~~~~~~~~~iI~~rr~~~~~~~~~---------~~~~~~d~L~~~~~~~~-~~l  287 (497)
T KOG0157|consen  220 RINLPL-GTKFLYGLK-SERKLKKARKILHDFLEKIIRERREELEKEGSG---------EEKKRLDFLDTLLLEED-KPL  287 (497)
T ss_pred             HHcCch-hhhHHhhcc-hHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCc---------ccchhhhHHHHHHHhcc-CCC
Confidence            776665 344444444 778899999999999999999999877544320         01346788886333322 679


Q ss_pred             CHHhHHHHHHHHHHHhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhhhcCCCCCChhhhcCChhHHHHHHHHhccCC
Q psy15843        324 SDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYP  403 (517)
Q Consensus       324 s~~~i~~~~~~~~~aG~dTTs~~l~~~l~~L~~~pe~q~klr~Ei~~~~~~~~~~~~t~~~l~~lpyL~avi~E~lRL~p  403 (517)
                      ++++|++++.+||+||+||||++++|++++|+.||++|+|+++|+ .++++......+..+.++|+|+++||+|||||||
T Consensus       288 ~~~~i~d~v~tf~faG~DTTss~ltw~l~~La~hP~vq~k~~eEi-~~i~~~~~~~~~~~~~~~m~yl~~vi~EsLRLyp  366 (497)
T KOG0157|consen  288 TDEDIRDEVDTFMFAGHDTTSSALTWTLWLLAKHPEVQEKLREEV-DEILGNRDDKWEVEKLDQMKYLEMVIKESLRLYP  366 (497)
T ss_pred             CHHHHHHHHHHheeeccchHHHHHHHHHHHHhcCHHHHHHHHHHH-HHHhCCCCCCCChhhhhhhHHHHHHHHHHhccCC
Confidence            999999999999999999999999999999999999999999999 9999754333233333369999999999999999


Q ss_pred             CcccccceeccccccC-CeeeCCCCEEEEechhhhcCCCCCC-CCCCcCCCCCCCCccC-CCCCCccccCCCCCCCCCCh
Q psy15843        404 SVPFIARKLSEDVPLP-DYVLPRDTEVIIVVYNLHRDPEVFP-RPELYDPDRFLSENVA-GRNPYAYIPFSAGPRNCIGE  480 (517)
Q Consensus       404 ~~~~~~R~a~~d~~l~-g~~IP~gt~V~~~~~~~hrdp~~~~-dP~~F~PeRfl~~~~~-~~~~~~~lpFG~G~R~C~G~  480 (517)
                      |+|+..|.+.+|++++ ||.||||+.|.++.|++||||++|+ ||++|||+||+++... ..++++|+|||+|||.|+|+
T Consensus       367 pvp~~~R~~~~d~~l~~g~~IPkG~~V~i~~~~~~r~~~~~~~dp~~F~PeRf~~~~~~~~~~~~~fipFsaGpR~CiG~  446 (497)
T KOG0157|consen  367 PVPLVARKATKDVKLPGGYTIPKGTNVLISIYALHRDPRVWGEDPEEFDPERFLDGEEKAKRHPFAFIPFSAGPRNCIGQ  446 (497)
T ss_pred             CCchhhcccCCCeEcCCCcEeCCCCEEEEehHHhccCccccCCChhhcCccccCCCCCcCCCCCccccCCCCCcccchhH
Confidence            9999999999999995 8999999999999999999999996 9999999999976433 56689999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhcceEeccCCc
Q psy15843        481 SEILEREQRKVATYSANNTFNVSVFSC  507 (517)
Q Consensus       481 ~lA~~el~~~la~ll~~f~~~~~~~~~  507 (517)
                      ++|++|++++++.++++|+|+++.+..
T Consensus       447 ~fA~lemKv~l~~ll~~f~~~~~~~~~  473 (497)
T KOG0157|consen  447 KFAMLEMKVVLAHLLRRFRIEPVGGDK  473 (497)
T ss_pred             HHHHHHHHHHHHHHHHheEEEecCCCC
Confidence            999999999999999999999887753

>KOG0158|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 7e-26
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 7e-26
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 7e-26
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 5e-22
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-20
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-20
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-19
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 3e-19
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 4e-19
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-19
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-19
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 5e-19
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 5e-19
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-18
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-18
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 5e-18
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 6e-18
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 6e-18
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 7e-18
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 9e-18
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 9e-18
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-17
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-17
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-17
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-17
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-17
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-17
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-17
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 1e-17
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-17
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-17
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-17
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 2e-17
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-17
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-17
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 2e-17
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-17
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 3e-17
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-17
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 4e-17
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 4e-17
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 5e-17
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 5e-17
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-17
1fah_A471 Structure Of Cytochrome P450 Length = 471 5e-17
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-17
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 5e-17
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-17
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 9e-17
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-16
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-16
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-16
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-16
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-16
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-16
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-16
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 3e-16
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-16
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 6e-16
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-15
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-15
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-15
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-15
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-15
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 4e-15
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 8e-15
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 1e-14
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-14
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-14
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-13
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 4e-13
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 5e-13
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 5e-13
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-13
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-12
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-12
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-12
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 2e-12
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 2e-12
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 2e-12
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-12
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-11
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-11
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-11
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 2e-11
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 2e-11
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 2e-11
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-11
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 5e-11
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-10
3pm0_A507 Structural Characterization Of The Complex Between 4e-10
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 7e-10
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 7e-09
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-08
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-08
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-08
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-08
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 2e-07
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 3e-07
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 9e-07
2iag_A482 Crystal Structure Of Human Prostacyclin Synthase Le 2e-05
3b6h_A498 Crystal Structure Of Human Prostacyclin Synthase In 2e-05
3buj_A397 Crystal Structure Of Calo2 Length = 397 2e-05
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 4e-05
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 4e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 6e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 6e-05
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 1e-04
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 2e-04
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 2e-04
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 2e-04
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 3e-04
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 3e-04
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 3e-04
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 3e-04
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 4e-04
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 7e-04
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 9e-04
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (287), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 112/198 (56%), Gaps = 11/198 (5%)
Query: 290 RRNIEETMEDSAEDVKK-RPAFLDLLIEA-----SERHN-LSDENIREEVDTFMFEGHDT 342
           R++++   E   ED +K R  FL L+I++     +E H  LSD  +  +   F+F G++T
Sbjct: 229 RKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYET 288
Query: 343 TSAAICWTLLLLGSNQEIQNKVYEEI-LVTSFKALHKPFTTRSLNSMKYLEACIKEALRL 401
           TS+ + + +  L ++ ++Q K+ EEI  V   KA   P T  ++  M+YL+  + E LRL
Sbjct: 289 TSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKA---PPTYDTVLQMEYLDMVVNETLRL 345
Query: 402 YPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAG 461
           +P    + R   +DV +    +P+   V+I  Y LHRDP+ +  PE + P+RF  +N   
Sbjct: 346 FPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDN 405
Query: 462 RNPYAYIPFSAGPRNCIG 479
            +PY Y PF +GPRNCIG
Sbjct: 406 IDPYIYTPFGSGPRNCIG 423
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|2IAG|A Chain A, Crystal Structure Of Human Prostacyclin Synthase Length = 482 Back     alignment and structure
>pdb|3B6H|A Chain A, Crystal Structure Of Human Prostacyclin Synthase In Complex With Inhibitor Minoxidil Length = 498 Back     alignment and structure
>pdb|3BUJ|A Chain A, Crystal Structure Of Calo2 Length = 397 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query517
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-111
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-30
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-08
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-105
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 8e-26
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-07
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-88
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-25
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-06
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 8e-88
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-27
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-05
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 8e-85
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 7e-21
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-05
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 9e-85
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-23
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-04
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 8e-79
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-10
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 5e-04
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-76
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-09
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 8e-04
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-76
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-20
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-04
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-67
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-04
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-65
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-62
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-61
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-58
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-21
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 9e-06
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 4e-55
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-07
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-54
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-07
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-49
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-46
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-09
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-44
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-09
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-38
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-36
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-36
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-36
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 6e-36
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-35
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-34
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-33
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-33
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 9e-33
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 5e-14
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 6e-13
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 8e-13
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-12
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 4e-12
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 8e-12
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 9e-12
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 1e-11
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 2e-11
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 4e-11
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 4e-11
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 5e-11
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 8e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 1e-10
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-10
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-10
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 5e-10
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 6e-10
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 6e-10
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 6e-10
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 8e-10
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 2e-09
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 2e-09
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 4e-09
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 7e-09
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 1e-08
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-08
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-08
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 5e-08
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 8e-08
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 9e-08
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-07
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 2e-07
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-07
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 4e-07
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 6e-07
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 6e-07
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 8e-07
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 8e-07
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 8e-07
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 9e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 5e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  337 bits (866), Expect = e-111
 Identities = 58/267 (21%), Positives = 105/267 (39%), Gaps = 21/267 (7%)

Query: 213 ETAMGRKINAQDDSNSEYVKAVYEIGSIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTL 272
           + A G + +    +     +AV  +   I   +  +     FL       +  +  +  L
Sbjct: 146 KAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTL---AKFLPGKRKQLREVRESIRFL 202

Query: 273 HSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNLSDENIREEV 332
                  +  R+  LK                +     L  +++A E     DE + +  
Sbjct: 203 RQVGRDWVQRRREALKRGE-------------EVPADILTQILKAEEG-AQDDEGLLDNF 248

Query: 333 DTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLE 392
            TF   GH+T++  + +T++ L    EI  ++  E+      +  +      L  ++YL 
Sbjct: 249 VTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEV-IGS-KRYLDFEDLGRLQYLS 306

Query: 393 ACIKEALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPD 452
             +KE+LRLYP      R L E+  +    +P +T ++   Y + R    F  P  ++PD
Sbjct: 307 QVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPD 366

Query: 453 RFLSENVAGRNPYAYIPFSAGPRNCIG 479
           RF       +  + Y PFS G R+CIG
Sbjct: 367 RFGPGAP--KPRFTYFPFSLGHRSCIG 391
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-64  Score=529.47  Aligned_cols=402  Identities=21%  Similarity=0.331  Sum_probs=326.3

Q ss_pred             HHHHHHHhhcccccccCccceEEEEEEEeeccccccccccccccccCchhhhcc-----hhhhcCccccC-CcchHHhhc
Q psy15843          6 VILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSRTIHKSSDYCYI-----EPWLGNGLLTS-AGHIWHQRR   79 (517)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~vvv~dp~~i~~il~~~~~~~k~~~~~~~-----~~~~g~gl~~~-~g~~wr~~R   79 (517)
                      .....+.++.++||...+..++..+.|+++||+++++|+.++....++..+..+     ..++|.|+++. +|+.|+++|
T Consensus        11 ~~~~~~~~~~~kyG~v~~~~~~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~w~~~R   90 (456)
T 3mdm_A           11 VLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQR   90 (456)
T ss_dssp             CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTCTTSCCCHHHHHHHHEETTEESSTTSTTTCCCHHHHHHHH
T ss_pred             hHHHHHHHHHHHhCCeEEEEeCCCCEEEECCHHHHHHHHhhccccccchhHHHHHHhhcccccCCCcccCCChHHHHHHH
Confidence            344455667777777666666556789999999999999764332222223222     12356777765 899999999


Q ss_pred             cccCCcCCHHHHHHHHHHHHHHHHHHHHHHhccCC-CceeechhhhhhhhhhhhhhhHHHHHHHHhHhhhcchhhhhhhh
Q psy15843         80 KILTPAFHFRILEDFVEVFQEQSEVLVRRLGEVGV-GESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQS  158 (517)
Q Consensus        80 k~l~paFs~~~l~~~~~~i~~~~~~lv~~L~~~~~-g~~v~v~~~~~~~t~dii~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (517)
                      |+++++|+.+.++.+.|.+.+.++.+++.|...+. +.++|+...+..+++|++                          
T Consensus        91 r~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~~~~vd~~~~~~~~~~dvi--------------------------  144 (456)
T 3mdm_A           91 RVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDIL--------------------------  144 (456)
T ss_dssp             HHHGGGGSHHHHHTTHHHHHHHHHHHHHHHHHTCSSSSCEEHHHHHHHHHHHHH--------------------------
T ss_pred             hhcccccCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCeeeHHHHHHHHHHHHH--------------------------
Confidence            99999999999999999999999999999987654 578999999999999999                          


Q ss_pred             hHHHHHHHHHHhhhhhhHHHHhhhhhHHHhhhcCCCCCCCCCcCCcccccCCccccccccccccCCCCChHHHHHHHHHH
Q psy15843        159 VIREFRTIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIG  238 (517)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~  238 (517)
                                                                      +     .++||.+++..++...++.+.+..+.
T Consensus       145 ------------------------------------------------~-----~~~fG~~~~~~~~~~~~~~~~~~~~~  171 (456)
T 3mdm_A          145 ------------------------------------------------A-----KAAFGMETSMLLGAQKPLSQAVKLML  171 (456)
T ss_dssp             ------------------------------------------------H-----HHHHSCCCCGGGTCCHHHHHHHHHHH
T ss_pred             ------------------------------------------------H-----HHHcCCChhhhcccccHHHHHHHHHH
Confidence                                                            7     88888888766555566766666665


Q ss_pred             HHHHHhhhhcccchhHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhhhhhcCCchHHHHHHHHH
Q psy15843        239 SIIQKRQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEAS  318 (517)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~ll~~~  318 (517)
                      ..+.... .+  ...++.......+...++.+.+..+..+.|+++++....+             .....|+++.++++.
T Consensus       172 ~~~~~~~-~~--~~~~~p~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~-------------~~~~~d~l~~ll~~~  235 (456)
T 3mdm_A          172 EGITASR-NT--LAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRG-------------EEVPADILTQILKAE  235 (456)
T ss_dssp             HHHHHHH-HS--CGGGCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-------------CCCCCCHHHHHHHHT
T ss_pred             HHHHHHH-HH--HHHhCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc-------------ccchhhHHHHHHHhc
Confidence            5443321 11  1111111112234555667777888888888887654221             123579999999875


Q ss_pred             hcCCCCHHhHHHHHHHHHHHhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhhhcCCCCCChhhhcCChhHHHHHHHH
Q psy15843        319 ERHNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEA  398 (517)
Q Consensus       319 ~~~~ls~~~i~~~~~~~~~aG~dTTs~~l~~~l~~L~~~pe~q~klr~Ei~~~~~~~~~~~~t~~~l~~lpyL~avi~E~  398 (517)
                       ++.++++++.+++.++++||+|||+++++|++|+|++||++|+|||+|| +++++.. +.++++++.+||||+|||+|+
T Consensus       236 -~~~~~~~~l~~~~~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei-~~~~~~~-~~~~~~~l~~lpyl~a~i~E~  312 (456)
T 3mdm_A          236 -EGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEV-DEVIGSK-RYLDFEDLGRLQYLSQVLKES  312 (456)
T ss_dssp             -SSCSSSHHHHHHHHHHHHHTTHHHHHHHHHHHHHHTTCHHHHHHHHHHH-HHHTTTC-SSCCHHHHHHCHHHHHHHHHH
T ss_pred             -CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHH-HHHcCCC-CCCCHHHHhcCHHHHHHHHHH
Confidence             3568999999999999999999999999999999999999999999999 8888865 789999999999999999999


Q ss_pred             hccCCCcccccceeccccccCCeeeCCCCEEEEechhhhcCCCCCCCCCCcCCCCCCCCccCCCCCCccccCCCCCCCCC
Q psy15843        399 LRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRNCI  478 (517)
Q Consensus       399 lRL~p~~~~~~R~a~~d~~l~g~~IP~gt~V~~~~~~~hrdp~~~~dP~~F~PeRfl~~~~~~~~~~~~lpFG~G~R~C~  478 (517)
                      ||++|++|..+|++.+|++++||.||+||.|.++.|++||||++||||++|+||||+++..  ..+.+|+|||.|+|.|+
T Consensus       313 lRl~p~~~~~~r~~~~d~~i~g~~Ip~Gt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~--~~~~~~~pFg~G~r~C~  390 (456)
T 3mdm_A          313 LRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAP--KPRFTYFPFSLGHRSCI  390 (456)
T ss_dssp             HHHCCSSCCEEEEECSCEEETTEEECSSEEEEECHHHHHTCTTTSSSTTSCCGGGGSTTSC--CCSSSCCTTCCGGGSCT
T ss_pred             HHhCCCccccccccCCceeECCEEECCCCEEEeehHHhcCCchhcCCccccCccccCCCCC--CCCCcccCCCCCCcCCC
Confidence            9999999998899999999999999999999999999999999999999999999997642  34577999999999999


Q ss_pred             ChHHHHHHHHHHHHHHHHhcceEeccCCc
Q psy15843        479 GESEILEREQRKVATYSANNTFNVSVFSC  507 (517)
Q Consensus       479 G~~lA~~el~~~la~ll~~f~~~~~~~~~  507 (517)
                      |++||.+|++++++.|+++|+|+++++..
T Consensus       391 G~~lA~~e~~~~la~ll~~f~~~~~~~~~  419 (456)
T 3mdm_A          391 GQQFAQMEVKVVMAKLLQRLEFRLVPGQR  419 (456)
T ss_dssp             THHHHHHHHHHHHHHHHHHEEEEECTTCC
T ss_pred             CHHHHHHHHHHHHHHHHHhCeEEeCCCCc
Confidence            99999999999999999999999886643
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 517
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-40
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-05
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-34
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 8e-06
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 0.002
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-30
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-22
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-04
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-21
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-07
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 5e-15
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-15
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-06
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.001
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 4e-14
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 5e-14
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-13
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-06
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-13
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-12
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 0.004
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-12
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 6e-12
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 7e-12
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 5e-10
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 8e-10
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 9e-10
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-09
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 6e-09
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 7e-09
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-07
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-04
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  148 bits (374), Expect = 5e-40
 Identities = 88/435 (20%), Positives = 151/435 (34%), Gaps = 48/435 (11%)

Query: 61  PWLGNGLLTSAGHIW---HQRRKILTPAFHFRIL----------EDFVEVFQEQSEVLVR 107
           P LGN L      +     + R+     F   +           +   E   +Q+E    
Sbjct: 11  PVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSG 70

Query: 108 RLGEVGVGESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFRTIA 167
           R         I V   +      I    E    LR      M    M  +SV    +  A
Sbjct: 71  R-------GKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEA 123

Query: 168 LLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSN 227
             L        R  +  L+         TS  +                G++ + +D   
Sbjct: 124 RCL----VEELRKSKGALLDNTLLFHSITSNII-----------CSIVFGKRFDYKDPVF 168

Query: 228 SEYVKAVYEIGSIIQKRQAKI-HLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKAD 286
              +   ++  S+I    +++  L   FL      ++   R L  +++F  + + + +A 
Sbjct: 169 LRLLDLFFQSFSLISSFSSQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRAT 228

Query: 287 LKARRNIEETMEDSAEDVKKRPAFLDLLIEASERHNLSDENIREEVDTFMFEGHDTTSAA 346
           L      +          K          ++        +N+   V +  F G +TTS  
Sbjct: 229 LDPSNPRDFIDVYLLRMEKD---------KSDPSSEFHHQNLILTVLSLFFAGTETTSTT 279

Query: 347 ICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIKEALRLYPSVP 406
           + +  LL+     +  +V +EI        H+P        M Y +A I E  RL   +P
Sbjct: 280 LRYGFLLMLKYPHVTERVQKEIE--QVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIP 337

Query: 407 FIAR-KLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPY 465
           F     +++D     YV+P++TEV  V+ +   DP  F  P  ++P  FL  N A +   
Sbjct: 338 FGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALKRNE 397

Query: 466 AYIPFSAGPRNCIGE 480
            ++PFS G R C+GE
Sbjct: 398 GFMPFSLGKRICLGE 412
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query517
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-62  Score=510.17  Aligned_cols=406  Identities=23%  Similarity=0.345  Sum_probs=320.2

Q ss_pred             HHHHHHhhcccccccCccceEEEEEEEeeccccccccccccc-cccCchhhhcchhhhcCccccCCcchHHhhccccCCc
Q psy15843          7 ILANILRRFRVEAVDRREDLTLLGELILRPQDGIRPILNNSR-TIHKSSDYCYIEPWLGNGLLTSAGHIWHQRRKILTPA   85 (517)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~vvv~dp~~i~~il~~~~-~~~k~~~~~~~~~~~g~gl~~~~g~~wr~~Rk~l~pa   85 (517)
                      ...++.+++++||..++..++....|+|+||+++++||.++. .+............+++|+++++|+.|+++|++++++
T Consensus        30 ~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~R~~~~~~  109 (472)
T d1tqna_          30 FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPT  109 (472)
T ss_dssp             HHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCGGGGGSTTTCCHHHHHHHHHHTTGG
T ss_pred             HHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccccccCCceeccCcHHHHHhhhhcCcc
Confidence            445566777888877666666777999999999999998653 2222221122234567899999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHhccCC-CceeechhhhhhhhhhhhhhhHHHHHHHHhHhhhcchhhhhhhhhHHHHH
Q psy15843         86 FHFRILEDFVEVFQEQSEVLVRRLGEVGV-GESINVFPYVTLCTLDIKLQWEEKSMLRATVTQNMSKLSMSIQSVIREFR  164 (517)
Q Consensus        86 Fs~~~l~~~~~~i~~~~~~lv~~L~~~~~-g~~v~v~~~~~~~t~dii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (517)
                      |+...++.+.+.+++.++.+++.|.+.+. +.++|+.+.+..+++|++                                
T Consensus       110 ~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~--------------------------------  157 (472)
T d1tqna_         110 FTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVI--------------------------------  157 (472)
T ss_dssp             GSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHH--------------------------------
T ss_pred             ccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhh--------------------------------
Confidence            99999999999999999999999987654 788999999999999999                                


Q ss_pred             HHHHHhhhhhhHHHHhhhhhHHHhhhcCCCCCCCCCcCCcccccCCccccccccccccCCCCChHHHHHHHHHHHHHHH-
Q psy15843        165 TIALLLTLGYFVVRRIKQSRLVKLINRIPGPTSLPVLGNSIECNVDNEETAMGRKINAQDDSNSEYVKAVYEIGSIIQK-  243 (517)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~-  243 (517)
                                                                +     .++||.+++..++...++......+...... 
T Consensus       158 ------------------------------------------~-----~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (472)
T d1tqna_         158 ------------------------------------------T-----STSFGVNIDSLNNPQDPFVENTKKLLRFDFLD  190 (472)
T ss_dssp             ------------------------------------------H-----HTSSCCCCCGGGCTTCHHHHHHTTCCCCCTTS
T ss_pred             ------------------------------------------h-----heecccccccccccchhhhHHHHHHhhhhhcc
Confidence                                                      7     8889988877766566665554332210000 


Q ss_pred             -hhhhcccchhHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhhhhhcCCchHHHHHHHHHhc--
Q psy15843        244 -RQAKIHLQPDFLFRLSSLYKNHQRCLNTLHSFSYKVINERKADLKARRNIEETMEDSAEDVKKRPAFLDLLIEASER--  320 (517)
Q Consensus       244 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~--  320 (517)
                       ........+.++. . ...+......+.+.+++...++++++.....            ..+...+..+.++.....  
T Consensus       191 ~~~~~~~~~~~~~~-~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~  256 (472)
T d1tqna_         191 PFFLSITVFPFLIP-I-LEVLNICVFPREVTNFLRKSVKRMKESRLED------------TQKHRVDFLQLMIDSQNSKE  256 (472)
T ss_dssp             HHHHHHHHCGGGHH-H-HHHTTCCSSCHHHHHHHHHHHHHHHTTTTTT------------CSCCCCCHHHHHHHHHCC--
T ss_pred             chhccccccccccc-c-cccccccccchhhhHHHHHHHHHhhhccccc------------ccccccchhhhhhhcccccc
Confidence             0000000111111 1 0111222223344555555566555543211            123456677777766421  


Q ss_pred             ----CCCCHHhHHHHHHHHHHHhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhhhcCCCCCChhhhcCChhHHHHHH
Q psy15843        321 ----HNLSDENIREEVDTFMFEGHDTTSAAICWTLLLLGSNQEIQNKVYEEILVTSFKALHKPFTTRSLNSMKYLEACIK  396 (517)
Q Consensus       321 ----~~ls~~~i~~~~~~~~~aG~dTTs~~l~~~l~~L~~~pe~q~klr~Ei~~~~~~~~~~~~t~~~l~~lpyL~avi~  396 (517)
                          ..++++++.+++..+++||+|||+.+++|++++|++||++|+|+|+|| .++++.. ..++.+++.++|||+|||+
T Consensus       257 ~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei-~~~~~~~-~~~~~~~l~~~~~l~a~i~  334 (472)
T d1tqna_         257 TESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEI-DAVLPNK-APPTYDTVLQMEYLDMVVN  334 (472)
T ss_dssp             --CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH-HHHSTTT-CCCCHHHHHHCHHHHHHHH
T ss_pred             cccccchhhhHHHhhhhhhhhcccccccccceeeccccccCcccccccccee-heecccc-ccchHHHhhccccccceee
Confidence                579999999999999999999999999999999999999999999999 8888765 6788999999999999999


Q ss_pred             HHhccCCCcccccceeccccccCCeeeCCCCEEEEechhhhcCCCCCCCCCCcCCCCCCCCccCCCCCCccccCCCCCCC
Q psy15843        397 EALRLYPSVPFIARKLSEDVPLPDYVLPRDTEVIIVVYNLHRDPEVFPRPELYDPDRFLSENVAGRNPYAYIPFSAGPRN  476 (517)
Q Consensus       397 E~lRL~p~~~~~~R~a~~d~~l~g~~IP~gt~V~~~~~~~hrdp~~~~dP~~F~PeRfl~~~~~~~~~~~~lpFG~G~R~  476 (517)
                      |++|++|+++.++|.+.+|+.++||.|||||.|+++.+.+|+||++|+||++|+||||++++.....+++|+|||+|+|.
T Consensus       335 E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~  414 (472)
T d1tqna_         335 ETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRN  414 (472)
T ss_dssp             HHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTS
T ss_pred             eccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999887666678899999999999


Q ss_pred             CCChHHHHHHHHHHHHHHHHhcceEeccCCc
Q psy15843        477 CIGESEILEREQRKVATYSANNTFNVSVFSC  507 (517)
Q Consensus       477 C~G~~lA~~el~~~la~ll~~f~~~~~~~~~  507 (517)
                      |+|+++|.+|++++++.||++|+|+++.+..
T Consensus       415 C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~  445 (472)
T d1tqna_         415 CIGMRFALMNMKLALIRVLQNFSFKPCKETQ  445 (472)
T ss_dssp             CTTHHHHHHHHHHHHHHHHTTEEEECCTTCC
T ss_pred             ChhHHHHHHHHHHHHHHHHHhCEEEeCCCCC
Confidence            9999999999999999999999999887654
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure