Psyllid ID: psy16352


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-----
GPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSSWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAFRQKSTKFGMDLHLNHAKLLGR
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccEEEEcEEEcccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHccccEEEcccHHHHHcccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEccccccccccEEEcccccEEEEEcccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHccc
ccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHcccccccccccccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHEccccccccccccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHcccEEEEccccHHHHccccccccHHHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHcccccccccEHHccccccccccccccccccccccccEcccccccccEEEEEcccccccccEEcccccEEEEEcccccccccccccccccEEEcccEEEEEcccccccccHcHEEEEEEccccccccccccccccEEEEEcccccccccccccccccEEEccccEEEccEEEEccccccccccccccccHHHEEcccccccccHcHHHHHHHcc
GPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVnktpqlaggpniqYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLkardsfddwrwkesldLSDLVQRRLEYlqnppdcrTARKLVCElnkgcgygcqlHHVVYCFIVAYATQRTLIldskewsysrggweevfqpvsktctspegvsnsswpgnndtqviylpiiefinprppylplaipedleprlsrlhgdpiVWWIGQFLMflnnptpnTREIVAKYGEkikfqkpivgihirrtdkvdteaalhpvEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKArdsfddwrwkesldLSDLVQRRLEYlqnppdcrTARKLVCElnkgcgygcqlHHVVYCFIVAYATRRTLIldskewsysrggweevfqpvsktctspegvsnsgwpgnndtqviylpiiefinprppylplaipedleprlsrlhgdpiVWWIGQFLTflnnptpnTREIVAKYGEkikfqkpivgihirrtdkvdteaalhpvEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIRekypqysvlgdpsiarTASLEHRYLKSSLLGIItdlhylsncdhlvcTFSSQICRTAYEQmnakfpdasdryrslddiyyfgvptATIWCICRTAYEqmnakfpdasdryrslddiyyfggqlsrihiavlphtprhsseMALLVGDRISvagnhwngyskgrnlrtdqlalyptfktsadsfpaFAYIFRRIHIavlphtprhssemdlmVGDRIsvagnhwngyskgrnlrtdqlalyptfksvphvetarfptypevpsrwpnvkKAAFRQKSTKFGMDLHLNHAKLLGR
gpniqyelarkrvskdvQELWYYVSSELTQFRTELVnktpqlaggpniqyELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKardsfddwrwKESLDLSDLVQRRLEYlqnppdcrtARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCTspegvsnsswpgnNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGekikfqkpivgihirrtdkvdteaaLHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDdasvlteireksllhVLGILKardsfddwrwKESLDLSDLVQRRLEYlqnppdcrtARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTspegvsnsgwpgnNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYgekikfqkpivgihirrtdkvdteaaLHPVEEYMTGVEEYYKQLALtqtvdvkrVYVATDDASvlteirekypqysvlgdpSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPtfksvphvetarfptypevpsrwpnVKKAAFRQKstkfgmdlHLNHAKLLGR
GPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSSWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAFRQKSTKFGMDLHLNHAKLLGR
************VSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTC************GNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCT*******SGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAF*********************
******E**********************************************RKRVSKDVQELWYYVSSELT*******************IIAETAEHKRSLLHVLDTLKARDS***W****SLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCT*PEGVSNSSWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDS***W***ESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSI***********KSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWC*************************************************EMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNV***AFRQKSTKFGMDLHLNHAKLLG*
GPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSK***********SWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSK*********NSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAFRQKSTKFGMDLHLNHAKLLGR
*PNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEG*SNSSWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAFRQKSTKFGMDLHLNHAKLLGR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSSWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKSVPHVETARFPTYPEVPSRWPNVKKAAFRQKSTKFGMDLHLNHAKLLGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query905 2.2.26 [Sep-21-2011]
Q9VYV5619 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.639 0.536 1e-140
Q6NVP8578 Alpha-(1,6)-fucosyltransf yes N/A 0.438 0.686 0.497 1e-128
Q9N0W2575 Alpha-(1,6)-fucosyltransf yes N/A 0.451 0.711 0.485 1e-128
Q6EV77575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.501 1e-128
Q9BYC5575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.501 1e-128
Q6EV76575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.503 1e-128
Q9WTS2575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.503 1e-127
Q659X0575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.498 1e-127
Q5NVB3574 Alpha-(1,6)-fucosyltransf yes N/A 0.436 0.688 0.501 1e-126
P79282575 Alpha-(1,6)-fucosyltransf yes N/A 0.437 0.688 0.496 1e-125
>sp|Q9VYV5|FUT8_DROME Alpha-(1,6)-fucosyltransferase OS=Drosophila melanogaster GN=FucT6 PE=1 SV=1 Back     alignment and function desciption
 Score =  498 bits (1283), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/434 (53%), Positives = 296/434 (68%), Gaps = 38/434 (8%)

Query: 357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416
           ++SLL  +  ++  D ++ WR KE+ DLSDLVQRRL +LQNP DC+ ARKLVC+LNKGCG
Sbjct: 209 KRSLLSDMERMRQSDGYEAWRHKEARDLSDLVQRRLHHLQNPSDCQNARKLVCKLNKGCG 268

Query: 417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPG 476
           YGCQLHHVVYCFIVAYAT RTLIL S+ W Y +GGWEEVFQPVS +C      +   WPG
Sbjct: 269 YGCQLHHVVYCFIVAYATERTLILKSRGWRYHKGGWEEVFQPVSNSCHDAGTANTYNWPG 328

Query: 477 NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNT 536
             +TQV+ LPII+ + PRPPYLPLA+PEDL PRL RLHGDPIVWW+GQFL +L  P P T
Sbjct: 329 KPNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKRLHGDPIVWWVGQFLKYLLRPQPTT 388

Query: 537 REIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVK 596
           R+ +      + +++PIVG+H+RRTDKV TEAA H VEEYMT VE+YY+ L +  +   +
Sbjct: 389 RDFLTSGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYMTYVEDYYRTLEVNGSTVAR 448

Query: 597 RVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDH 656
           R+++A+DDA V+ E R KYPQY ++GDP +AR AS+  RY  ++L GII D+H LS  DH
Sbjct: 449 RIFLASDDAQVIEEARRKYPQYQIIGDPEVARMASVSTRYTDTALNGIILDIHLLSMSDH 508

Query: 657 LVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFP 716
           LVCTFSSQ+CR AYE M   +PDA+ R++SLDDIYY                        
Sbjct: 509 LVCTFSSQVCRVAYEIMQTMYPDAAHRFKSLDDIYY------------------------ 544

Query: 717 DASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRN 776
                         +GGQ +     V+ H PR   ++ L VGD +SVAGNHW+G SKG+N
Sbjct: 545 --------------YGGQNAHNRRVVIAHKPRTHEDLQLRVGDLVSVAGNHWDGNSKGKN 590

Query: 777 LRTDQLALYPTFKT 790
            RT+Q  L+P+FK 
Sbjct: 591 TRTNQGGLFPSFKV 604




Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q6NVP8|FUT8_XENTR Alpha-(1,6)-fucosyltransferase OS=Xenopus tropicalis GN=fut8 PE=2 SV=1 Back     alignment and function description
>sp|Q9N0W2|FUT8_BOVIN Alpha-(1,6)-fucosyltransferase OS=Bos taurus GN=FUT8 PE=2 SV=1 Back     alignment and function description
>sp|Q6EV77|FUT8_PANTR Alpha-(1,6)-fucosyltransferase OS=Pan troglodytes GN=FUT8 PE=2 SV=1 Back     alignment and function description
>sp|Q9BYC5|FUT8_HUMAN Alpha-(1,6)-fucosyltransferase OS=Homo sapiens GN=FUT8 PE=1 SV=2 Back     alignment and function description
>sp|Q6EV76|FUT8_RAT Alpha-(1,6)-fucosyltransferase OS=Rattus norvegicus GN=Fut8 PE=2 SV=1 Back     alignment and function description
>sp|Q9WTS2|FUT8_MOUSE Alpha-(1,6)-fucosyltransferase OS=Mus musculus GN=Fut8 PE=2 SV=2 Back     alignment and function description
>sp|Q659X0|FUT8_CANFA Alpha-(1,6)-fucosyltransferase OS=Canis familiaris GN=FUT8 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVB3|FUT8_PONAB Alpha-(1,6)-fucosyltransferase OS=Pongo abelii GN=FUT8 PE=2 SV=1 Back     alignment and function description
>sp|P79282|FUT8_PIG Alpha-(1,6)-fucosyltransferase OS=Sus scrofa GN=FUT8 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query905
189236914592 PREDICTED: similar to alpha-(1,6)-fucosy 0.449 0.687 0.543 1e-145
157118068573 alpha6-fucosyltransferase, putative [Aed 0.468 0.739 0.521 1e-144
328709459567 PREDICTED: alpha-(1,6)-fucosyltransferas 0.437 0.698 0.576 1e-144
170044485573 alpha-(1,6)-fucosyltransferase [Culex qu 0.458 0.724 0.523 1e-143
347966757586 AGAP001888-PA [Anopheles gambiae str. PE 0.449 0.694 0.541 1e-143
312380130595 hypothetical protein AND_07861 [Anophele 0.438 0.667 0.547 1e-141
194889456619 GG18841 [Drosophila erecta] gi|190648738 0.437 0.639 0.536 1e-138
195355262619 GM13053 [Drosophila sechellia] gi|194129 0.437 0.639 0.536 1e-138
18859827619 alpha1,6-fucosyltransferase [Drosophila 0.437 0.639 0.536 1e-138
195480779619 FucT6 [Drosophila yakuba] gi|194188912|g 0.437 0.639 0.534 1e-137
>gi|189236914|ref|XP_969111.2| PREDICTED: similar to alpha-(1,6)-fucosyltransferase [Tribolium castaneum] gi|270006336|gb|EFA02784.1| hypothetical protein TcasGA2_TC008521 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  523 bits (1348), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 310/449 (69%), Gaps = 42/449 (9%)

Query: 357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416
           ++SLLH +  L   D +  WR KE+ DLS LVQ+R  +LQNP DC+TA+KL+C LNKGCG
Sbjct: 171 KRSLLHDIDQLAEVDGYATWREKEANDLSGLVQKRFHFLQNPADCKTAKKLICSLNKGCG 230

Query: 417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPG 476
           YGCQLHH VYCF+VAY T+RTLIL SK W Y + GWEE+F+PVS TC  P G S S WPG
Sbjct: 231 YGCQLHHAVYCFMVAYGTKRTLILKSKGWRYHKAGWEEIFKPVSDTCVDPSGKSVSNWPG 290

Query: 477 NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNT 536
           N++TQV+ LPII+ ++PRPP+LPLAIPEDL PRL+RLHGDPIVWW+GQ L FL  P P T
Sbjct: 291 NSETQVVNLPIIDSLSPRPPFLPLAIPEDLAPRLTRLHGDPIVWWVGQILKFLLRPQPQT 350

Query: 537 REIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVK 596
             ++ +    + F++PIVG+H+RRTDKV TEAA H +EEYMT V+EYYK+L L  +VD +
Sbjct: 351 AAVMQETMTHMGFKRPIVGVHVRRTDKVGTEAAYHGIEEYMTAVDEYYKELELKTSVDKR 410

Query: 597 RVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDH 656
           R+Y+ATDD  V+ + + KY  Y +LGDPSI++TA++  RY  SSL GII D++ L+  D+
Sbjct: 411 RIYLATDDPKVIADAKSKYSHYEILGDPSISKTAAISTRYSDSSLFGIINDINMLAMSDY 470

Query: 657 LVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFP 716
           LVCTFSSQ+CR AYE M   +PDAS R+RSLDD+Y                         
Sbjct: 471 LVCTFSSQVCRVAYEIMQTYYPDASSRFRSLDDVY------------------------- 505

Query: 717 DASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRN 776
                        Y+GGQ     IAVL H PR + EM+++ GD I VAGNHWNG+SKGRN
Sbjct: 506 -------------YYGGQNPHNTIAVLSHEPRKNGEMSVVAGDLIGVAGNHWNGFSKGRN 552

Query: 777 LRTDQLALYPTFKTS----ADSFPAFAYI 801
           LRT+Q+ALYP+FK         FP +A +
Sbjct: 553 LRTNQIALYPSFKVKDKIETAKFPTYAEV 581




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157118068|ref|XP_001658992.1| alpha6-fucosyltransferase, putative [Aedes aegypti] gi|108875844|gb|EAT40069.1| AAEL008181-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328709459|ref|XP_001947095.2| PREDICTED: alpha-(1,6)-fucosyltransferase-like [Acyrthosiphon pisum] gi|328709468|ref|XP_001951687.2| PREDICTED: alpha-(1,6)-fucosyltransferase-like isoform 1 [Acyrthosiphon pisum] gi|328709470|ref|XP_003243969.1| PREDICTED: alpha-(1,6)-fucosyltransferase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170044485|ref|XP_001849876.1| alpha-(1,6)-fucosyltransferase [Culex quinquefasciatus] gi|167867616|gb|EDS30999.1| alpha-(1,6)-fucosyltransferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347966757|ref|XP_321174.5| AGAP001888-PA [Anopheles gambiae str. PEST] gi|333469912|gb|EAA01061.5| AGAP001888-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312380130|gb|EFR26214.1| hypothetical protein AND_07861 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194889456|ref|XP_001977089.1| GG18841 [Drosophila erecta] gi|190648738|gb|EDV46016.1| GG18841 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195355262|ref|XP_002044111.1| GM13053 [Drosophila sechellia] gi|194129380|gb|EDW51423.1| GM13053 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|18859827|ref|NP_572740.1| alpha1,6-fucosyltransferase [Drosophila melanogaster] gi|33112303|sp|Q9VYV5.1|FUT8_DROME RecName: Full=Alpha-(1,6)-fucosyltransferase; Short=Alpha1-6FucT; AltName: Full=GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase; AltName: Full=GDP-fucose--glycoprotein fucosyltransferase; AltName: Full=Glycoprotein 6-alpha-L-fucosyltransferase gi|24637307|gb|AAN63649.1|AF441264_1 alpha 1,6 fucosyltransferase [Drosophila melanogaster] gi|7292682|gb|AAF48079.1| alpha1,6-fucosyltransferase [Drosophila melanogaster] gi|15291213|gb|AAK92875.1| GH11963p [Drosophila melanogaster] gi|220945356|gb|ACL85221.1| FucT6-PA [synthetic construct] gi|220955164|gb|ACL90125.1| FucT6-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195480779|ref|XP_002101388.1| FucT6 [Drosophila yakuba] gi|194188912|gb|EDX02496.1| FucT6 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query905
FB|FBgn0030327619 FucT6 "alpha1,6-fucosyltransfe 0.372 0.544 0.607 1.6e-149
UNIPROTKB|F1SA54575 FUT8 "Alpha-(1,6)-fucosyltrans 0.373 0.587 0.563 2.4e-140
ZFIN|ZDB-GENE-031118-20581 fut8 "fucosyltransferase 8 (al 0.374 0.583 0.570 1.3e-139
UNIPROTKB|F1N4H9575 LOC100851836 "Uncharacterized 0.373 0.587 0.565 3.5e-139
UNIPROTKB|F1PZQ9575 FUT8 "Alpha-(1,6)-fucosyltrans 0.373 0.587 0.563 5.6e-139
RGD|1303096575 Fut8 "fucosyltransferase 8 (al 0.373 0.587 0.565 1.2e-138
UNIPROTKB|Q6EV76575 Fut8 "Alpha-(1,6)-fucosyltrans 0.373 0.587 0.565 1.2e-138
UNIPROTKB|P79282575 FUT8 "Alpha-(1,6)-fucosyltrans 0.377 0.594 0.556 1.2e-138
UNIPROTKB|Q9N0W2575 FUT8 "Alpha-(1,6)-fucosyltrans 0.373 0.587 0.563 1.5e-138
UNIPROTKB|Q9BYC5575 FUT8 "Alpha-(1,6)-fucosyltrans 0.373 0.587 0.563 1.9e-138
FB|FBgn0030327 FucT6 "alpha1,6-fucosyltransferase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1153 (410.9 bits), Expect = 1.6e-149, Sum P(3) = 1.6e-149
 Identities = 206/339 (60%), Positives = 260/339 (76%)

Query:   357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416
             ++SLL  +  ++  D ++ WR KE+ DLSDLVQRRL +LQNP DC+ ARKLVC+LNKGCG
Sbjct:   209 KRSLLSDMERMRQSDGYEAWRHKEARDLSDLVQRRLHHLQNPSDCQNARKLVCKLNKGCG 268

Query:   417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNS-GWP 475
             YGCQLHHVVYCFIVAYAT RTLIL S+ W Y +GGWEEVFQPVS +C    G +N+  WP
Sbjct:   269 YGCQLHHVVYCFIVAYATERTLILKSRGWRYHKGGWEEVFQPVSNSCHDA-GTANTYNWP 327

Query:   476 GNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPN 535
             G  +TQV+ LPII+ + PRPPYLPLA+PEDL PRL RLHGDPIVWW+GQFL +L  P P 
Sbjct:   328 GKPNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKRLHGDPIVWWVGQFLKYLLRPQPT 387

Query:   536 TREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDV 595
             TR+ +      + +++PIVG+H+RRTDKV TEAA H VEEYMT VE+YY+ L +  +   
Sbjct:   388 TRDFLTSGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYMTYVEDYYRTLEVNGSTVA 447

Query:   596 KRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCD 655
             +R+++A+DDA V+ E R KYPQY ++GDP +AR AS+  RY  ++L GII D+H LS  D
Sbjct:   448 RRIFLASDDAQVIEEARRKYPQYQIIGDPEVARMASVSTRYTDTALNGIILDIHLLSMSD 507

Query:   656 HLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFG 694
             HLVCTFSSQ+CR AYE M   +PDA+ R++SLDDIYY+G
Sbjct:   508 HLVCTFSSQVCRVAYEIMQTMYPDAAHRFKSLDDIYYYG 546


GO:0008424 "glycoprotein 6-alpha-L-fucosyltransferase activity" evidence=ISS
GO:0006486 "protein glycosylation" evidence=ISS
GO:0030173 "integral to Golgi membrane" evidence=ISS
GO:0046702 "galactoside 6-L-fucosyltransferase activity" evidence=NAS
GO:0008417 "fucosyltransferase activity" evidence=NAS
GO:0046921 "alpha-(1->6)-fucosyltransferase activity" evidence=ISS;IDA
GO:0033578 "protein glycosylation in Golgi" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0032580 "Golgi cisterna membrane" evidence=IEA
UNIPROTKB|F1SA54 FUT8 "Alpha-(1,6)-fucosyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031118-20 fut8 "fucosyltransferase 8 (alpha (1,6) fucosyltransferase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4H9 LOC100851836 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZQ9 FUT8 "Alpha-(1,6)-fucosyltransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1303096 Fut8 "fucosyltransferase 8 (alpha (1,6) fucosyltransferase)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6EV76 Fut8 "Alpha-(1,6)-fucosyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P79282 FUT8 "Alpha-(1,6)-fucosyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N0W2 FUT8 "Alpha-(1,6)-fucosyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BYC5 FUT8 "Alpha-(1,6)-fucosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VYV5FUT8_DROME2, ., 4, ., 1, ., 6, 80.53680.43750.6397yesN/A
Q9WTS2FUT8_MOUSE2, ., 4, ., 1, ., 6, 80.50340.43750.6886yesN/A
Q5NVB3FUT8_PONAB2, ., 4, ., 1, ., 6, 80.50110.43640.6881yesN/A
Q6EV77FUT8_PANTR2, ., 4, ., 1, ., 6, 80.50110.43750.6886yesN/A
Q6EV76FUT8_RAT2, ., 4, ., 1, ., 6, 80.50340.43750.6886yesN/A
Q9BYC5FUT8_HUMAN2, ., 4, ., 1, ., 6, 80.50110.43750.6886yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.766
4th Layer2.4.1.680.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query905
cd11300328 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase 1e-175
cd11300328 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase 1e-127
cd1179255 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1 9e-25
cd1179255 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1 8e-24
cd11548287 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase s 5e-13
cd11296206 cd11296, O-FucT_like, GDP-fucose protein O-fucosyl 4e-08
cd11548287 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase s 3e-06
cd11296206 cd11296, O-FucT_like, GDP-fucose protein O-fucosyl 8e-05
cd1178455 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain 3e-04
cd1180155 cd11801, SH3_JIP1_like, Src homology 3 domain of J 7e-04
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 8e-04
cd11301265 cd11301, Fut1_Fut2_like, Alpha-1,2-fucosyltransfer 0.001
cd1180155 cd11801, SH3_JIP1_like, Src homology 3 domain of J 0.002
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 0.002
cd1194255 cd11942, SH3_JIP2, Src homology 3 domain of JNK-in 0.003
>gnl|CDD|211386 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase Back     alignment and domain information
 Score =  510 bits (1315), Expect = e-175
 Identities = 193/328 (58%), Positives = 237/328 (72%), Gaps = 5/328 (1%)

Query: 371 DSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIV 430
           D   +WR KE   LS LVQ+R+  LQNP DC  A+KLVC LNKGCG+GCQLHHVVYC IV
Sbjct: 1   DGDSEWRRKELKKLSKLVQKRIHKLQNPKDCSKAKKLVCNLNKGCGFGCQLHHVVYCLIV 60

Query: 431 AYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGW---PGNNDTQVIYLPI 487
           AY T RTLILDSK W YS GGWE+VF P+S+TCT   G + + W   P N+D QV+ LPI
Sbjct: 61  AYGTNRTLILDSKGWRYSPGGWEKVFLPLSETCTDRSGDNTAVWWWEPTNSDVQVVKLPI 120

Query: 488 IEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKI 547
           I+ ++ RPP+LPLA+PEDL  RL RLHGDP VWWIGQ L +L  P P  ++ + +  +++
Sbjct: 121 IDSLHSRPPFLPLAVPEDLAERLERLHGDPRVWWIGQLLKYLMRPQPWLQDEIDEAKKEL 180

Query: 548 KFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQ--TVDVKRVYVATDDA 605
            F+ PIVG+HIRRTDK+ TEAA H +EEYM  VEE+Y +  L        +RVY+ATDD 
Sbjct: 181 GFKHPIVGVHIRRTDKLGTEAAFHSLEEYMEHVEEWYDKYELRGPSEKVKRRVYLATDDP 240

Query: 606 SVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQI 665
           SV  E + KYP Y  +GDP I+++ASL  RY  SSL GII D+H LS CD+LVCTFSSQ+
Sbjct: 241 SVFDEAKNKYPNYFFIGDPGISKSASLSTRYSDSSLKGIIIDIHLLSECDYLVCTFSSQV 300

Query: 666 CRTAYEQMNAKFPDASDRYRSLDDIYYF 693
           CR AYE M  + PDASDR+ SLDDIYY+
Sbjct: 301 CRLAYELMQTRHPDASDRFHSLDDIYYY 328


Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. Length = 328

>gnl|CDD|211386 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase Back     alignment and domain information
>gnl|CDD|212726 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1,6-fucosyltransferase (Fut8) Back     alignment and domain information
>gnl|CDD|212726 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1,6-fucosyltransferase (Fut8) Back     alignment and domain information
>gnl|CDD|211389 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ Back     alignment and domain information
>gnl|CDD|211383 cd11296, O-FucT_like, GDP-fucose protein O-fucosyltransferase and related proteins Back     alignment and domain information
>gnl|CDD|211389 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ Back     alignment and domain information
>gnl|CDD|211383 cd11296, O-FucT_like, GDP-fucose protein O-fucosyltransferase and related proteins Back     alignment and domain information
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|211387 cd11301, Fut1_Fut2_like, Alpha-1,2-fucosyltransferase Back     alignment and domain information
>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting protein 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 905
KOG3705|consensus580 100.0
KOG3705|consensus580 100.0
KOG4225|consensus489 99.98
PF05830321 NodZ: Nodulation protein Z (NodZ); InterPro: IPR00 99.91
KOG4348|consensus 627 99.87
KOG4348|consensus 627 99.86
KOG1029|consensus1118 99.73
KOG4226|consensus379 99.56
KOG4225|consensus489 99.55
KOG1029|consensus 1118 99.49
KOG4226|consensus 379 99.47
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.38
PF05830321 NodZ: Nodulation protein Z (NodZ); InterPro: IPR00 99.24
PF03254476 XG_FTase: Xyloglucan fucosyltransferase; InterPro: 99.18
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.09
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.08
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.01
PF10250351 O-FucT: GDP-fucose protein O-fucosyltransferase; I 98.95
PF01531298 Glyco_transf_11: Glycosyl transferase family 11; I 98.91
KOG1118|consensus366 98.87
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.85
KOG3775|consensus 482 98.83
KOG2199|consensus 462 98.82
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.81
KOG2996|consensus865 98.8
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.77
KOG3632|consensus1335 98.74
KOG0162|consensus1106 98.58
KOG3601|consensus222 98.57
KOG4792|consensus293 98.54
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.53
KOG1702|consensus264 98.5
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.41
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.4
KOG2070|consensus 661 98.35
KOG2856|consensus472 98.34
KOG2546|consensus483 98.14
KOG2070|consensus 661 97.96
KOG2199|consensus462 97.92
KOG1118|consensus366 97.88
KOG3775|consensus482 97.85
KOG3655|consensus484 97.75
KOG1702|consensus264 97.73
KOG4773|consensus 386 97.71
KOG2856|consensus472 97.66
KOG3875|consensus362 97.66
KOG0162|consensus1106 97.54
KOG1264|consensus 1267 97.52
PF10250351 O-FucT: GDP-fucose protein O-fucosyltransferase; I 97.38
KOG3523|consensus695 97.36
KOG3601|consensus222 97.18
KOG2996|consensus865 97.03
KOG4792|consensus293 97.02
PF01531298 Glyco_transf_11: Glycosyl transferase family 11; I 96.95
KOG3565|consensus640 96.92
KOG3849|consensus386 96.72
KOG1843|consensus473 96.7
KOG2528|consensus 490 96.63
KOG4429|consensus421 96.6
KOG4575|consensus 874 96.3
KOG2546|consensus483 96.26
KOG1264|consensus 1267 96.09
KOG3523|consensus695 96.03
KOG0199|consensus 1039 95.89
KOG3655|consensus484 95.86
KOG0515|consensus752 95.63
KOG3875|consensus362 95.57
PF03254476 XG_FTase: Xyloglucan fucosyltransferase; InterPro: 95.5
KOG3632|consensus1335 95.44
KOG2528|consensus 490 95.27
KOG3849|consensus386 95.17
KOG0197|consensus 468 94.94
KOG1451|consensus812 94.48
KOG1451|consensus812 93.72
KOG3565|consensus640 93.15
KOG4773|consensus386 92.98
KOG0199|consensus 1039 92.89
KOG3771|consensus460 92.67
KOG0609|consensus 542 92.51
KOG2222|consensus 848 91.92
KOG3725|consensus375 91.84
KOG3771|consensus460 91.7
KOG1843|consensus473 91.46
KOG3725|consensus375 89.78
KOG4278|consensus 1157 88.72
KOG3557|consensus 721 88.09
KOG4278|consensus 1157 86.29
KOG0197|consensus 468 83.46
KOG4575|consensus 874 81.94
>KOG3705|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-127  Score=1027.31  Aligned_cols=455  Identities=53%  Similarity=0.973  Sum_probs=434.0

Q ss_pred             hhHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhccCchhhhHHHHHHHHhhHHHHHHHHHHHHHhhccCCCchhhhhhhhh
Q psy16352         48 IQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLD  127 (905)
Q Consensus        48 ~~~e~~rr~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~sl~~~~~~l~~~~~~~~w~~~e~~~  127 (905)
                      .+||.+||||+++++|||||++|||.|+|+..   ..++..+.+.+|-++++|++|||.|+..|++.||+++||.+|+..
T Consensus       116 ~dhE~~rRri~~~i~E~w~fl~Sel~kvr~~~---~~dl~e~~~~~LL~~~~h~rSlm~d~~~l~q~dG~e~wR~Kea~d  192 (580)
T KOG3705|consen  116 VDHEVQRRRIDDRIREMWYFLHSELGKVRKAA---SADLIENSTKILLETAEHMRSLMGDSAQLEQLDGSEEWRFKEATD  192 (580)
T ss_pred             ccHHHHHHHHHhhHHHHHHHHHHHHHHHhhhh---hhhHHhhHHHHHHhhHHHHHHHHhHHHHHHhccCcHHHHHhHHhH
Confidence            58999999999999999999999999998863   458889999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhhcCCCCCCCCCCeEEEEecCCccchhHHHHHHHHHHHHHhcCcEEEEcCCCCCCCCCCcccccccCCCCC
Q psy16352        128 LSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTC  207 (905)
Q Consensus       128 Lt~~vQ~~I~~~QNP~dC~~Ak~L~c~~~~~cGfGc~lH~~~~cl~~A~~~nRtli~d~~~~~Y~~~~w~~~F~P~S~~C  207 (905)
                      ||++|||||+++|||+||++||+|||+++++||||||+||++|||++||+|.||||+.+.+|.|+.|||+++|+|+|++|
T Consensus       193 lt~lvqrri~~LQNPkdCs~AkkLVCnlnKgCGyGCQLHHVvYCfi~AyaTqRtliLks~gWrY~~gGWe~VF~pvS~~c  272 (580)
T KOG3705|consen  193 LTQLVQRRIEKLQNPKDCSEAKKLVCNLNKGCGYGCQLHHVVYCFITAYATQRTLILKSDGWRYSSGGWESVFKPVSKCC  272 (580)
T ss_pred             HHHHHHHHHHHhcChHhhHHHhhheeeccCCcccccceeeeeEeeeeeeecceEEEEecCCceecCCChhhhhhhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCC--CCcceEEeccccccCCCCCCCCCCCCcchhHHHhhhcCCCchhHHHHHHHHHhCCChhHHHHHH
Q psy16352        208 TSPEGVSNSSWPGN--NDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVA  285 (905)
Q Consensus       208 ~~~~~~~~~~w~~~--~~~~vv~~pi~~~~~~~~~f~p~~~p~~l~~~l~~~h~~P~~Ww~GQ~~~YL~RP~~~~~~~i~  285 (905)
                      .+..+.+..+||+.  ++++|+.+||+|++.++|||+|+++|+||+++|.++||+|.+||+||+++|||||||+++++|+
T Consensus       273 ~D~~~~nT~~wpg~~~~n~qVv~LpIvDSL~prPpyLPlAVPEdLa~rL~rlHgdP~vwwVgqFikYL~Rpqp~t~~~l~  352 (580)
T KOG3705|consen  273 FDEAVGNTEAWPGAEPSNAQVVSLPIVDSLIPRPPYLPLAVPEDLAERLTRLHGDPPVWWVGQFIKYLMRPQPATQEKLD  352 (580)
T ss_pred             cccccccccCCCCCCCCCceEEEeecccccCCCCCCccccCcHHHHHHHHHhcCCCceeeHHHHHHHHhCCChhhHHHHH
Confidence            99998888999985  4889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcCCCCCeeeeeeeecccccccccCCChHHHHHHHHHHHHHHhccCCCceeEEEEEecchhhhhHHHHhhhhhhhh
Q psy16352        286 KYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLG  365 (905)
Q Consensus       286 ~~~~~l~f~~PiVgvHVRrtDK~~~Ea~~~~leeYM~~v~~~~~~~~~~~~~~~~ri~LaTDd~~vi~EakekSL~~Dle  365 (905)
                      ++.++++|.+||||||||||||++|||+||++||||++||.||+.++                                 
T Consensus       353 ~a~k~lg~~~PivGvhvRRTDKVGTEAAfH~~eEYM~~vE~~f~~le---------------------------------  399 (580)
T KOG3705|consen  353 KALKSLGLDKPIVGVHVRRTDKVGTEAAFHALEEYMEWVEIWFKVLE---------------------------------  399 (580)
T ss_pred             HHHHhCCCCCceeeEEEEecccccchhhhhhHHHHHHHHHHHHHHHH---------------------------------
Confidence            99999999999999999999999999999999999999999986210                                 


Q ss_pred             hhccCCchhhhhHhhhhhhHHHHHHHHHhhcCCCCccccceEEEeccCCcchHHHHHHHHHHHHHHHHcCcEEEEecCCC
Q psy16352        366 ILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEW  445 (905)
Q Consensus       366 ~L~~~d~~~~wr~~~~~~l~~~vq~~I~~~QNP~dCs~AK~Lvc~l~~~~GfG~~lh~l~~cL~lA~~t~RtLivd~~~w  445 (905)
                                                                   .                                  
T Consensus       400 ---------------------------------------------~----------------------------------  400 (580)
T KOG3705|consen  400 ---------------------------------------------K----------------------------------  400 (580)
T ss_pred             ---------------------------------------------H----------------------------------
Confidence                                                         0                                  


Q ss_pred             cccCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCeEEeceeeecCCCCCCCCCCCCCCchhHHhhhcCCchHHHHHHH
Q psy16352        446 SYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQF  525 (905)
Q Consensus       446 ~Y~~~gw~~~F~P~S~~C~~~~~~~~~~W~~~~~~~vv~~pii~~~~~~~~f~p~~vP~~l~~~L~~~h~~p~~Ww~gq~  525 (905)
                                                                                                      
T Consensus       401 --------------------------------------------------------------------------------  400 (580)
T KOG3705|consen  401 --------------------------------------------------------------------------------  400 (580)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhccCChhHHHHHHHHhhhccCCCCcceeEEecCCCCCccccccChHHHHHHHHHHHHHHhccCCCCcceEEEEcCCH
Q psy16352        526 LTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDA  605 (905)
Q Consensus       526 ~~YLlRP~~~~~~~I~~~~~~l~f~~PiVGVHIRrgDK~~~Ea~~~~l~eYm~~ve~~~~~~~~~~~~~~~~IfLATDDp  605 (905)
                                                        || |                             ...+|||||||||
T Consensus       401 ----------------------------------rg-~-----------------------------~~~rRiflAsDDp  416 (580)
T KOG3705|consen  401 ----------------------------------RG-K-----------------------------PLERRIFLASDDP  416 (580)
T ss_pred             ----------------------------------hC-C-----------------------------chhheEEEecCCc
Confidence                                              00 0                             0236999999999


Q ss_pred             HHHHHHHhhCCCcEEEcCCcccccccccccchhhhhhHHHHHHHHHhcCCeEEEcccCcHhHHHHHHHhccCCCceeecc
Q psy16352        606 SVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYR  685 (905)
Q Consensus       606 ~Vi~e~k~~yp~y~~i~~~~~~~~a~~~~R~s~~~l~~~l~Dl~lLs~cD~~VgT~SSnv~RLa~eLrqt~~~d~~~~~~  685 (905)
                      .|+.|++.+||+|.||++++++++|++.+||+++++.|+++||++||++||+||||||+|||++||+|||++        
T Consensus       417 ~vv~EAk~kYPnYe~igd~eia~~A~l~nRYTd~sL~GvIlDIh~LS~~d~LVCTFSSQVCRvaYEimQt~~--------  488 (580)
T KOG3705|consen  417 TVVPEAKNKYPNYEVIGDTEIAKTAQLNNRYTDASLMGVILDIHILSKVDYLVCTFSSQVCRVAYEIMQTSG--------  488 (580)
T ss_pred             hhchHhhccCCCcEEeccHHHHHHhhccccchhhhhhheeeeeeeecccceEEEechHHHHHHHHHHHhccC--------
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999        


Q ss_pred             cccccccccCCCceeeeeehhhHhhhhccCCCCCCCeeecccccccCCCcccceeeecCCCCCCCCCccccCCcEEEecc
Q psy16352        686 SLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAG  765 (905)
Q Consensus       686 slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ld~~~~~~~~~~~~~~v~~~~~~~~~~El~l~~GD~I~~~~  765 (905)
                                                    |||+.+|+|||||||||||++|.++|+++|.|++++||+|++||+|+|+|
T Consensus       489 ------------------------------pDa~~~FhSLDDIYYfGGQnAHn~ivi~aH~prt~~ei~l~vGD~vgvAG  538 (580)
T KOG3705|consen  489 ------------------------------PDAGSKFHSLDDIYYFGGQNAHNVIVIEAHIPRTNKEIDLKVGDKVGVAG  538 (580)
T ss_pred             ------------------------------CCcccccccccceeeecCccccceEEEEecCCCcccccCcccCCeeeecc
Confidence                                          99999999999999999999999999999999999999999999999999


Q ss_pred             ccccceeeeeecCCCceeeeeCcccccCC----CCChh
Q psy16352        766 NHWNGYSKGRNLRTDQLALYPTFKTSADS----FPAFA  799 (905)
Q Consensus       766 ~~~~G~~~G~n~~tg~~GlfP~~~v~~~~----~p~~~  799 (905)
                      ||||||++|+|.+|++.|+||+|||++..    +|.|.
T Consensus       539 NHWdGySKG~Nr~t~~~GlfPSyKvrek~~t~k~ply~  576 (580)
T KOG3705|consen  539 NHWDGYSKGTNRQTYKEGLFPSYKVREKFITIKIPLYV  576 (580)
T ss_pred             cccccccccccccccccCCCccceeeeeEEEeeecchh
Confidence            99999999999999999999999999764    55543



>KOG3705|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>PF05830 NodZ: Nodulation protein Z (NodZ); InterPro: IPR008716 The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF05830 NodZ: Nodulation protein Z (NodZ); InterPro: IPR008716 The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation Back     alignment and domain information
>PF03254 XG_FTase: Xyloglucan fucosyltransferase; InterPro: IPR004938 Plant cell walls are crucial for development, signal transduction, and disease resistance in plants Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF10250 O-FucT: GDP-fucose protein O-fucosyltransferase; InterPro: IPR019378 This is a family of conserved proteins representing the enzyme responsible for adding O-fucose to EGF (epidermal growth factor-like) repeats Back     alignment and domain information
>PF01531 Glyco_transf_11: Glycosyl transferase family 11; InterPro: IPR002516 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PF10250 O-FucT: GDP-fucose protein O-fucosyltransferase; InterPro: IPR019378 This is a family of conserved proteins representing the enzyme responsible for adding O-fucose to EGF (epidermal growth factor-like) repeats Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PF01531 Glyco_transf_11: Glycosyl transferase family 11; InterPro: IPR002516 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG3849|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>PF03254 XG_FTase: Xyloglucan fucosyltransferase; InterPro: IPR004938 Plant cell walls are crucial for development, signal transduction, and disease resistance in plants Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG3849|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query905
2de0_X526 Crystal Structure Of Human Alpha 1,6-fucosyltransfe 1e-129
2de0_X526 Crystal Structure Of Human Alpha 1,6-fucosyltransfe 2e-13
>pdb|2DE0|X Chain X, Crystal Structure Of Human Alpha 1,6-fucosyltransferase, Fut8 Length = 526 Back     alignment and structure

Iteration: 1

Score = 459 bits (1181), Expect = e-129, Method: Compositional matrix adjust. Identities = 219/437 (50%), Positives = 287/437 (65%), Gaps = 41/437 (9%) Query: 357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416 E+S++ L L D DWR KE+ DL++LVQRR+ YLQNP DC A+KLVC +NKGCG Sbjct: 98 ERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCG 157 Query: 417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPG 476 YGCQLHHVVYCF++AY T+RTLIL+S+ W Y+ GGWE VF+PVS+TCT G+S W G Sbjct: 158 YGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSG 217 Query: 477 ---NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPT 533 + + QV+ LPI++ ++PRPPYLPLA+PEDL RL R+HGDP VWW+ QF+ +L P Sbjct: 218 EVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQ 277 Query: 534 PNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTV 593 P + + + +K+ F+ P++G+H+RRTDKV TEAA HP+EEYM VEE+++ LA V Sbjct: 278 PWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQV 337 Query: 594 DVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSN 653 D KRVY+ATDD S+L E + KYP Y + D SI+ +A L +RY ++SL G+I D+H+LS Sbjct: 338 DKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQ 397 Query: 654 CDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNA 713 D LVCTFSSQ+CR AYE M PDAS + SLDDIYY Sbjct: 398 ADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYY--------------------- 436 Query: 714 KFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSK 773 FGGQ + IA+ H PR + E+ + GD I VAGNHW+GYSK Sbjct: 437 -----------------FGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSK 479 Query: 774 GRNLRTDQLALYPTFKT 790 G N + + LYP++K Sbjct: 480 GVNRKLGRTGLYPSYKV 496
>pdb|2DE0|X Chain X, Crystal Structure Of Human Alpha 1,6-fucosyltransferase, Fut8 Length = 526 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query905
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 1e-136
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 1e-108
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 4e-18
2hhc_A330 NODZ, nodulation fucosyltransferase NODZ; glycosyl 2e-55
2hhc_A330 NODZ, nodulation fucosyltransferase NODZ; glycosyl 5e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 7e-06
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 1e-05
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 2e-04
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 6e-04
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
 Score =  416 bits (1069), Expect = e-136
 Identities = 222/466 (47%), Positives = 291/466 (62%), Gaps = 41/466 (8%)

Query: 356 REKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGC 415
            E+S++  L  L   D   DWR KE+ DL++LVQRR+ YLQNP DC  A+KLVC +NKGC
Sbjct: 97  HERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGC 156

Query: 416 GYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWP 475
           GYGCQLHHVVYCF++AY T+RTLIL+S+ W Y+ GGWE VF+PVS+TCT   G+S   W 
Sbjct: 157 GYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWS 216

Query: 476 G---NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNP 532
           G   + + QV+ LPI++ ++PRPPYLPLA+PEDL  RL R+HGDP VWW+ QF+ +L  P
Sbjct: 217 GEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRP 276

Query: 533 TPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQT 592
            P   + + +  +K+ F+ P++G+H+RRTDKV TEAA HP+EEYM  VEE+++ LA    
Sbjct: 277 QPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQ 336

Query: 593 VDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLS 652
           VD KRVY+ATDD S+L E + KYP Y  + D SI+ +A L +RY ++SL G+I D+H+LS
Sbjct: 337 VDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLS 396

Query: 653 NCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMN 712
             D LVCTFSSQ                                      +CR AYE M 
Sbjct: 397 QADFLVCTFSSQ--------------------------------------VCRVAYEIMQ 418

Query: 713 AKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYS 772
              PDAS  + SLDDIYYFGGQ +   IA+  H PR + E+ +  GD I VAGNHW+GYS
Sbjct: 419 TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYS 478

Query: 773 KGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSS 818
           KG N +  +  LYP++K            +     A   H   H  
Sbjct: 479 KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEKAGGGHHHHHHG 524


>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Length = 330 Back     alignment and structure
>2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Length = 330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query905
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 100.0
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 100.0
2hhc_A330 NODZ, nodulation fucosyltransferase NODZ; glycosyl 99.9
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.8
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.78
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.75
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.73
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.57
2hhc_A330 NODZ, nodulation fucosyltransferase NODZ; glycosyl 99.72
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.59
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.54
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.49
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.47
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.47
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.45
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.42
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.41
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.41
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.41
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.4
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.4
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.4
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.37
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.37
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.37
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.36
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.35
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.35
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.35
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.35
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.35
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.35
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.34
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.34
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.33
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.33
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.33
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.33
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.33
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.33
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.33
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.33
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.32
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.32
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.32
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.32
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.31
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.31
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.31
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.31
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.31
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.31
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.31
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.3
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.3
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.3
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.3
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.3
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.3
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.3
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.29
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.29
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.29
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.29
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.29
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.29
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.29
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.29
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.28
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.28
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.28
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.28
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.28
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.28
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.28
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.28
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.27
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.27
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.27
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.27
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.27
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.27
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.27
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.27
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.27
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.27
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.26
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.26
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.26
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.26
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.26
1i07_A60 Epidermal growth factor receptor kinase substrate 99.26
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.26
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.26
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.26
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.26
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.26
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.26
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.26
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.25
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.25
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.25
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.25
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.25
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.25
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.25
3u23_A65 CD2-associated protein; structural genomics, struc 99.25
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.25
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.24
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.24
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.24
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.24
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.24
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.24
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.24
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.24
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.24
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.24
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.24
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.23
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.23
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.23
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.23
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.23
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.23
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.23
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.22
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.22
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.22
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.22
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.22
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.22
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.22
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.22
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.22
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.22
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.22
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.22
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.21
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.21
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.21
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.21
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.21
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.21
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.21
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.21
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.21
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.21
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.21
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.2
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.2
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.2
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.2
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.2
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.2
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.19
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.19
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.19
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.18
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.18
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.18
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.18
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.17
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.17
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.17
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.17
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.17
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.16
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.16
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.15
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.14
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.14
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.14
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.13
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.13
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.12
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.1
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.09
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.08
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.07
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.06
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.06
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.04
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.02
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.02
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.02
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.02
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.02
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.01
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 98.99
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 98.98
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 98.97
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.96
2cuc_A70 SH3 domain containing ring finger 2; structural ge 98.95
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 98.94
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 98.94
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 98.93
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 98.93
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 98.93
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.91
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 98.91
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 98.91
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 98.91
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 98.9
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 98.9
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 98.88
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 98.88
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 98.88
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.88
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 98.87
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.87
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 98.86
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 98.86
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 98.86
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.86
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.86
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 98.86
3zy2_A362 Putative GDP-fucose protein O-fucosyltransferase; 98.86
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 98.85
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.85
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 98.85
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 98.84
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 98.84
1uti_A58 GRB2-related adaptor protein 2; signaling protein 98.84
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 98.84
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 98.84
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.84
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 98.84
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 98.83
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 98.83
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.83
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 98.82
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 98.82
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 98.82
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 98.82
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 98.81
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.81
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 98.81
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 98.81
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 98.81
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 98.81
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 98.8
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.8
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 98.8
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 98.8
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 98.8
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 98.8
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 98.8
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 98.8
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 98.79
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 98.79
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 98.79
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 98.78
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 98.78
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 98.78
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 98.77
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 98.77
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.77
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 98.77
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 98.77
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 98.77
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 98.77
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.76
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.76
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 98.76
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 98.76
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.76
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 98.75
1i07_A60 Epidermal growth factor receptor kinase substrate 98.75
2dil_A69 Proline-serine-threonine phosphatase-interacting p 98.75
2j6f_A62 CD2-associated protein; metal-binding, immune resp 98.75
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.75
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 98.74
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 98.74
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 98.74
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 98.74
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.74
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.74
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.73
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.72
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 98.72
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 98.72
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 98.72
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 98.72
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 98.71
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 98.71
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.71
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 98.71
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 98.71
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 98.71
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.7
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.7
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 98.7
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.7
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.16
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.7
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 98.7
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 98.69
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.69
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 98.69
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 98.69
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 98.69
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 98.69
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 98.69
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 98.68
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 98.68
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 98.68
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 98.68
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 98.68
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 98.68
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 98.68
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 98.67
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.67
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.67
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 98.67
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.67
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.66
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 98.66
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.66
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 98.65
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 98.65
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.65
3u23_A65 CD2-associated protein; structural genomics, struc 98.65
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 98.63
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 98.63
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 98.63
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 98.63
1awj_A77 ITK; transferase, regulatory intramolecular comple 98.63
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.63
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 98.62
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.62
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.62
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.61
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 98.61
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.61
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 98.61
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.61
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.61
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 98.61
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.6
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 98.6
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 98.6
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 98.6
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.6
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.59
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.59
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 98.59
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.59
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 98.58
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 98.58
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 98.58
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 98.57
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.57
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 98.57
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 98.57
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.57
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.57
4ap5_A408 GDP-fucose protein O-fucosyltransferase 2; GT-B, G 98.56
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.56
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 98.56
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.55
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 98.55
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 98.55
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 98.53
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 98.52
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.51
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 98.51
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 98.51
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.45
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.44
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.43
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.37
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.37
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.33
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.33
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.32
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.31
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.25
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.21
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.13
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.03
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.02
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.01
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 97.98
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.97
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 97.85
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.85
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.81
1u3o_A82 Huntingtin-associated protein-interacting protein; 97.78
3zy2_A362 Putative GDP-fucose protein O-fucosyltransferase; 97.77
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 97.76
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 97.72
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 97.53
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.52
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 97.47
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 97.38
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.37
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.35
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 97.33
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 97.33
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.23
4ap5_A408 GDP-fucose protein O-fucosyltransferase 2; GT-B, G 97.19
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 96.97
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 96.85
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.85
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 96.84
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 96.73
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 96.09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.91
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 95.79
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 95.26
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 95.22
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 95.1
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 95.06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 94.53
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 94.26
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 94.17
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 92.17
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 85.56
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 83.84
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.5e-94  Score=836.26  Aligned_cols=470  Identities=50%  Similarity=0.948  Sum_probs=413.2

Q ss_pred             hhhhhccccccccccCCCCChhHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhccCchhhhHHHHHHHHhhHHHHHHHHHH
Q psy16352         28 LTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHV  107 (905)
Q Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~e~~rr~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~sl~~~  107 (905)
                      +++.+-...+++..+.+||+++||++|||++++++|||||++++|.||++   .+++++.+.+++++.++++|++||++|
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~e~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~l~~~  104 (526)
T 2de0_X           28 LVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKN---LEGNELQRHADEFLLDLGHHERSIMTD  104 (526)
T ss_dssp             ------------------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT---CCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HhhhhhhhhHHhcccCCCCChHHHHHHHHHHHhHHHHHHHHHHHHHHhhc---cCchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444446788899999999999999999999999999999999999866   246799999999999999999999999


Q ss_pred             HHHhhccCCCchhhhhhhhhhHHHHHHHHhhcCCCCCCCCCCeEEEEecCCccchhHHHHHHHHHHHHHhcCcEEEEcCC
Q psy16352        108 LDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSK  187 (905)
Q Consensus       108 ~~~l~~~~~~~~w~~~e~~~Lt~~vQ~~I~~~QNP~dC~~Ak~L~c~~~~~cGfGc~lH~~~~cl~~A~~~nRtli~d~~  187 (905)
                      +++|++.||+.+||.+++++||++||++|+.+|||+||++||+|+|+++.+|||||+||++++||.+|+++|||||+|++
T Consensus       105 ~~~l~~~~g~~~~r~~~~~~lt~~vq~~i~~~QnP~~Cs~aK~Lv~~~~~~~GfGs~lh~l~~~L~~A~~~~Rtliidd~  184 (526)
T 2de0_X          105 LYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQ  184 (526)
T ss_dssp             HHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHCCSCGGGSCEEEEECCCSSCHHHHHHHHHHHHHHHHHHTCEEEEECT
T ss_pred             HHHHHhhhchhHHHHHHHHHHHHHHHHHHHHhcCCCcCCCCCEEEEEecCCCchHHHHHHHHHHHHHHHhhCCEEEEECC
Confidence            99999999999999999999999999999999999999999999999988999999999999999999999999999999


Q ss_pred             CCCCCCCCcccccccCCCCCCCCCCCCCCCCCCC---CCcceEEeccccccCCCCCCCCCCCCcchhHHHhhhcCCCchh
Q psy16352        188 EWSYSRGGWEEVFQPVSKTCTSPEGVSNSSWPGN---NDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVW  264 (905)
Q Consensus       188 ~~~Y~~~~w~~~F~P~S~~C~~~~~~~~~~w~~~---~~~~vv~~pi~~~~~~~~~f~p~~~p~~l~~~l~~~h~~P~~W  264 (905)
                      +|.|++|+|+|||+|+|++|..+.......|++.   .+++||.+|+++..++.++|.|+++|+++.++|.++|++|.+|
T Consensus       185 ~w~Y~~g~w~~yF~P~s~~C~~~~~~~~~~w~~~~~~~~~~vV~~~~i~~~~~~~~~~~~~~P~~~~~~L~~l~~dp~~w  264 (526)
T 2de0_X          185 NWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVW  264 (526)
T ss_dssp             TCSSCTTCGGGTBCCSCSSCCCCCCSCCCBCCCTTGGGGCSEEEECCGGGCSSCCSCCTTCEEGGGHHHHHHHCSCHHHH
T ss_pred             CCCcCCCCHHHhhhCcCccccCCCccccCCCCCcccCCCcceEEeeccccccccccccccccchhHHHHHHhccCCcHHH
Confidence            9999999999999999999999877777899985   3788999999988888899999999999999999999999999


Q ss_pred             HHHHHHHHHhCCChhHHHHHHHHhhhcCCCCCeeeeeeeecccccccccCCChHHHHHHHHHHHHHHhccCCCceeEEEE
Q psy16352        265 WIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYV  344 (905)
Q Consensus       265 w~GQ~~~YL~RP~~~~~~~i~~~~~~l~f~~PiVgvHVRrtDK~~~Ea~~~~leeYM~~v~~~~~~~~~~~~~~~~ri~L  344 (905)
                      |+||+++|||||+++++++|++.+++++|+.|+||||||||||+..|+.++++++||++|++                  
T Consensus       265 ~~~q~~~yl~rP~~~i~~~I~~~~~~l~~~~piVGVHIRrGDk~~~E~~~~~~~~Y~~~v~~------------------  326 (526)
T 2de0_X          265 WVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEE------------------  326 (526)
T ss_dssp             HHHHHHHHHTCBCHHHHHHHHHHHHHHTCCSSEEEEEECCC-----CCCSCSHHHHHHHHHH------------------
T ss_pred             HHHHHHHHHcCCCHHHHHHHHHHHHHhCCCCCEEEEEEeCCCCCccccccCCHHHHHHHHHH------------------
Confidence            99999999999999999999999999887788888888888887668888888877755541                  


Q ss_pred             EecchhhhhHHHHhhhhhhhhhhccCCchhhhhHhhhhhhHHHHHHHHHhhcCCCCccccceEEEeccCCcchHHHHHHH
Q psy16352        345 ATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHV  424 (905)
Q Consensus       345 aTDd~~vi~EakekSL~~Dle~L~~~d~~~~wr~~~~~~l~~~vq~~I~~~QNP~dCs~AK~Lvc~l~~~~GfG~~lh~l  424 (905)
                                                                                                      
T Consensus       327 --------------------------------------------------------------------------------  326 (526)
T 2de0_X          327 --------------------------------------------------------------------------------  326 (526)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHcCcEEEEecCCCcccCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCeEEeceeeecCCCCCCCCCCCCC
Q psy16352        425 VYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPE  504 (905)
Q Consensus       425 ~~cL~lA~~t~RtLivd~~~w~Y~~~gw~~~F~P~S~~C~~~~~~~~~~W~~~~~~~vv~~pii~~~~~~~~f~p~~vP~  504 (905)
                                                                                                      
T Consensus       327 --------------------------------------------------------------------------------  326 (526)
T 2de0_X          327 --------------------------------------------------------------------------------  326 (526)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CchhHHhhhcCCchHHHHHHHhhhhccCChhHHHHHHHHhhhccCCCCcceeEEecCCCCCccccccChHHHHHHHHHHH
Q psy16352        505 DLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYY  584 (905)
Q Consensus       505 ~l~~~L~~~h~~p~~Ww~gq~~~YLlRP~~~~~~~I~~~~~~l~f~~PiVGVHIRrgDK~~~Ea~~~~l~eYm~~ve~~~  584 (905)
                                                                                                    |+
T Consensus       327 ------------------------------------------------------------------------------~~  328 (526)
T 2de0_X          327 ------------------------------------------------------------------------------HF  328 (526)
T ss_dssp             ------------------------------------------------------------------------------HH
T ss_pred             ------------------------------------------------------------------------------HH
Confidence                                                                                          11


Q ss_pred             HHHhccCCCCcceEEEEcCCHHHHHHHHhhCCCcEEEcCCcccccccccccchhhhhhHHHHHHHHHhcCCeEEEcccCc
Q psy16352        585 KQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQ  664 (905)
Q Consensus       585 ~~~~~~~~~~~~~IfLATDDp~Vi~e~k~~yp~y~~i~~~~~~~~a~~~~R~s~~~l~~~l~Dl~lLs~cD~~VgT~SSn  664 (905)
                      +.+.........+||||||||+|+++++++||+|+|++++.+..++++.+|++.+++.++++||++||+||+||||+|||
T Consensus       329 ~~l~~~~~~~~~~ifLATDDp~v~~e~k~~~p~~~~~~d~~~~~~a~~~~R~s~~~l~~~l~DL~lLs~cd~~Vgt~sS~  408 (526)
T 2de0_X          329 QLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQ  408 (526)
T ss_dssp             HHHHTTSCCSSCEEEEEESCHHHHHHHHHHCTTSEEECCCCSSCSSGGGGGTCCTHHHHHHHHHHHHHHSSEEEECTTSH
T ss_pred             HHHHhhcCCCCCeEEEEcCCHHHHHHHHHhCCCCEEecCcccccccCccccccHHHHHHHHHHHHHHhcCCeeecCCCCH
Confidence            11111112356899999999999999999999999999987777777888999999999999999999999999999999


Q ss_pred             HhHHHHHHHhccCCCceeecccccccccccCCCceeeeeehhhHhhhhccCCCCCCCeeecccccccCCCcccceeeecC
Q psy16352        665 ICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLP  744 (905)
Q Consensus       665 v~RLa~eLrqt~~~d~~~~~~slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ld~~~~~~~~~~~~~~v~~~  744 (905)
                      |||++++||++.+                                      |++...+.|||++|+||||.....+|+|+
T Consensus       409 ~srla~~l~~~~~--------------------------------------~~~~~~~~SLD~~~~~~Gq~~~~~~aly~  450 (526)
T 2de0_X          409 VCRVAYEIMQTLH--------------------------------------PDASANFHSLDDIYYFGGQNAHNQIAIYA  450 (526)
T ss_dssp             HHHHHHHHHTTSS--------------------------------------SCCTTCEEESSCCSCCTTCCCCEEEECSC
T ss_pred             HHHHHHHHhcCcC--------------------------------------ccccccccCCccccccccccccceEEeec
Confidence            9999999999998                                      89999999999999999999999999999


Q ss_pred             CCCCCCCCccccCCcEEEeccccccceeeeeecCCCceeeeeCcccccCC
Q psy16352        745 HTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADS  794 (905)
Q Consensus       745 ~~~~~~~El~l~~GD~I~~~~~~~~G~~~G~n~~tg~~GlfP~~~v~~~~  794 (905)
                      |+|+++|||+|++||+|.|..++++||++|+|.+||+.|+||++||++..
T Consensus       451 y~a~~~dELs~~~GD~i~v~~~~~~gW~~G~~~~~g~~G~fPsnyV~~~~  500 (526)
T 2de0_X          451 HQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKI  500 (526)
T ss_dssp             BCCSSTTBCCBCTTCEEEEEEECSSSEEEEEETTTTEEEEEEGGGEEECC
T ss_pred             CCCCCCCcCCcCCCCEEEEccccCCCeeEEEeCCCCCEEEECchheeEcc
Confidence            99999999999999999999999999999999999999999999999754



>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3zy2_A Putative GDP-fucose protein O-fucosyltransferase; glycosyltransferase, GT-B, catalytic mechanism,; HET: GDP; 1.54A {Caenorhabditis elegans} PDB: 3zy3_A* 3zy4_A* 3zy5_A* 3zy6_A* Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>4ap5_A GDP-fucose protein O-fucosyltransferase 2; GT-B, GT68; HET: NAG; 3.00A {Homo sapiens} PDB: 4ap6_A* Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3zy2_A Putative GDP-fucose protein O-fucosyltransferase; glycosyltransferase, GT-B, catalytic mechanism,; HET: GDP; 1.54A {Caenorhabditis elegans} PDB: 3zy3_A* 3zy4_A* 3zy5_A* 3zy6_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>4ap5_A GDP-fucose protein O-fucosyltransferase 2; GT-B, GT68; HET: NAG; 3.00A {Homo sapiens} PDB: 4ap6_A* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query905
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.68
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.49
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.48
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.47
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.47
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.46
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.41
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.41
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.4
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.39
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.39
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.36
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.36
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.36
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.36
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.35
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.34
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.34
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.34
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.34
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.32
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.32
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.31
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.3
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.3
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.29
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.28
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.27
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.27
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.27
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.26
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.25
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.24
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.24
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.24
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.23
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.22
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.21
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.19
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.18
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.15
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.15
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.1
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.08
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.08
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.06
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.05
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.05
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.03
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.02
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.0
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.0
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 98.98
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.98
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 98.97
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 98.94
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 98.94
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 98.93
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.93
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 98.92
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 98.91
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 98.91
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 98.89
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.88
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.88
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.86
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.84
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 98.83
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 98.83
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 98.81
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 98.81
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.8
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 98.79
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.79
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.78
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 98.77
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.77
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.77
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.77
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.75
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.72
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.7
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 98.69
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.65
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.6
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.42
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 98.39
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.37
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.37
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 98.3
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 97.99
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 97.4
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Intersectin 2 (KIAA1256)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=1.3e-17  Score=151.01  Aligned_cols=89  Identities=15%  Similarity=0.130  Sum_probs=72.9

Q ss_pred             eeecCCCceeeeeCcccccCCCCC----hhhhhhhhheecccCCCCCCCCccccCCCEEEEeeeeecceecceecCCCce
Q psy16352        774 GRNLRTDQLALYPTFKTSADSFPA----FAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQL  849 (905)
Q Consensus       774 G~n~~tg~~GlfP~~~v~~~~~p~----~~~~~~~~~~a~y~y~~~~~dEL~l~~GD~i~v~~~~~dgw~~G~n~rtg~~  849 (905)
                      |+...+|+.|+||+.+|++...+.    ........++|||+|.|++++||+|++||+|.|+++.++|||.|+.  +|+.
T Consensus         1 g~~~~~G~~G~~P~~yv~~~~~~~~~~~~~~~~~~~~~Alydy~a~~~~ELsf~~Gd~i~Vl~~~~~gWw~g~~--~g~~   78 (98)
T d1udla_           1 GSSGSSGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEI--NGVT   78 (98)
T ss_dssp             CCCCCSSCCSSCCCCCCCCCSCCCCCCCSCCCCSEEEEESSCCCCSSTTSCCCCTTCEEEECBCCSSSEEBCBS--SSCB
T ss_pred             CCcCCCCceeeEcccceeECCCcccccCCCCCCccEEEEccCCCCCCCCEeeEcCCCEEEEeEecCCCeEEEEE--CCeE
Confidence            455578999999999998765322    1222345689999999999999999999999999999999999974  8999


Q ss_pred             eeccCCCceecccCCC
Q psy16352        850 ALYPTFKSVPHVETAR  865 (905)
Q Consensus       850 GlfP~~~v~~v~~~~~  865 (905)
                      |+||+|||+.+ .+.+
T Consensus        79 G~~P~nyVe~~-~~~~   93 (98)
T d1udla_          79 GLFPSNYVKMT-TDSS   93 (98)
T ss_dssp             CCEETTSEEEC-CCCS
T ss_pred             EEEchHHEEEC-CCCC
Confidence            99999999754 4443



>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure