Psyllid ID: psy15864


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MDSSTKHQIGTFTEPTPLDWKKAKKKEKKKKEKKAKKKEKKKEKKKKEKKKKKKKKKKKKKNNNNNNNNNNNNNNNNNNNNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAARVEGQEEVKGEDNFGMEGEDGKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAAKVEGQEEVKGEDNFGMEGEDGKYI
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHccccccccccccccEEEEEEEEEEHHHcccccccccHHHHHHHHHHccccEEEHHHHHHHHHHHHHccccccccccccccccccccccc
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHcHcEEEEEcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccEEEEHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHccccccccccccccHHcccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHEEcccEEEcccccccccccccccc
mdsstkhqigtfteptpldwkKAKKKEKKKKEKKAKKKEKKKEKKKKEKKKKKKKKKKKKknnnnnnnnnnnnnnnnnnnnnnnnneekgtflykmAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCAlyfipesphwlisQGRMQEASASLCwlrgwvtpdkVQTELSQITKAIEESELKRlgkdgqrrpnyrmyMRRTFLLPYAIVTSLFfigqfggmttlQTYAVGIFesihapldpYFATLLLGVAELGGALLCVVLIHYtgkrplalistggsAACFIVVAVYAQFHlsygwdsplvPTVFLVLAAFLTHICIRLlpwmligevfpnniratasgasgsssYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFvmpetegrtlRDIEEHFADKGKTFVTNIRRAEKKRHAArvegqeevkgednfgmegedgkyISRVVGTLYMYFVmpetegrtlRDIEEHFADKGKTFVTNIRRAEKKRHAakvegqeevkgednfgmegedgkyi
mdsstkhqigtfteptpldwkkakkkekkkkekkakkkekkkekkkkekkkkkkkkkkkkknnnnnnnnnnnnnnnnnnnNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAieeselkrlgkdgqrrpnyrMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKkrhaarvegqeevkgednfgmegedgkYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKkrhaakvegqeevkgednfgmegedgkyi
MDSSTKHQIGTFTEPTPLDWkkakkkekkkkekkakkkekkkekkkkekkkkkkkkkkkkknnnnnnnnnnnnnnnnnnnnnnnnneekGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFatlllgvaelggallcvvlIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATasgasgsssYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAARVEGQEEVKGEDNFGMEGEDGKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAAKVEGQEEVKGEDNFGMEGEDGKYI
******************************************************************************************TFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQI********************NYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNI******************************GKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTN***********************************
**********TFTEPT**************************************************************NNNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQIT*******************NYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEH**********************************************SRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNI**********************************
*********GTFTEPTPLDWK****************************************NNNNNNNNNNNNNNNNNNNNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRR***************VKGEDNFGMEGEDGKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRR***************VKGEDNFGMEGEDGKYI
***********FTEPTPLDWKKAKKKEKKKKEKKAKKKEKKKEKKKKEKKKKKKKKKKKKKNNNNNNNNNNNNNNNNNNNNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKR******RRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGK**********************************EDGKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAAKVEGQEEVKGEDNFGMEGE*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSTKHQIGTFTEPTPLDWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNNNNNNNNNNNNNNEEKGTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAARVEGQEEVKGEDNFGMEGEDGKYISRVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKRHAAKVEGQEEVKGEDNFGMEGEDGKYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query553 2.2.26 [Sep-21-2011]
B4KR05863 Facilitated trehalose tra N/A N/A 0.589 0.377 0.283 6e-36
Q291H8868 Facilitated trehalose tra no N/A 0.566 0.360 0.270 2e-35
B4GAP7869 Facilitated trehalose tra N/A N/A 0.566 0.360 0.270 2e-35
B4LPX5911 Facilitated trehalose tra N/A N/A 0.593 0.360 0.274 3e-35
B4P624856 Facilitated trehalose tra N/A N/A 0.564 0.364 0.281 5e-35
B3MG58866 Facilitated trehalose tra N/A N/A 0.594 0.379 0.263 5e-35
B4MYA4872 Facilitated trehalose tra N/A N/A 0.584 0.370 0.275 6e-35
Q17NV8806 Facilitated trehalose tra N/A N/A 0.567 0.389 0.276 8e-35
A9ZSY3505 Facilitated trehalose tra N/A N/A 0.593 0.649 0.278 2e-34
B3NSE1856 Facilitated trehalose tra N/A N/A 0.591 0.382 0.281 2e-34
>sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 Back     alignment and function desciption
 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 171/356 (48%), Gaps = 30/356 (8%)

Query: 105 TYVAEITQPHLRGMLSATASMTTIFGTVSQLFL---GSFLHWRSAAILNLLFPILALCAL 161
            Y+ E  QP +RG L     + T FG +  L     G+++ W   A L    P+  L  +
Sbjct: 519 VYLGETVQPEVRGTLGL---LPTAFGNIGILLCFVAGTYMDWSMLAFLGGTLPVPFLILM 575

Query: 162 YFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQR 221
           + IPE+P W +S+GR + A  +L WLRG      V+ EL  + ++  ++       D Q 
Sbjct: 576 FLIPETPRWYVSRGREERARKALVWLRG--KEADVEPELKGLMRSQADA-------DRQA 626

Query: 222 RPNYRM-YMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLG 280
             N  +  ++R+ L P +I   L F  Q  G+  +  Y V IF+   + +D    T+++G
Sbjct: 627 TQNTMLELLKRSNLKPLSISLGLMFFQQLSGINAVIFYTVQIFQDAGSTIDGNVCTIIVG 686

Query: 281 VAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHL--SYGWDSPLVPTVF 338
           V       +  VLI   G++ L  +S   + A  + + V   F    S G D+  V   +
Sbjct: 687 VVNFMATFIATVLIDRAGRKILLYVS---NVAMILTLFVLGGFFYCKSTGMDTSNVG--W 741

Query: 339 LVLAAFLTHIC-----IRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPML 393
           L L+ F+ +I         +PW+++GE+ P  IR +A+  + + ++   F V K +  M+
Sbjct: 742 LPLSCFVVYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWSCTFVVTKSFQDMI 801

Query: 394 DTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGK--TFVTNIR 447
           D     G  + + AI  VG  ++ F +PET+G+TL DIE     + +  + V NI+
Sbjct: 802 DVMGAHGAFWMFGAICFVGLFFVIFYVPETQGKTLEDIERKMMGRVRRMSSVANIK 857




Low-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Drosophila mojavensis (taxid: 7230)
>sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 Back     alignment and function description
>sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 Back     alignment and function description
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
193688235560 PREDICTED: facilitated trehalose transpo 0.631 0.623 0.550 3e-99
291461585544 sugar transporter 13 [Nilaparvata lugens 0.643 0.654 0.476 6e-99
307207615526 Sugar transporter ERD6-like 7 [Harpegnat 0.596 0.627 0.460 5e-91
91082977 1252 PREDICTED: similar to sugar transporter 0.654 0.289 0.434 2e-89
270007037 1229 hypothetical protein TcasGA2_TC013484 [T 0.649 0.292 0.431 3e-89
380020516518 PREDICTED: facilitated trehalose transpo 0.591 0.631 0.471 3e-89
332016797531 Sugar transporter ERD6-like 2 [Acromyrme 0.591 0.615 0.463 4e-89
328788677518 PREDICTED: facilitated trehalose transpo 0.582 0.621 0.464 6e-89
307176944517 Sugar transporter ERD6-like 6 [Camponotu 0.620 0.663 0.443 1e-88
350411515518 PREDICTED: facilitated trehalose transpo 0.584 0.623 0.475 3e-87
>gi|193688235|ref|XP_001945235.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  369 bits (946), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 195/354 (55%), Positives = 256/354 (72%), Gaps = 5/354 (1%)

Query: 103 VLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALY 162
           VLTYVAEIT+PH+RG+L+A +S T I G++SQ  LG+F HWR   + N + P++A  +L 
Sbjct: 188 VLTYVAEITEPHIRGVLAALSSTTVILGSISQFILGNFFHWRKIVLFNTIVPVVAFISLL 247

Query: 163 FIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRR 222
            IPESPHWLI++GR+ EA  SLCWLRGWV PD VQ ELS ++K+I  +E K   K  ++ 
Sbjct: 248 LIPESPHWLITKGRIAEAEKSLCWLRGWVQPDAVQYELSMLSKSIALNEEKVRMKKNKKF 307

Query: 223 PNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATLLLGVA 282
             Y  Y RRTFLLPY I+T+ FF G FGG +TLQ YAV IFE++ +P++ Y +TL+LG+ 
Sbjct: 308 --YTFYTRRTFLLPYFIITASFFFGSFGGTSTLQVYAVQIFETLGSPINGYTSTLVLGIL 365

Query: 283 ELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYA---QFHLSYGWDSPLVPTVFL 339
           +L G +L ++LIH+TGKRPLA++ST GS+ CF VV+ Y    Q++     +   +P VFL
Sbjct: 366 QLMGGILGLLLIHWTGKRPLAIVSTLGSSLCFFVVSAYVFIKQYNEEIIINVTWIPLVFL 425

Query: 340 VLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFHLW 399
             AAF+THI IRLLPWMLIGEV+P NIR  ASGASGSSSYIF+F  NK Y+ +LD  +L 
Sbjct: 426 NTAAFMTHISIRLLPWMLIGEVYPPNIRGQASGASGSSSYIFSFIANKSYFMVLDCINLS 485

Query: 400 GTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKGKTFVTNIRRAEKKR 453
           GT   YA +S++G L +Y +MPETEG  L DI+ HFADK KTFV  I R++K +
Sbjct: 486 GTFLLYAIVSLIGCLMLYTMMPETEGVPLEDIQNHFADKTKTFVMKIERSDKIK 539




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|291461585|dbj|BAI83427.1| sugar transporter 13 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|307207615|gb|EFN85275.1| Sugar transporter ERD6-like 7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91082977|ref|XP_974017.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007037|gb|EFA03485.1| hypothetical protein TcasGA2_TC013484 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380020516|ref|XP_003694129.1| PREDICTED: facilitated trehalose transporter Tret1-like [Apis florea] Back     alignment and taxonomy information
>gi|332016797|gb|EGI57618.1| Sugar transporter ERD6-like 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328788677|ref|XP_623950.2| PREDICTED: facilitated trehalose transporter Tret1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307176944|gb|EFN66250.1| Sugar transporter ERD6-like 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350411515|ref|XP_003489374.1| PREDICTED: facilitated trehalose transporter Tret1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
FB|FBgn0051100716 CG31100 [Drosophila melanogast 0.405 0.312 0.443 1.4e-71
UNIPROTKB|A9ZSY2502 Tret1 "Facilitated trehalose t 0.567 0.625 0.281 1.3e-36
TAIR|locus:2036039464 AT1G08890 [Arabidopsis thalian 0.576 0.687 0.286 7.2e-36
UNIPROTKB|A9ZSY3505 Tret1 "Facilitated trehalose t 0.589 0.645 0.284 8.5e-33
TAIR|locus:2036009462 AT1G08900 [Arabidopsis thalian 0.571 0.683 0.279 7.3e-31
UNIPROTKB|Q291H8868 Tret1 "Facilitated trehalose t 0.560 0.357 0.275 1.9e-30
UNIPROTKB|B4GAP7869 Tret1 "Facilitated trehalose t 0.560 0.356 0.275 1.9e-30
UNIPROTKB|A5LGM7504 Tret1 "Facilitated trehalose t 0.566 0.621 0.253 2e-29
UNIPROTKB|I3LQQ9506 SLC2A6 "Uncharacterized protei 0.575 0.628 0.278 3.4e-29
UNIPROTKB|B4KR05863 Tret1 "Facilitated trehalose t 0.587 0.376 0.273 3e-28
FB|FBgn0051100 CG31100 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 467 (169.5 bits), Expect = 1.4e-71, Sum P(2) = 1.4e-71
 Identities = 105/237 (44%), Positives = 135/237 (56%)

Query:    96 MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPI 155
             M AP   VLTYVAEIT+P  RG+LSA  +   I G   Q  LGS + WRS A ++  FP+
Sbjct:   166 MEAP---VLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDWRSVAAVSSAFPV 222

Query:   156 LALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQ-----IT-KAIEE 209
             + +  L F+PESP WLI + R +EA  SL WLRGWV    ++ E +Q     IT KAIE 
Sbjct:   223 ITIIMLCFVPESPVWLIREQRFREAVKSLQWLRGWVPEHMIEAEFNQLYDELITQKAIEL 282

Query:   210 SELKRLGKDGQRRP---NYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESI 266
             S    +   GQRR      RM+ +R+FL+P+ +V+  FF G F G T LQTYAV IF ++
Sbjct:   283 SA-DGIPPPGQRRTLGQRLRMWRKRSFLVPFLLVSFSFFTGHFSGKTPLQTYAVQIFHTL 341

Query:   267 HAPLDPYFXXXXXXXXXXXXXXXXXXXIHYTGKRPLALISTGGSAACFIVVAVYAQF 323
              AP++ Y                    IH+TGKRPL L+ST G+  CF   A YA F
Sbjct:   342 KAPMNKYHATILLGVAEMLATILGVVLIHFTGKRPLVLVSTVGTGLCFFGTATYAHF 398


GO:0016021 "integral to membrane" evidence=ISS
GO:0015145 "monosaccharide transmembrane transporter activity" evidence=ISS
GO:0015749 "monosaccharide transport" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
UNIPROTKB|A9ZSY2 Tret1 "Facilitated trehalose transporter Tret1" [Apis mellifera ligustica (taxid:7469)] Back     alignment and assigned GO terms
TAIR|locus:2036039 AT1G08890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q291H8 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4GAP7 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQQ9 SLC2A6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4KR05 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 1e-50
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 8e-45
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 1e-31
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-19
TIGR00898505 TIGR00898, 2A0119, cation transport protein 8e-15
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 9e-12
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-09
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 7e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-08
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 1e-08
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 1e-08
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 1e-08
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-08
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 3e-08
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 5e-08
TIGR00895398 TIGR00895, 2A0115, benzoate transport 7e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-07
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 3e-07
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 3e-07
COG2814394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 3e-07
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 4e-07
TIGR03490541 TIGR03490, Mycoplas_LppA, mycoides cluster lipopro 4e-07
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 6e-07
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 7e-07
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 8e-07
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 1e-06
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 1e-06
PTZ00362479 PTZ00362, PTZ00362, hypothetical protein; Provisio 1e-06
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 1e-06
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 2e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-06
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 3e-06
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 3e-06
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-06
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 4e-06
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 4e-06
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 4e-06
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 4e-06
pfam11671146 pfam11671, Apis_Csd, Complementary sex determiner 5e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 6e-06
pfam11208132 pfam11208, DUF2992, Protein of unknown function (D 6e-06
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 6e-06
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 7e-06
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 7e-06
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 7e-06
PTZ00362479 PTZ00362, PTZ00362, hypothetical protein; Provisio 7e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-06
pfam11671146 pfam11671, Apis_Csd, Complementary sex determiner 7e-06
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 1e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-05
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 1e-05
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 1e-05
PHA03089191 PHA03089, PHA03089, late transcription factor VLTF 1e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 2e-05
PTZ00362479 PTZ00362, PTZ00362, hypothetical protein; Provisio 2e-05
PTZ00362479 PTZ00362, PTZ00362, hypothetical protein; Provisio 2e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 2e-05
pfam11671146 pfam11671, Apis_Csd, Complementary sex determiner 2e-05
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 2e-05
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 2e-05
TIGR00881379 TIGR00881, 2A0104, phosphoglycerate transporter fa 2e-05
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 2e-05
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 3e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-05
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-05
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 4e-05
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 5e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 5e-05
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 5e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-05
PTZ00053470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 5e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-05
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 6e-05
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 6e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 6e-05
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 7e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-05
pfam02414285 pfam02414, Borrelia_orfA, Borrelia ORF-A 7e-05
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 8e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 9e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-04
PHA03089191 PHA03089, PHA03089, late transcription factor VLTF 1e-04
PHA03089191 PHA03089, PHA03089, late transcription factor VLTF 1e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 1e-04
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 1e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-04
pfam02414285 pfam02414, Borrelia_orfA, Borrelia ORF-A 1e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 2e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-04
pfam11208132 pfam11208, DUF2992, Protein of unknown function (D 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
pfam0807971 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin 2e-04
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 2e-04
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 2e-04
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 3e-04
TIGR03490541 TIGR03490, Mycoplas_LppA, mycoides cluster lipopro 3e-04
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 3e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-04
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 3e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 3e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 3e-04
PTZ00470522 PTZ00470, PTZ00470, glycoside hydrolase family 47 3e-04
PRK11778330 PRK11778, PRK11778, putative inner membrane peptid 3e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 4e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 4e-04
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 4e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 4e-04
pfam0807971 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin 4e-04
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 4e-04
PRK11778330 PRK11778, PRK11778, putative inner membrane peptid 4e-04
pfam05424276 pfam05424, Duffy_binding, Duffy binding domain 4e-04
PRK05244177 PRK05244, PRK05244, Der GTPase activator; Provisio 4e-04
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 5e-04
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-04
pfam14265125 pfam14265, DUF4355, Domain of unknown function (DU 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 5e-04
pfam0774195 pfam07741, BRF1, Brf1-like TBP-binding domain 5e-04
pfam1065998 pfam10659, Trypan_glycop_C, Trypanosome variant su 5e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-04
pfam13166713 pfam13166, AAA_13, AAA domain 5e-04
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 5e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 6e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 6e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 6e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 6e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 6e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
pfam13166713 pfam13166, AAA_13, AAA domain 6e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 6e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 6e-04
pfam09736141 pfam09736, Bud13, Pre-mRNA-splicing factor of RES 6e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-04
PTZ00470522 PTZ00470, PTZ00470, glycoside hydrolase family 47 7e-04
pfam05424276 pfam05424, Duffy_binding, Duffy binding domain 7e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 7e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 7e-04
pfam00183529 pfam00183, HSP90, Hsp90 protein 7e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 7e-04
pfam14303147 pfam14303, NAM-associated, No apical meristem-asso 7e-04
pfam07808238 pfam07808, RED_N, RED-like protein N-terminal regi 7e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 8e-04
pfam04615728 pfam04615, Utp14, Utp14 protein 8e-04
pfam07890132 pfam07890, Rrp15p, Rrp15p 8e-04
pfam05501122 pfam05501, DUF755, Domain of unknown function (DUF 9e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.001
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 0.001
pfam09428130 pfam09428, DUF2011, Fungal protein of unknown func 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.001
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.001
pfam11208132 pfam11208, DUF2992, Protein of unknown function (D 0.001
PHA03089191 PHA03089, PHA03089, late transcription factor VLTF 0.001
PTZ00053470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 0.001
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
pfam0807971 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin 0.001
pfam0807971 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin 0.001
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 0.001
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 0.001
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.001
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 0.001
PTZ00470522 PTZ00470, PTZ00470, glycoside hydrolase family 47 0.001
PRK05244177 PRK05244, PRK05244, Der GTPase activator; Provisio 0.001
pfam1065998 pfam10659, Trypan_glycop_C, Trypanosome variant su 0.001
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.001
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.001
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.001
pfam00183529 pfam00183, HSP90, Hsp90 protein 0.001
pfam14303147 pfam14303, NAM-associated, No apical meristem-asso 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.001
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.001
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 0.001
TIGR00891405 TIGR00891, 2A0112, putative sialic acid transporte 0.001
pfam06102168 pfam06102, DUF947, Domain of unknown function (DUF 0.001
COG5163591 COG5163, NOP7, Protein required for biogenesis of 0.001
pfam0870180 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase 0.001
pfam1420493 pfam14204, Ribosomal_L18_c, Ribosomal L18 C-termin 0.001
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.001
pfam0517899 pfam05178, Kri1, KRI1-like family 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 0.002
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 0.002
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam11208132 pfam11208, DUF2992, Protein of unknown function (D 0.002
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.002
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 0.002
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.002
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.002
pfam02414285 pfam02414, Borrelia_orfA, Borrelia ORF-A 0.002
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.002
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 0.002
PTZ00470522 PTZ00470, PTZ00470, glycoside hydrolase family 47 0.002
pfam13166713 pfam13166, AAA_13, AAA domain 0.002
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.002
cd09270211 cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
pfam0455783 pfam04557, tRNA_synt_1c_R2, Glutaminyl-tRNA synthe 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.002
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.002
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.002
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.002
cd13156152 cd13156, KOW_RPL6, KOW motif of Ribosomal Protein 0.002
COG5182429 COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA 0.002
PRK13914481 PRK13914, PRK13914, invasion associated secreted e 0.002
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
pfam11671146 pfam11671, Apis_Csd, Complementary sex determiner 0.003
PRK12280158 PRK12280, rplW, 50S ribosomal protein L23; Reviewe 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 0.003
pfam0774195 pfam07741, BRF1, Brf1-like TBP-binding domain 0.003
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.003
COG5163591 COG5163, NOP7, Protein required for biogenesis of 0.003
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.003
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.003
COG3078169 COG3078, COG3078, Uncharacterized protein conserve 0.003
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 0.003
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 0.003
pfam12923131 pfam12923, RRP7, Ribosomal RNA-processing protein 0.003
pfam04935206 pfam04935, SURF6, Surfeit locus protein 6 0.004
TIGR03490541 TIGR03490, Mycoplas_LppA, mycoides cluster lipopro 0.004
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.004
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.004
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
pfam0807971 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin 0.004
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.004
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PRK11778330 PRK11778, PRK11778, putative inner membrane peptid 0.004
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 0.004
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 0.004
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.004
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.004
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.004
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.004
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.004
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.004
pfam12923131 pfam12923, RRP7, Ribosomal RNA-processing protein 0.004
pfam03343603 pfam03343, SART-1, SART-1 family 0.004
pfam14058136 pfam14058, PcfK, PcfK-like protein 0.004
COG5116926 COG5116, RPN2, 26S proteasome regulatory complex c 0.004
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 0.004
TIGR00887502 TIGR00887, 2A0109, phosphate:H+ symporter 0.004
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.004
pfam09831177 pfam09831, DUF2058, Uncharacterized protein conser 0.004
pfam06024101 pfam06024, DUF912, Nucleopolyhedrovirus protein of 0.004
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.004
pfam0234981 pfam02349, MSG, Major surface glycoprotein 0.004
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score =  180 bits (458), Expect = 1e-50
 Identities = 94/341 (27%), Positives = 160/341 (46%), Gaps = 15/341 (4%)

Query: 101 VLVLTYVAEITQPHLRGMLSATASMTTIFG-------TVSQLFLGSFLHWRSAAILNLLF 153
            LV  Y++EI    LRG L++   +   FG          ++ L + L WR    L L+ 
Sbjct: 146 ALVPMYLSEIAPKALRGALTSLYQLAITFGILVAYGFGSGKVSLNNTLGWRIPLGLQLIP 205

Query: 154 PILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDK-VQTELSQITKAIEESEL 212
             L    L+F+PESP WL+ +GR++EA  SL  LRG    DK +  EL  I       E 
Sbjct: 206 AGLLFLGLFFLPESPRWLVGKGRVEEARKSLARLRGTSGEDKELLDELELIDIK-RSIEK 264

Query: 213 KRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESI-HAPLD 271
           + +               R       +   L +  QF G+  +  Y+  IFE+   +   
Sbjct: 265 RSVQPSWGSL----FSSTRRIRRRLFLGVVLQWFQQFTGINAIMYYSPTIFENAGVSTDH 320

Query: 272 PYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVY-AQFHLSYGWD 330
            +  ++++G        + + L+   G+RPL LI   G A C  V+ +  A F       
Sbjct: 321 AFLVSIIVGAVNFAFTFVAIFLVDRFGRRPLLLIGAAGMAICLFVLGILGASFVTGSSKS 380

Query: 331 SPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYY 390
           S  V  VF++L      +    +PW+++ E+FP ++R      + +++++  F V  L+ 
Sbjct: 381 SGNVAIVFILLFIAFFAMGWGPVPWVIVSEIFPLSLRPKGISIAVAANWLANFIVGFLFP 440

Query: 391 PMLDTFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDI 431
            ML++  + G   F+  ++V+G +++YF +PET+GRTL +I
Sbjct: 441 TMLESIGVGGVFIFFGGLNVLGLIFVYFFLPETKGRTLEEI 481


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240380 PTZ00362, PTZ00362, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240380 PTZ00362, PTZ00362, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|240380 PTZ00362, PTZ00362, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240380 PTZ00362, PTZ00362, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|233167 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217023 pfam02414, Borrelia_orfA, Borrelia ORF-A Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional Back     alignment and domain information
>gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217023 pfam02414, Borrelia_orfA, Borrelia ORF-A Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|218585 pfam05424, Duffy_binding, Duffy binding domain Back     alignment and domain information
>gnl|CDD|235370 PRK05244, PRK05244, Der GTPase activator; Provisional Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain Back     alignment and domain information
>gnl|CDD|220838 pfam10659, Trypan_glycop_C, Trypanosome variant surface glycoprotein C-terminal domain Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>gnl|CDD|218585 pfam05424, Duffy_binding, Duffy binding domain Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain Back     alignment and domain information
>gnl|CDD|219589 pfam07808, RED_N, RED-like protein N-terminal region Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|219621 pfam07890, Rrp15p, Rrp15p Back     alignment and domain information
>gnl|CDD|218612 pfam05501, DUF755, Domain of unknown function (DUF755) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) Back     alignment and domain information
>gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain Back     alignment and domain information
>gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>gnl|CDD|235370 PRK05244, PRK05244, Der GTPase activator; Provisional Back     alignment and domain information
>gnl|CDD|220838 pfam10659, Trypan_glycop_C, Trypanosome variant surface glycoprotein C-terminal domain Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|219978 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase Back     alignment and domain information
>gnl|CDD|222592 pfam14204, Ribosomal_L18_c, Ribosomal L18 C-terminal region Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|218482 pfam05178, Kri1, KRI1-like family Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|217023 pfam02414, Borrelia_orfA, Borrelia ORF-A Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|218148 pfam04557, tRNA_synt_1c_R2, Glutaminyl-tRNA synthetase, non-specific RNA binding region part 2 Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|240520 cd13156, KOW_RPL6, KOW motif of Ribosomal Protein L6 Back     alignment and domain information
>gnl|CDD|227509 COG5182, CUS1, Splicing factor 3b, subunit 2 [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein Back     alignment and domain information
>gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|225620 COG3078, COG3078, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|221857 pfam12923, RRP7, Ribosomal RNA-processing protein 7 (RRP7) Back     alignment and domain information
>gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 Back     alignment and domain information
>gnl|CDD|234229 TIGR03490, Mycoplas_LppA, mycoides cluster lipoprotein, LppA/P72 family Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|221857 pfam12923, RRP7, Ribosomal RNA-processing protein 7 (RRP7) Back     alignment and domain information
>gnl|CDD|217502 pfam03343, SART-1, SART-1 family Back     alignment and domain information
>gnl|CDD|206228 pfam14058, PcfK, PcfK-like protein Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|129965 TIGR00887, 2A0109, phosphate:H+ symporter Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) Back     alignment and domain information
>gnl|CDD|218858 pfam06024, DUF912, Nucleopolyhedrovirus protein of unknown function (DUF912) Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|216985 pfam02349, MSG, Major surface glycoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 553
KOG0569|consensus485 100.0
KOG0254|consensus513 99.97
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.96
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.96
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.95
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.95
KOG0253|consensus528 99.95
PRK10642490 proline/glycine betaine transporter; Provisional 99.94
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.93
TIGR00898505 2A0119 cation transport protein. 99.93
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.88
KOG0252|consensus538 99.88
PRK09952438 shikimate transporter; Provisional 99.87
KOG0255|consensus521 99.86
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.86
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.86
PRK15075434 citrate-proton symporter; Provisional 99.83
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.83
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.83
PRK10489417 enterobactin exporter EntS; Provisional 99.82
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.82
PRK12307426 putative sialic acid transporter; Provisional 99.82
PRK11663434 regulatory protein UhpC; Provisional 99.82
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.8
KOG0569|consensus 485 99.8
TIGR00891405 2A0112 putative sialic acid transporter. 99.8
PRK03545390 putative arabinose transporter; Provisional 99.79
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.78
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.78
PRK05122399 major facilitator superfamily transporter; Provisi 99.78
PRK12382392 putative transporter; Provisional 99.78
TIGR00893399 2A0114 d-galactonate transporter. 99.78
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.77
PRK03893496 putative sialic acid transporter; Provisional 99.77
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.77
PRK09705393 cynX putative cyanate transporter; Provisional 99.76
TIGR00895398 2A0115 benzoate transport. 99.75
PRK09874408 drug efflux system protein MdtG; Provisional 99.75
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.75
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.74
PRK11010491 ampG muropeptide transporter; Validated 99.73
TIGR00900365 2A0121 H+ Antiporter protein. 99.72
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.72
PRK15011393 sugar efflux transporter B; Provisional 99.72
PRK03699394 putative transporter; Provisional 99.72
PRK10091382 MFS transport protein AraJ; Provisional 99.71
TIGR00897402 2A0118 polyol permease family. This family of prot 99.71
KOG2532|consensus466 99.71
PLN00028476 nitrate transmembrane transporter; Provisional 99.71
KOG2533|consensus495 99.7
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.7
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.69
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.69
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.69
PRK10504471 putative transporter; Provisional 99.69
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.68
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.68
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.68
KOG0254|consensus 513 99.68
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.68
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.68
PRK09528420 lacY galactoside permease; Reviewed 99.68
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.67
PRK11195393 lysophospholipid transporter LplT; Provisional 99.67
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.67
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.66
PRK11902402 ampG muropeptide transporter; Reviewed 99.66
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.64
PRK11646400 multidrug resistance protein MdtH; Provisional 99.64
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.63
TIGR00901356 2A0125 AmpG-related permease. 99.62
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.61
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.61
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.61
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.6
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.6
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.6
KOG1330|consensus493 99.59
TIGR00896355 CynX cyanate transporter. This family of proteins 99.59
PRK11043401 putative transporter; Provisional 99.59
PRK03633381 putative MFS family transporter protein; Provision 99.58
PRK10054395 putative transporter; Provisional 99.58
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.57
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.57
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.56
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.56
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.53
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.53
PRK10133438 L-fucose transporter; Provisional 99.53
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.52
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 99.52
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.51
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.49
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.49
PRK11652394 emrD multidrug resistance protein D; Provisional 99.47
PRK11663 434 regulatory protein UhpC; Provisional 99.45
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.45
KOG2504|consensus509 99.44
PF13347428 MFS_2: MFS/sugar transport protein 99.43
PRK03545390 putative arabinose transporter; Provisional 99.42
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.42
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.41
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.41
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.4
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.4
TIGR00895398 2A0115 benzoate transport. 99.4
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.39
TIGR00891405 2A0112 putative sialic acid transporter. 99.39
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.39
TIGR00893399 2A0114 d-galactonate transporter. 99.39
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.39
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.39
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.39
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.38
PRK09669444 putative symporter YagG; Provisional 99.38
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.37
PRK10091382 MFS transport protein AraJ; Provisional 99.37
COG2211467 MelB Na+/melibiose symporter and related transport 99.36
TIGR00805633 oat sodium-independent organic anion transporter. 99.35
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.35
PRK11462460 putative transporter; Provisional 99.34
PRK10504 471 putative transporter; Provisional 99.34
PRK12307426 putative sialic acid transporter; Provisional 99.34
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.33
COG2270438 Permeases of the major facilitator superfamily [Ge 99.33
KOG3764|consensus464 99.33
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.33
PRK10429473 melibiose:sodium symporter; Provisional 99.33
PLN00028 476 nitrate transmembrane transporter; Provisional 99.32
KOG0252|consensus 538 99.32
KOG4686|consensus459 99.32
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.32
PRK03699394 putative transporter; Provisional 99.3
KOG2615|consensus451 99.3
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.3
PRK10642 490 proline/glycine betaine transporter; Provisional 99.3
PRK11652394 emrD multidrug resistance protein D; Provisional 99.3
PTZ00207591 hypothetical protein; Provisional 99.3
PRK10054395 putative transporter; Provisional 99.3
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.28
TIGR00900365 2A0121 H+ Antiporter protein. 99.28
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.28
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.28
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.28
PRK03893 496 putative sialic acid transporter; Provisional 99.27
PRK09874408 drug efflux system protein MdtG; Provisional 99.27
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.27
KOG1330|consensus 493 99.26
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.25
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.25
PRK11043401 putative transporter; Provisional 99.24
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.24
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.24
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.23
PRK11646400 multidrug resistance protein MdtH; Provisional 99.23
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.22
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.22
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.22
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.21
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.21
PRK09848448 glucuronide transporter; Provisional 99.21
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.2
KOG2563|consensus480 99.2
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.2
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.19
KOG0255|consensus 521 99.19
PTZ00207 591 hypothetical protein; Provisional 99.19
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.18
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.18
PRK09705393 cynX putative cyanate transporter; Provisional 99.18
PRK15075434 citrate-proton symporter; Provisional 99.17
PRK11195393 lysophospholipid transporter LplT; Provisional 99.17
PRK10489417 enterobactin exporter EntS; Provisional 99.17
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.17
PRK05122399 major facilitator superfamily transporter; Provisi 99.16
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.15
PRK09952438 shikimate transporter; Provisional 99.15
TIGR00898 505 2A0119 cation transport protein. 99.14
TIGR00897402 2A0118 polyol permease family. This family of prot 99.14
TIGR00805 633 oat sodium-independent organic anion transporter. 99.13
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.13
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.12
KOG2615|consensus 451 99.12
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 99.1
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.1
PRK12382392 putative transporter; Provisional 99.09
PRK03633381 putative MFS family transporter protein; Provision 99.09
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.09
PRK15462493 dipeptide/tripeptide permease D; Provisional 99.08
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.07
PRK10133 438 L-fucose transporter; Provisional 99.06
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.04
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.03
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 99.02
KOG3764|consensus464 99.01
KOG2532|consensus 466 98.99
PRK11010 491 ampG muropeptide transporter; Validated 98.95
KOG0253|consensus 528 98.94
TIGR00896355 CynX cyanate transporter. This family of proteins 98.93
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.91
TIGR00901356 2A0125 AmpG-related permease. 98.89
KOG3626|consensus735 98.88
PRK11902402 ampG muropeptide transporter; Reviewed 98.87
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.85
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 98.85
PRK15011393 sugar efflux transporter B; Provisional 98.84
PRK09528420 lacY galactoside permease; Reviewed 98.81
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.78
KOG2504|consensus 509 98.73
KOG2533|consensus 495 98.72
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.72
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.7
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.69
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.62
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.61
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.55
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.53
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.52
KOG2816|consensus463 98.52
KOG2325|consensus488 98.51
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.51
KOG2816|consensus 463 98.48
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.42
KOG3762|consensus618 98.39
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 98.38
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.35
PRK10429 473 melibiose:sodium symporter; Provisional 98.3
PRK09669 444 putative symporter YagG; Provisional 98.3
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.23
PF13347428 MFS_2: MFS/sugar transport protein 98.21
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 98.09
PRK11462 460 putative transporter; Provisional 98.03
KOG2325|consensus 488 97.99
COG2807395 CynX Cyanate permease [Inorganic ion transport and 97.96
PRK09848 448 glucuronide transporter; Provisional 97.9
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.85
KOG3810|consensus433 97.84
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.81
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.79
KOG2563|consensus 480 97.76
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.74
COG2211 467 MelB Na+/melibiose symporter and related transport 97.69
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.67
KOG3098|consensus461 97.57
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.5
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.37
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.34
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 97.26
COG0477338 ProP Permeases of the major facilitator superfamil 97.25
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.22
PF1283277 MFS_1_like: MFS_1 like family 97.18
KOG0637|consensus498 97.1
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 96.93
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 96.72
KOG4332|consensus 454 96.6
KOG3626|consensus 735 96.58
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.49
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 96.29
KOG4686|consensus 459 96.07
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 95.99
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 95.91
KOG3098|consensus 461 95.88
COG2270 438 Permeases of the major facilitator superfamily [Ge 95.64
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 95.6
PRK03612 521 spermidine synthase; Provisional 95.54
KOG0637|consensus 498 95.46
COG3202509 ATP/ADP translocase [Energy production and convers 95.01
TIGR01272310 gluP glucose/galactose transporter. Disruption of 94.79
PF00854372 PTR2: POT family; InterPro: IPR000109 This entry r 94.49
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 94.15
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 94.07
KOG3574|consensus510 94.01
KOG1237|consensus 571 93.44
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 93.23
TIGR00926654 2A1704 Peptide:H+ symporter (also transports b-lac 92.34
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 92.27
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 91.93
KOG4332|consensus454 91.63
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 91.48
KOG1237|consensus571 91.47
KOG3762|consensus 618 91.29
KOG1479|consensus406 90.32
COG4262 508 Predicted spermidine synthase with an N-terminal m 89.95
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 88.61
COG3202 509 ATP/ADP translocase [Energy production and convers 88.24
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 87.62
KOG3574|consensus 510 87.44
KOG1479|consensus406 86.75
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 83.25
KOG3312|consensus186 82.98
PF05297381 Herpes_LMP1: Herpesvirus latent membrane protein 1 82.96
PRK10263 1355 DNA translocase FtsK; Provisional 81.5
>KOG0569|consensus Back     alignment and domain information
Probab=100.00  E-value=4.5e-34  Score=286.07  Aligned_cols=341  Identities=25%  Similarity=0.384  Sum_probs=278.4

Q ss_pred             ccccccccccc--chhhhhhhhhccCcccccchhchhhhhHHHHHHHHHhhcccc------chHHHHHHHHHHHHHHHHH
Q psy15864         89 KGTFLYKMAAP--LVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFL------HWRSAAILNLLFPILALCA  160 (553)
Q Consensus        89 ~gr~~~G~ga~--~~~~~~~i~e~~p~~~Rg~~~~~~~~~~~lG~~l~~~l~~~l------gWr~~f~i~~i~~li~~i~  160 (553)
                      -||++.|+..+  ..+.+.|+.|..|.+.||....+.+++..+|.+++..++..-      .|++.+.+.++++++.+++
T Consensus       121 ~GR~i~Gl~~gl~~~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~  200 (485)
T KOG0569|consen  121 LGRLIVGLACGLSTGLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLAL  200 (485)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHH
Confidence            48999998776  457889999999999999999999999999999997766542      7999999999999999999


Q ss_pred             hccccCCceeeee-cCChHHHHHHHHHHcCCCCCcchHHH-HHHHHHHHHHHHHHhcCCCCCCChhhhhhhhhcchhHHH
Q psy15864        161 LYFIPESPHWLIS-QGRMQEASASLCWLRGWVTPDKVQTE-LSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYA  238 (553)
Q Consensus       161 ~~~lpEsp~~l~~-~~~~~~a~~~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (553)
                      +.++||||+|+.. +++.++|++.++.+++..+.+...++ .++.++.    .    .......+.++.+.++..++...
T Consensus       201 l~~~PESPk~Ll~~k~~~~~A~~sl~~y~G~~~~~~~~e~~~~e~~~~----~----~~~~~~~sl~~~~~~~~lR~~~~  272 (485)
T KOG0569|consen  201 LPFLPESPKYLLIKKGDEEEARKALKFYRGKEDVEAEIEEMLREIEEE----E----LEKKKQISLRQLLKNPTLRRPLL  272 (485)
T ss_pred             HhcCCCCcchHHHHcCCHHHHHHHHHHHhCCCcchhHHHHHHHHHHHh----c----cccccCCcHHHHhcCcchhHHHH
Confidence            9999999999988 89999999999999986554332222 2221111    1    11112223444455567777788


Q ss_pred             HHHHHHHHHhhhhhHHHHhhHHHHHHhhCCCCCh-HHHHHHHHHHHHHHHHHHhhhhcccCCcceeecchhHHHHHHHHH
Q psy15864        239 IVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDP-YFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVV  317 (553)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~~i~~~~g~~~~g~l~dr~Grr~~l~~~~~~~~i~~~~~  317 (553)
                      +.+.+..+.++++.+...+|...++...|++.+. .+.....++..++.++++.++.||+|||+++++++.++.+..+++
T Consensus       273 i~~~v~~~qq~sGi~ai~~Yst~i~~~aG~~~~~a~~an~~~g~v~~~~t~~~~~lid~~gRRpLll~~~~~~~~~~~~~  352 (485)
T KOG0569|consen  273 IGIVVSFAQQFSGINAIFFYSTSIFKTAGFTPEEAQYANLGIGIVNLLSTLVSPFLIDRLGRRPLLLISLSLMAVALLLM  352 (485)
T ss_pred             HHHHHHHHHHhcCcceeHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHH
Confidence            8888899999999999999999999999987654 477888899999999999999999999999999999998888877


Q ss_pred             HHHHHhhcccCCCCChhHHHHHHHHHHHHhhhhccccceeeccccccchhhhhhhHHHHHHHHHHHHHHHHhHHHHhhcc
Q psy15864        318 AVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPMLDTFH  397 (553)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~Rg~~~~~~~~~~~~~~~i~~~~~~~~~~~~g  397 (553)
                      ...............+..+++.+++.++++.+.+|+++.+.+|++|+..|+++.++...+.++..++....+.++.+..|
T Consensus       353 ~~~~~l~~~~~~~~~y~~i~~~~~~~~~f~~G~gpi~~fi~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g  432 (485)
T KOG0569|consen  353 SIALFLSNSFGSWLSYLCIAAIFLFIISFAIGPGPIPWFIGAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIG  432 (485)
T ss_pred             HHHHHHHHHhhhHHHHHHHHHHHHHHHhhhcCCCchhHHHHHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            76543321110001122356677778888899999999999999999999999999999999999999999999998888


Q ss_pred             chhhHHHHHHHHHHHHhhheEEcccCCCCChHHHHHHHhcc
Q psy15864        398 LWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADK  438 (553)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~~~~~~~~~  438 (553)
                      . ..++++.+.+++.++.+++++||||||+..|+.+..+.+
T Consensus       433 ~-~~filF~i~~~~~~i~~~~~lPETkgr~~~eI~~~~~~~  472 (485)
T KOG0569|consen  433 P-YVFILFVIPLAIFLIYLYRYLPETKGRTPYEIIEELEKR  472 (485)
T ss_pred             c-hhhHHHHHHHHHHHHHHHHhCcccCCCCHHHHHHHHHhC
Confidence            5 788888999999999999999999999999988877655



>KOG0254|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3312|consensus Back     alignment and domain information
>PF05297 Herpes_LMP1: Herpesvirus latent membrane protein 1 (LMP1); InterPro: IPR007961 This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
4gby_A491 The Structure Of The Mfs (Major Facilitator Superfa 2e-16
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 84.0 bits (206), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 93/370 (25%), Positives = 155/370 (41%), Gaps = 60/370 (16%) Query: 90 GTFLYKMAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLH------- 142 G L M +P+ Y+AE+ H+RG L + IFG + + F+ Sbjct: 139 GVGLASMLSPM-----YIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASW 193 Query: 143 -----WR----SAAILNLLFPILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTP 193 WR S I LLF +L LY +PESP WL+S+G+ ++A L + G Sbjct: 194 LNTDGWRYMFASECIPALLFLML----LYTVPESPRWLMSRGKQEQAEGILRKIMG---- 245 Query: 194 DKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMT 253 T +Q + I+ S D R+ R+ M ++ ++ S+F QF G+ Sbjct: 246 ---NTLATQAVQEIKHS------LDHGRKTGGRLLMFGVGVIVIGVMLSIF--QQFVGIN 294 Query: 254 TLQTYAVGIFESIHAPLD-PYFXXXXXXXXXXXXXXXXXXXIHYTGKRPLALISTGGSAA 312 + YA +F+++ A D + G++PL +I G A Sbjct: 295 VVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAI 354 Query: 313 CFIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTH---ICIRLLPWMLIGEVFPNNIRAT 369 + F+ L+ +F V AAF +C W+L+ E+FPN IR Sbjct: 355 GMFSLG--TAFYTQAPGIVALLSMLFYV-AAFAMSWGPVC-----WVLLSEIFPNAIRGK 406 Query: 370 XXXXXXXXXYIFAFAVNKLYYPMLDT-------FHLWGTLYFYAAISVVGTLYMYFVMPE 422 ++ + V+ +PM+D FH + + Y + V+ L+M+ +PE Sbjct: 407 ALAIAVAAQWLANYFVS-WTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPE 465 Query: 423 TEGRTLRDIE 432 T+G+TL ++E Sbjct: 466 TKGKTLEELE 475

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.97
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.85
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.83
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.8
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.76
2cfq_A417 Lactose permease; transport, transport mechanism, 99.67
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.64
2xut_A524 Proton/peptide symporter family protein; transport 99.56
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.43
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.42
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.42
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.37
2xut_A 524 Proton/peptide symporter family protein; transport 99.28
2cfq_A417 Lactose permease; transport, transport mechanism, 98.63
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.97  E-value=5.6e-32  Score=282.90  Aligned_cols=331  Identities=23%  Similarity=0.393  Sum_probs=246.9

Q ss_pred             ccccccccccc--chhhhhhhhhccCcccccchhchhhhhHHHHHHHHHhhcccc------------chHHHHHHHHHHH
Q psy15864         89 KGTFLYKMAAP--LVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFL------------HWRSAAILNLLFP  154 (553)
Q Consensus        89 ~gr~~~G~ga~--~~~~~~~i~e~~p~~~Rg~~~~~~~~~~~lG~~l~~~l~~~l------------gWr~~f~i~~i~~  154 (553)
                      -+|+++|+|.+  .+++++|++|++|+++|++..++.+.+..+|.+++++++...            .||+++.+.++++
T Consensus       131 ~~R~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (491)
T 4gc0_A          131 IYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPA  210 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhh
Confidence            47999998754  678889999999999999999999999999999888776432            6999999999999


Q ss_pred             HHHHHHhccccCCceeeeecCChHHHHHHHHHHcCCCCCcchHHHHHHHHHHHHHHHHHhcCCCCCCChhhhhhhhhcch
Q psy15864        155 ILALCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFL  234 (553)
Q Consensus       155 li~~i~~~~lpEsp~~l~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (553)
                      ++.+++.+++||||+|+..+++.+++.+.+++......   ...+..+........+.          ....  ......
T Consensus       211 ~~~~~~~~~~peSp~~L~~~~~~~~a~~~l~~~~~~~~---~~~~~~~~~~~~~~~~~----------~~~~--~~~~~~  275 (491)
T 4gc0_A          211 LLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTL---ATQAVQEIKHSLDHGRK----------TGGR--LLMFGV  275 (491)
T ss_dssp             HHHHHHGGGSCCCHHHHHHTTCHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH----------HTTH--HHHSCC
T ss_pred             hhhhhhhhcCCCChHHHHHcCchhHHHHhHHHhcCCch---hHHHHHHHHHHHHhhhh----------hhhH--HHHhcc
Confidence            99999999999999999999999999988877643211   11111111111111110          0001  111123


Q ss_pred             hHHHHHHHHHHHHhhhhhHHHHhhHHHHHHhhCCCCCh-HHHHHHHHHHHHHHHHHHhhhhcccCCcceeecchhHHHHH
Q psy15864        235 LPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDP-YFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAAC  313 (553)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~~i~~~~g~~~~g~l~dr~Grr~~l~~~~~~~~i~  313 (553)
                      ++..+......+.++.+.+.+.+|.+.+....+..... .....+.++..++++++++++.||+|||+.++.+..++.++
T Consensus       276 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dr~Grr~~~~~~~~~~~~~  355 (491)
T 4gc0_A          276 GVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIG  355 (491)
T ss_dssp             THHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHhhhhHHHhcchHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHhhcCcchhccchHHHHHH
Confidence            34455566667777888888889999988877665433 35566778889999999999999999999999888888877


Q ss_pred             HHHHHHHHHhhcccCCCCChhHHHHHHHHHHHHhhhhccccceeeccccccchhhhhhhHHHHHHHHHHHHHHHHhHHHH
Q psy15864        314 FIVVAVYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPML  393 (553)
Q Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~Rg~~~~~~~~~~~~~~~i~~~~~~~~~  393 (553)
                      .+.++.....     ....+..++..+++..+++.++.+++++|.+|++|++.|++++|+...++++++++++.+++.+.
T Consensus       356 ~~~l~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~  430 (491)
T 4gc0_A          356 MFSLGTAFYT-----QAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMD  430 (491)
T ss_dssp             HHHHHHHHHT-----TCCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHC
T ss_pred             HHHHHHHHhc-----ccchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            7766654331     22333444445555556667777888899999999999999999999999999999998877654


Q ss_pred             h------hccchhhHHHHHHHHHHHHhhheEEcccCCCCChHHHHHHHhccC
Q psy15864        394 D------TFHLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEEHFADKG  439 (553)
Q Consensus       394 ~------~~g~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~~~~~~~~~~  439 (553)
                      +      ..+....++++++++++..++.++++|||+|+++||++++++.+.
T Consensus       431 ~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLeei~~~f~~~~  482 (491)
T 4gc0_A          431 KNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWEPET  482 (491)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHHHHGGGTC---
T ss_pred             HHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHHHHHHHhCCCC
Confidence            3      234455677888888888888889999999999999998876554



>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 553
d1pw4a_447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 3e-16
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 4e-08
d1zroa2314 a.264.1.1 (A:283-596) Erythrocyte binding antigen 3e-06
d1zroa2314 a.264.1.1 (A:283-596) Erythrocyte binding antigen 9e-06
d1zroa2314 a.264.1.1 (A:283-596) Erythrocyte binding antigen 2e-05
d1zroa2314 a.264.1.1 (A:283-596) Erythrocyte binding antigen 2e-05
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 9e-06
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 1e-05
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 1e-05
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 3e-05
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 1e-04
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 2e-04
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 3e-04
d1zroa1275 a.264.1.1 (A:8-282) Erythrocyte binding antigen re 5e-04
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 5e-05
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 6e-05
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 8e-04
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 0.001
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 0.002
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 0.002
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 0.003
d2c6ja1294 a.264.1.1 (A:15-308) Duffy receptor, alpha form {P 0.003
d1v9da_332 a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 1e-04
d1k4ta3230 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase 7e-04
d1k4ta3230 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase 8e-04
d1y2oa1248 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain 0.001
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 0.001
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 0.003
d1oisa_223 e.15.1.1 (A:) Eukaryotic DNA topoisomerase I, N-te 0.004
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 78.6 bits (192), Expect = 3e-16
 Identities = 48/337 (14%), Positives = 98/337 (29%), Gaps = 37/337 (10%)

Query: 104 LTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFL------HWRSAAILNLLFPILA 157
              +        RG + +  +     G      L             +  +      ++A
Sbjct: 138 GRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVA 197

Query: 158 LCALYFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGK 217
           L A   + ++P                    G    ++ + +         E EL     
Sbjct: 198 LFAFAMMRDTPQS-----------------CGLPPIEEYKNDYPDDYNEKAEQELTA--- 237

Query: 218 DGQRRPNYRMYMRRTFLLPYAIVTSLFFIGQFGGMTTLQTYAVGIFESIHAPLDPYFATL 277
              ++   +  +    L   AI     ++ ++G +    TY   +           +A  
Sbjct: 238 ---KQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALD--KSSWAYF 292

Query: 278 LLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVAVYAQFHLSYGWDSPLVPTV 337
           L   A + G LLC  +     +               I   VY          +P V  +
Sbjct: 293 LYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNP----AGNPTVDMI 348

Query: 338 FLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFAFAVNKLYYPML-DTF 396
            +++  FL +  + +L  +   E+ P     TA+G +G   Y+              D F
Sbjct: 349 CMIVIGFLIYGPV-MLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFF 407

Query: 397 HLWGTLYFYAAISVVGTLYMYFVMPETEGRTLRDIEE 433
              G        S++  + +  VM   + R  + ++E
Sbjct: 408 GWDGGFMVMIGGSILAVILLIVVMIGEKRRHEQLLQE 444


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure
>d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 Back     information, alignment and structure
>d1k4ta3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d1k4ta3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1oisa_ e.15.1.1 (A:) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.8
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.61
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.45
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.82
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.80  E-value=1.2e-20  Score=191.53  Aligned_cols=300  Identities=15%  Similarity=0.102  Sum_probs=182.4

Q ss_pred             cccccccccc--cchhhhhhhhhccCcccccchhchhhhhHHHHHHHHHhhcccc-----chHHHHHHHHHHHHHHHHHh
Q psy15864         89 KGTFLYKMAA--PLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFL-----HWRSAAILNLLFPILALCAL  161 (553)
Q Consensus        89 ~gr~~~G~ga--~~~~~~~~i~e~~p~~~Rg~~~~~~~~~~~lG~~l~~~l~~~l-----gWr~~f~i~~i~~li~~i~~  161 (553)
                      -.|++.|++.  ..+...++++|++|+++|+++++++..+..+|.+++++++...     +||+.|++.++++++..++.
T Consensus       121 ~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~  200 (447)
T d1pw4a_         121 VLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFA  200 (447)
T ss_dssp             HHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHH
Confidence            3567777764  3467778999999999999999999999999998888766543     89999999888887775544


Q ss_pred             -ccccCCceeeeecCChHHHHHHHHHHcCCCCCcchHHHHHHHHHHHHHHHHHhcCCCCCCChhhhhhhhhcchhHHHHH
Q psy15864        162 -YFIPESPHWLISQGRMQEASASLCWLRGWVTPDKVQTELSQITKAIEESELKRLGKDGQRRPNYRMYMRRTFLLPYAIV  240 (553)
Q Consensus       162 -~~lpEsp~~l~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (553)
                       ++++++|+........+..             .+.....   .+.           ............+.....+.++.
T Consensus       201 ~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~---~~~-----------~~~~~~~~~~~~~~~~~~~~~~~  253 (447)
T d1pw4a_         201 FAMMRDTPQSCGLPPIEEYK-------------NDYPDDY---NEK-----------AEQELTAKQIFMQYVLPNKLLWY  253 (447)
T ss_dssp             HHHCCCSSTTTCCCSCTTTC-------------CC---------------------------CCTHHHHHHTSSCHHHHH
T ss_pred             HHhcccchhhcccchhhhhh-------------hhcccch---hhc-----------cccccchhhHHHHHHHcCchHHH
Confidence             4466665432111100000             0000000   000           00000111111222222333344


Q ss_pred             HHHHHHHhhhhhHHHHhhHHHHHHh-hCCCCC-hHHHHHHHHHHHHHHHHHHhhhhcccCCcceeecchhHHHHHHHHHH
Q psy15864        241 TSLFFIGQFGGMTTLQTYAVGIFES-IHAPLD-PYFATLLLGVAELGGALLCVVLIHYTGKRPLALISTGGSAACFIVVA  318 (553)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~-~~~~~~~~~i~~~~g~~~~g~l~dr~Grr~~l~~~~~~~~i~~~~~~  318 (553)
                      .....+......+.+..+.+.++.+ .+.+.. ..+...+..++.+++.+++|+++||++|+...........+..+...
T Consensus       254 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  333 (447)
T d1pw4a_         254 IAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATI  333 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhhhhhhcchhhhhhhcccccccccchhhhhhhcchhhhhhhhhhhhhhhhhccccccccccchhHHHHHHHHH
Confidence            4444444445555666677776644 344432 34666778888999999999999999988755444433333322222


Q ss_pred             HHHHhhcccCCCCChhHHHHHHHHHHHHhhhhccccceeeccccccchhhhhhhHHHHHHHHHH-HHHHHHhHHHHhhcc
Q psy15864        319 VYAQFHLSYGWDSPLVPTVFLVLAAFLTHICIRLLPWMLIGEVFPNNIRATASGASGSSSYIFA-FAVNKLYYPMLDTFH  397 (553)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~Rg~~~~~~~~~~~~~~-~i~~~~~~~~~~~~g  397 (553)
                      ....    ....+.+..++..++.+++.+... +..++++.|.+|++.||++.|+.+.++++++ +++|.+.+.+.+..|
T Consensus       334 ~~~~----~~~~~~~~~~~~~~~~g~~~~~~~-~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~g  408 (447)
T d1pw4a_         334 VYWM----NPAGNPTVDMICMIVIGFLIYGPV-MLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFG  408 (447)
T ss_dssp             HTTS----CCTTCHHHHHHHHHHHHHHHTHHH-HHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSC
T ss_pred             HHHh----cccccHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            2111    112344445555555555543333 4445888999999999999999988888754 567888899999988


Q ss_pred             chhhHHHHHHHHHHHHhhheEEc
Q psy15864        398 LWGTLYFYAAISVVGTLYMYFVM  420 (553)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~  420 (553)
                      +...+.+++++.++..++.+++.
T Consensus       409 ~~~~~~~~~~~~~~~~~~~~~~~  431 (447)
T d1pw4a_         409 WDGGFMVMIGGSILAVILLIVVM  431 (447)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Confidence            77777766666666555554433



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure