Psyllid ID: psy16276

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIKE
ccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHccccHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHcccccHHHccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHc
ccccHHcHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHccccccccHHEEEEEEEccHHHHHHHHHHccccccccccccccccccccccHHHHHccccHHHHccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHcc
martkqtarkstggkaprkQLATKAarksapstggvkkphryrpgtVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIEnsgqfdlnpssslkikkhrkptwldylktptcalsmpnvsplcpktfswpdvseesvlkfptwldylktptcalsmpnvsplcpktfswldkepikfnvdldgapEELIQLVQSIKE
martkqtarkstggkaprkqlatkaarksapstggvkkphryrpgtvalreIRRYQKSTellirklpfqRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIKE
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIKE
*********************************************TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLN****LKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQL******
MART*******************KAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPT***********************ESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSI**
**************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIKE
**************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSM***SPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIK*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKFPTWLDYLKTPTCALSMPNVSPLCPKTFSWLDKEPIKFNVDLDGAPEELIQLVQSIKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
Q8WSF1136 Histone H3.3 OS=Trichinel N/A N/A 0.455 0.720 0.969 9e-48
Q6P823136 Histone H3.3 OS=Xenopus t yes N/A 0.455 0.720 0.969 1e-47
Q6PI79136 Histone H3.3 OS=Xenopus l N/A N/A 0.455 0.720 0.969 1e-47
P84248136 Histone H3.3 OS=Spisula s N/A N/A 0.455 0.720 0.969 1e-47
P84245136 Histone H3.3 OS=Rattus no yes N/A 0.455 0.720 0.969 1e-47
P84246136 Histone H3.3 OS=Oryctolag yes N/A 0.455 0.720 0.969 1e-47
Q71LE2136 Histone H3.3 OS=Sus scrof yes N/A 0.455 0.720 0.969 1e-47
P84244136 Histone H3.3 OS=Mus muscu yes N/A 0.455 0.720 0.969 1e-47
P84243136 Histone H3.3 OS=Homo sapi yes N/A 0.455 0.720 0.969 1e-47
P84249136 Histone H3.3 OS=Drosophil yes N/A 0.455 0.720 0.969 1e-47
>sp|Q8WSF1|H33_TRIPS Histone H3.3 OS=Trichinella pseudospiralis GN=HHT3 PE=2 SV=3 Back     alignment and function desciption
 Score =  189 bits (481), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 95/98 (96%), Positives = 95/98 (96%)

Query: 1  MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
          MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1  MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIE 98
          LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ   E
Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAE 98
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Trichinella pseudospiralis (taxid: 6337)
>sp|Q6P823|H33_XENTR Histone H3.3 OS=Xenopus tropicalis GN=TGas113e22.1 PE=1 SV=3 Back     alignment and function description
>sp|Q6PI79|H33_XENLA Histone H3.3 OS=Xenopus laevis PE=1 SV=3 Back     alignment and function description
>sp|P84248|H33_SPISO Histone H3.3 OS=Spisula solidissima PE=1 SV=2 Back     alignment and function description
>sp|P84245|H33_RAT Histone H3.3 OS=Rattus norvegicus GN=H3f3b PE=1 SV=2 Back     alignment and function description
>sp|P84246|H33_RABIT Histone H3.3 OS=Oryctolagus cuniculus GN=H3F3A PE=2 SV=2 Back     alignment and function description
>sp|Q71LE2|H33_PIG Histone H3.3 OS=Sus scrofa GN=H3F3A PE=2 SV=3 Back     alignment and function description
>sp|P84244|H33_MOUSE Histone H3.3 OS=Mus musculus GN=H3f3a PE=1 SV=2 Back     alignment and function description
>sp|P84243|H33_HUMAN Histone H3.3 OS=Homo sapiens GN=H3F3A PE=1 SV=2 Back     alignment and function description
>sp|P84249|H33_DROME Histone H3.3 OS=Drosophila melanogaster GN=His3.3A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
195185648191 GL16668 [Drosophila persimilis] gi|19411 0.641 0.722 0.715 2e-52
12847552172 unnamed protein product [Mus musculus] 0.590 0.738 0.755 4e-50
184185553112 histone H3.3A (predicted) [Rhinolophus f 0.520 1.0 0.759 6e-47
384494530 590 histone H3 [Rhizopus delemar RA 99-880] 0.437 0.159 0.989 9e-47
410038708136 PREDICTED: histone H3.3-like isoform 1 [ 0.534 0.845 0.837 4e-46
47225158188 unnamed protein product [Tetraodon nigro 0.641 0.734 0.675 5e-46
156356095136 predicted protein [Nematostella vectensi 0.455 0.720 0.969 5e-46
432895697119 PREDICTED: histone H3.3-like, partial [O 0.455 0.823 0.969 5e-46
432892305250 PREDICTED: histone H3.3-like [Oryzias la 0.460 0.396 0.949 5e-46
62204741138 H3 histone, family 3B [Mus musculus] 0.618 0.963 0.679 5e-46
>gi|195185648|ref|XP_002029274.1| GL16668 [Drosophila persimilis] gi|194115638|gb|EDW37681.1| GL16668 [Drosophila persimilis] Back     alignment and taxonomy information
 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/158 (71%), Positives = 122/158 (77%), Gaps = 20/158 (12%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPT 120
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ   E S  +                 
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQ---EASEAY----------------- 100

Query: 121 WLDYLKTPTCALSMPNVSPLCPKTFSWPDVSEESVLKF 158
            +   + PTCA SMP+VS  CP+T +WPDVS  SVLK 
Sbjct: 101 LVGLFEIPTCAPSMPSVSQSCPRTSNWPDVSVASVLKL 138

Source: Drosophila persimilis

Species: Drosophila persimilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|12847552|dbj|BAB27616.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|184185553|gb|ACC68951.1| histone H3.3A (predicted) [Rhinolophus ferrumequinum] Back     alignment and taxonomy information
>gi|384494530|gb|EIE85021.1| histone H3 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
>gi|410038708|ref|XP_003950456.1| PREDICTED: histone H3.3-like isoform 1 [Pan troglodytes] gi|410038710|ref|XP_003950457.1| PREDICTED: histone H3.3-like isoform 2 [Pan troglodytes] gi|410038712|ref|XP_003950458.1| PREDICTED: histone H3.3-like isoform 3 [Pan troglodytes] Back     alignment and taxonomy information
>gi|47225158|emb|CAF98785.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|156356095|ref|XP_001623766.1| predicted protein [Nematostella vectensis] gi|196007812|ref|XP_002113772.1| replacement histone H3.3 [Trichoplax adhaerens] gi|221130419|ref|XP_002154470.1| PREDICTED: histone H3.3-like [Hydra magnipapillata] gi|48427895|sp|Q8WSF1.3|H33_TRIPS RecName: Full=Histone H3.3 gi|18265391|gb|AAL67159.1|AF323993_1 histone H3.3 [Trichinella pseudospiralis] gi|118776378|gb|ABL14206.1| histone H3.3-like protein protein [Trichinella spiralis] gi|156210495|gb|EDO31666.1| predicted protein [Nematostella vectensis] gi|190584176|gb|EDV24246.1| replacement histone H3.3 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|432895697|ref|XP_004076117.1| PREDICTED: histone H3.3-like, partial [Oryzias latipes] Back     alignment and taxonomy information
>gi|432892305|ref|XP_004075755.1| PREDICTED: histone H3.3-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|62204741|gb|AAH92300.1| H3 histone, family 3B [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
UNIPROTKB|K7ES00151 H3F3B "Histone H3" [Homo sapie 0.660 0.940 0.721 5.4e-47
UNIPROTKB|B4DEB1123 H3F3A "Histone H3" [Homo sapie 0.451 0.788 0.959 9.1e-45
UNIPROTKB|F6XQ29109 H3F3B "Histone H3" [Canis lupu 0.455 0.899 0.959 2.4e-44
FB|FBgn0014857136 His3.3A "Histone H3.3A" [Droso 0.437 0.691 1.0 3.1e-44
FB|FBgn0004828136 His3.3B "Histone H3.3B" [Droso 0.437 0.691 1.0 3.1e-44
UNIPROTKB|P84247136 H3-IX "Histone H3.3" [Gallus g 0.437 0.691 1.0 3.1e-44
UNIPROTKB|Q5E9F8136 H3F3A "Histone H3.3" [Bos taur 0.437 0.691 1.0 3.1e-44
UNIPROTKB|E2R6K5136 H3F3B "Histone H3" [Canis lupu 0.437 0.691 1.0 3.1e-44
UNIPROTKB|K7EK07132 H3F3B "Histone H3" [Homo sapie 0.437 0.712 1.0 3.1e-44
UNIPROTKB|P84243136 H3F3A "Histone H3.3" [Homo sap 0.437 0.691 1.0 3.1e-44
UNIPROTKB|K7ES00 H3F3B "Histone H3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 5.4e-47, P = 5.4e-47
 Identities = 109/151 (72%), Positives = 115/151 (76%)

Query:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
             MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENS-----GQF----DLNPSSSL 111
             LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ           G F     +N ++ +
Sbjct:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQVRQRPGAGGGLGGFRSPSGINSAALV 120

Query:   112 KIKKHRKPTWLDYLKTPTCALSMPNVSPLCP 142
               ++  K TW    K PTC  S    SP CP
Sbjct:   121 LNRRLAKRTWWVCSKIPTCVPSTLRESPSCP 151
GO:0006334 "nucleosome assembly" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|B4DEB1 H3F3A "Histone H3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6XQ29 H3F3B "Histone H3" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0014857 His3.3A "Histone H3.3A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004828 His3.3B "Histone H3.3B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P84247 H3-IX "Histone H3.3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9F8 H3F3A "Histone H3.3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6K5 H3F3B "Histone H3" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7EK07 H3F3B "Histone H3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P84243 H3F3A "Histone H3.3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2UCQ0H3_ASPORNo assigned EC number0.91830.45580.7205yesN/A
Q8WSF1H33_TRIPSNo assigned EC number0.96930.45580.7205N/AN/A
Q0UY45H3_PHANONo assigned EC number0.92850.45580.7205N/AN/A
Q4P7J7H31_USTMANo assigned EC number0.92850.45580.7205N/AN/A
Q10453H331_CAEELNo assigned EC number0.95910.45580.7205yesN/A
A5PK61H3C_BOVINNo assigned EC number0.93870.45580.7205yesN/A
P23753H3_EMENINo assigned EC number0.91830.45580.7205yesN/A
P09988H31_SCHPONo assigned EC number0.92850.45580.7205yesN/A
Q59VN2H31_CANALNo assigned EC number0.92850.45580.7205N/AN/A
P07041H3_NEUCRNo assigned EC number0.91910.46040.7279N/AN/A
P61832H3_ASPFUNo assigned EC number0.91830.45580.7205yesN/A
Q4IER8H3_GIBZENo assigned EC number0.91910.46040.7279yesN/A
Q6PI79H33_XENLANo assigned EC number0.96930.45580.7205N/AN/A
P61836H3_ZYGBANo assigned EC number0.92850.45580.7205N/AN/A
Q6P823H33_XENTRNo assigned EC number0.96930.45580.7205yesN/A
Q5E9F8H33_BOVINNo assigned EC number0.96930.45580.7205yesN/A
P61834H3_PENFNNo assigned EC number0.91830.45580.7205N/AN/A
A5DFC5H31_PICGUNo assigned EC number0.92850.45580.7205N/AN/A
P84244H33_MOUSENo assigned EC number0.96930.45580.7205yesN/A
P84245H33_RATNo assigned EC number0.96930.45580.7205yesN/A
P84246H33_RABITNo assigned EC number0.96930.45580.7205yesN/A
P84247H33_CHICKNo assigned EC number0.96930.45580.7205yesN/A
Q9U281H332_CAEELNo assigned EC number0.95910.45580.7205yesN/A
P61833H3_CANGANo assigned EC number0.92850.45580.7205yesN/A
P61830H3_YEASTNo assigned EC number0.92850.45580.7205yesN/A
P61831H3_KLULANo assigned EC number0.92850.45580.7205yesN/A
Q757N1H3_ASHGONo assigned EC number0.92850.45580.7205yesN/A
A2QRR5H3_ASPNCNo assigned EC number0.91830.45580.7205yesN/A
P84248H33_SPISONo assigned EC number0.96930.45580.7205N/AN/A
P84249H33_DROMENo assigned EC number0.96930.45580.7205yesN/A
Q0D0E8H3_ASPTNNo assigned EC number0.91830.45580.7205N/AN/A
Q5RCC9H33_PONABNo assigned EC number0.95910.45580.7205yesN/A
Q9P427H3_AJECANo assigned EC number0.90810.45580.7205N/AN/A
A5DWE2H31_LODELNo assigned EC number0.92850.45580.7205N/AN/A
P84243H33_HUMANNo assigned EC number0.96930.45580.7205yesN/A
A4RCX7H3_MAGO7No assigned EC number0.91910.46040.7279N/AN/A
A3LXD5H31_PICSTNo assigned EC number0.92850.45580.7205yesN/A
Q5DWI3H3_MARPONo assigned EC number0.91910.46040.7279N/AN/A
A5DG57H33_PICGUNo assigned EC number0.90810.45580.7205N/AN/A
Q6PI20H33_DANRENo assigned EC number0.96930.45580.7205yesN/A
A1D240H3_NEOFINo assigned EC number0.91830.45580.7205N/AN/A
Q6DL03H3_CHAGBNo assigned EC number0.91910.46040.7279N/AN/A
Q9HDN1H3_MORAPNo assigned EC number0.94890.45580.7205N/AN/A
A1CP80H3_ASPCLNo assigned EC number0.91830.45580.7205N/AN/A
P02301H3C_MOUSENo assigned EC number0.94890.45580.7205yesN/A
Q71LE2H33_PIGNo assigned EC number0.96930.45580.7205yesN/A
P84250H33_DROHYNo assigned EC number0.96930.45580.7205N/AN/A
Q4PB04H32_USTMANo assigned EC number0.92850.45580.7205N/AN/A
P61835H3_HYPJENo assigned EC number0.91910.46040.7279N/AN/A
Q6BRZ5H31_DEBHANo assigned EC number0.92850.45580.7205yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 3e-62
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 1e-55
smart00428105 smart00428, H3, Histone H3 3e-30
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 3e-22
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 6e-13
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 3e-12
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 8e-10
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information 
 Score =  190 bits (483), Expect = 3e-62
 Identities = 88/94 (93%), Positives = 92/94 (97%)

Query: 1  MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
          MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1  MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ 94
          LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ
Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQ 94

Length = 136
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN00161135 histone H3; Provisional 100.0
KOG1745|consensus137 100.0
smart00428105 H3 Histone H3. 100.0
PLN0016097 histone H3; Provisional 100.0
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.58
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 98.96
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 96.53
>PTZ00018 histone H3; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.3e-47  Score=308.43  Aligned_cols=124  Identities=77%  Similarity=1.084  Sum_probs=119.3

Q ss_pred             CCCcccccccCCCCCCCCchhhhhhhccCCCCCCCCCCCcccCCCchhhHHHHhhhchhhhhhccchhHHHHHHHHHhcc
Q psy16276          1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (215)
Q Consensus         1 MARTKqtArKstggkaPRKqlatkaarKs~p~~g~~kKp~R~RPGTvALrEIRryQkSTeLLIpKlPFqRLVREIaq~~~   80 (215)
                      ||||||++++++|+++|+++.++++++++.+.+++.++++||+||++||+|||+||+||+|||+|+||+||||||+++|.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999999988888888889999999999999999999999999999999999999999999999


Q ss_pred             ccccchHHHHHHHHHHHHhhcccccCCCchHHhhhcCCceeecccCCc-ccccCCCcCCCCCCCCC
Q psy16276         81 TDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTP-TCALSMPNVSPLCPKTF  145 (215)
Q Consensus        81 ~~lRfqssAL~ALQEAaE~~~ay~L~f~~s~~~~~h~k~vtV~lfeD~-lCAihakr~s~~~~~~~  145 (215)
                      +++|||++||+|||||+|   +| |                |++|||+ +||+|++|+| +|+++.
T Consensus        81 ~~~rf~~~al~aLQeaaE---~y-L----------------v~lfed~~lca~HakRVT-l~~kD~  125 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAE---AY-L----------------VGLFEDTNLCAIHAKRVT-IMPKDI  125 (136)
T ss_pred             CcceeeHHHHHHHHHHHH---HH-H----------------HHHhhhhHHHHHhhccee-cchhhH
Confidence            999999999999999999   99 9                9999998 9999999988 888765

>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
3av2_A139 The Human Nucleosome Structure Containing The Histo 9e-49
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 1e-48
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 5e-48
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 2e-47
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 2e-47
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 5e-47
3lel_A136 Structural Insight Into The Sequence-Dependence Of 7e-47
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 8e-47
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 8e-47
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 8e-47
3afa_A139 The Human Nucleosome Structure Length = 139 8e-47
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 9e-47
3av1_A139 The Human Nucleosome Structure Containing The Histo 1e-46
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-46
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-46
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-46
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 5e-46
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 5e-46
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 5e-46
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 5e-46
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 5e-46
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 7e-46
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 1e-45
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 1e-45
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-44
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 2e-44
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 3e-35
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 4e-25
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-21
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 5e-11
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 5e-11
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 8e-11
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 6e-09
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 2e-08
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 3e-08
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 5e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 5e-08
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 2e-07
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 2e-07
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 2e-07
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 4e-06
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 2e-05
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 1e-04
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 1e-04
2l5a_A235 Structural Basis For Recognition Of Centromere Spec 2e-04
2x4w_B21 Molecular Basis Of Histone H3k36me3 Recognition By 2e-04
2p5b_I22 The Complex Structure Of Jmjd2a And Trimethylated H 5e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 5e-04
2kft_B21 Nmr Solution Structure Of The First Phd Finger Doma 6e-04
2kwk_B20 Solution Structures Of The Double Phd Fingers Of Hu 6e-04
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 7e-04
2uxn_E21 Structural Basis Of Histone Demethylation By Lsd1 R 7e-04
2v1d_C21 Structural Basis Of Lsd1-Corest Selectivity In Hist 8e-04
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure 
Iteration: 1

 Score =  189 bits (480), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 95/98 (96%), Positives = 95/98 (96%)
Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 4   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 63
Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIE 98
           LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ   E
Sbjct: 64  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASE 101
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 Back     alignment and structure
>pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure
>pdb|2KFT|B Chain B, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 21 Back     alignment and structure
>pdb|2KWK|B Chain B, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3b Bound To A H3 Peptide Wild Type Length = 20 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|2UXN|E Chain E, Structural Basis Of Histone Demethylation By Lsd1 Revealed By Suicide Inactivation Length = 21 Back     alignment and structure
>pdb|2V1D|C Chain C, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 21 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 7e-30
3r45_A156 Histone H3-like centromeric protein A; histone fol 2e-23
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 2e-23
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 5e-21
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 3e-14
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 6e-11
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 2e-10
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 5e-07
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
 Score =  107 bits (266), Expect = 7e-30
 Identities = 91/98 (92%), Positives = 94/98 (95%)

Query: 1  MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60
          MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIE 98
          LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ   E
Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE 98
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 Back     alignment and structure
>3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.89
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.89
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 99.87
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.85
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 98.94
2r10_A 361 Chromatin structure-remodeling complex protein RSC 98.93
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.43
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 98.09
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 98.05
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 95.77
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 94.5
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 88.49
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 85.63
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 84.92
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 84.7
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 84.07
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 81.09
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 80.62
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
Probab=100.00  E-value=1.3e-51  Score=335.21  Aligned_cols=123  Identities=79%  Similarity=1.099  Sum_probs=79.2

Q ss_pred             CCCcccccccCCCCCCCCchhhhhhhccCCCCCCCCCCCcccCCCchhhHHHHhhhchhhhhhccchhHHHHHHHHHhcc
Q psy16276          1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (215)
Q Consensus         1 MARTKqtArKstggkaPRKqlatkaarKs~p~~g~~kKp~R~RPGTvALrEIRryQkSTeLLIpKlPFqRLVREIaq~~~   80 (215)
                      ||||||||+||+||++|+|++++++++|++|+++|++++||||||++||+|||+||+||+|||||+||+||||||+++|+
T Consensus         1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~   80 (136)
T 1tzy_C            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_dssp             -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccchHHHHHHHHHHHHhhcccccCCCchHHhhhcCCceeecccCCc-ccccCCCcCCCCCCCC
Q psy16276         81 TDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTWLDYLKTP-TCALSMPNVSPLCPKT  144 (215)
Q Consensus        81 ~~lRfqssAL~ALQEAaE~~~ay~L~f~~s~~~~~h~k~vtV~lfeD~-lCAihakr~s~~~~~~  144 (215)
                      +++|||++||.|||||+|   +| |                |+||||+ +||+||+|+| +++++
T Consensus        81 ~~~R~q~~Al~aLQeaaE---ay-L----------------v~Lfeda~l~A~HAkRvT-i~~kD  124 (136)
T 1tzy_C           81 TDLRFQSSAVMALQEASE---AY-L----------------VGLFEDTNLCAIHAKRVT-IMPKD  124 (136)
T ss_dssp             TTCEECHHHHHHHHHHHH---HH-H----------------HHHHHHHHHHHHHTTCSE-ECHHH
T ss_pred             hhhcccHHHHHHHHHHHH---HH-H----------------HHHHHHHHHHHHHcCCcc-CcHHh
Confidence            999999999999999999   99 9                9999998 9999999987 77754
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 215
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 2e-30
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score =  105 bits (264), Expect = 2e-30
 Identities = 51/57 (89%), Positives = 53/57 (92%)

Query: 42 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIE 98
          YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ   E
Sbjct: 1  YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE 57

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 95.51
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 91.98
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 89.84
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=5.2e-36  Score=229.02  Aligned_cols=82  Identities=70%  Similarity=1.014  Sum_probs=78.6

Q ss_pred             cCCCchhhHHHHhhhchhhhhhccchhHHHHHHHHHhccccccchHHHHHHHHHHHHhhcccccCCCchHHhhhcCCcee
Q psy16276         42 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQYWIENSGQFDLNPSSSLKIKKHRKPTW  121 (215)
Q Consensus        42 ~RPGTvALrEIRryQkSTeLLIpKlPFqRLVREIaq~~~~~lRfqssAL~ALQEAaE~~~ay~L~f~~s~~~~~h~k~vt  121 (215)
                      |||||+||+|||+||+||+|||||+||+||||||++++.+++|||++||.|||||+|   +| |                
T Consensus         1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E---~y-L----------------   60 (95)
T d1tzyc_           1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE---AY-L----------------   60 (95)
T ss_dssp             CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHH---HH-H----------------
T ss_pred             CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHH---HH-H----------------
Confidence            799999999999999999999999999999999999999999999999999999999   99 9                


Q ss_pred             ecccCCc-ccccCCCcCCCCCCCC
Q psy16276        122 LDYLKTP-TCALSMPNVSPLCPKT  144 (215)
Q Consensus       122 V~lfeD~-lCAihakr~s~~~~~~  144 (215)
                      |++|||+ +||+|++|+| +++++
T Consensus        61 v~lfeda~~~a~HakRvT-l~~kD   83 (95)
T d1tzyc_          61 VGLFEDTNLCAIHAKRVT-IMPKD   83 (95)
T ss_dssp             HHHHHHHHHHHHHTTCSE-ECHHH
T ss_pred             HHHHHHhHHHHHhcCCCc-CCHHH
Confidence            9999998 9999999887 77764
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure