Psyllid ID: psy16352
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 905 | ||||||
| 189236914 | 592 | PREDICTED: similar to alpha-(1,6)-fucosy | 0.449 | 0.687 | 0.543 | 1e-145 | |
| 157118068 | 573 | alpha6-fucosyltransferase, putative [Aed | 0.468 | 0.739 | 0.521 | 1e-144 | |
| 328709459 | 567 | PREDICTED: alpha-(1,6)-fucosyltransferas | 0.437 | 0.698 | 0.576 | 1e-144 | |
| 170044485 | 573 | alpha-(1,6)-fucosyltransferase [Culex qu | 0.458 | 0.724 | 0.523 | 1e-143 | |
| 347966757 | 586 | AGAP001888-PA [Anopheles gambiae str. PE | 0.449 | 0.694 | 0.541 | 1e-143 | |
| 312380130 | 595 | hypothetical protein AND_07861 [Anophele | 0.438 | 0.667 | 0.547 | 1e-141 | |
| 194889456 | 619 | GG18841 [Drosophila erecta] gi|190648738 | 0.437 | 0.639 | 0.536 | 1e-138 | |
| 195355262 | 619 | GM13053 [Drosophila sechellia] gi|194129 | 0.437 | 0.639 | 0.536 | 1e-138 | |
| 18859827 | 619 | alpha1,6-fucosyltransferase [Drosophila | 0.437 | 0.639 | 0.536 | 1e-138 | |
| 195480779 | 619 | FucT6 [Drosophila yakuba] gi|194188912|g | 0.437 | 0.639 | 0.534 | 1e-137 |
| >gi|189236914|ref|XP_969111.2| PREDICTED: similar to alpha-(1,6)-fucosyltransferase [Tribolium castaneum] gi|270006336|gb|EFA02784.1| hypothetical protein TcasGA2_TC008521 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 523 bits (1348), Expect = e-145, Method: Compositional matrix adjust.
Identities = 244/449 (54%), Positives = 310/449 (69%), Gaps = 42/449 (9%)
Query: 357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416
++SLLH + L D + WR KE+ DLS LVQ+R +LQNP DC+TA+KL+C LNKGCG
Sbjct: 171 KRSLLHDIDQLAEVDGYATWREKEANDLSGLVQKRFHFLQNPADCKTAKKLICSLNKGCG 230
Query: 417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPG 476
YGCQLHH VYCF+VAY T+RTLIL SK W Y + GWEE+F+PVS TC P G S S WPG
Sbjct: 231 YGCQLHHAVYCFMVAYGTKRTLILKSKGWRYHKAGWEEIFKPVSDTCVDPSGKSVSNWPG 290
Query: 477 NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNT 536
N++TQV+ LPII+ ++PRPP+LPLAIPEDL PRL+RLHGDPIVWW+GQ L FL P P T
Sbjct: 291 NSETQVVNLPIIDSLSPRPPFLPLAIPEDLAPRLTRLHGDPIVWWVGQILKFLLRPQPQT 350
Query: 537 REIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVK 596
++ + + F++PIVG+H+RRTDKV TEAA H +EEYMT V+EYYK+L L +VD +
Sbjct: 351 AAVMQETMTHMGFKRPIVGVHVRRTDKVGTEAAYHGIEEYMTAVDEYYKELELKTSVDKR 410
Query: 597 RVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDH 656
R+Y+ATDD V+ + + KY Y +LGDPSI++TA++ RY SSL GII D++ L+ D+
Sbjct: 411 RIYLATDDPKVIADAKSKYSHYEILGDPSISKTAAISTRYSDSSLFGIINDINMLAMSDY 470
Query: 657 LVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFP 716
LVCTFSSQ+CR AYE M +PDAS R+RSLDD+Y
Sbjct: 471 LVCTFSSQVCRVAYEIMQTYYPDASSRFRSLDDVY------------------------- 505
Query: 717 DASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYSKGRN 776
Y+GGQ IAVL H PR + EM+++ GD I VAGNHWNG+SKGRN
Sbjct: 506 -------------YYGGQNPHNTIAVLSHEPRKNGEMSVVAGDLIGVAGNHWNGFSKGRN 552
Query: 777 LRTDQLALYPTFKTS----ADSFPAFAYI 801
LRT+Q+ALYP+FK FP +A +
Sbjct: 553 LRTNQIALYPSFKVKDKIETAKFPTYAEV 581
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157118068|ref|XP_001658992.1| alpha6-fucosyltransferase, putative [Aedes aegypti] gi|108875844|gb|EAT40069.1| AAEL008181-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328709459|ref|XP_001947095.2| PREDICTED: alpha-(1,6)-fucosyltransferase-like [Acyrthosiphon pisum] gi|328709468|ref|XP_001951687.2| PREDICTED: alpha-(1,6)-fucosyltransferase-like isoform 1 [Acyrthosiphon pisum] gi|328709470|ref|XP_003243969.1| PREDICTED: alpha-(1,6)-fucosyltransferase-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170044485|ref|XP_001849876.1| alpha-(1,6)-fucosyltransferase [Culex quinquefasciatus] gi|167867616|gb|EDS30999.1| alpha-(1,6)-fucosyltransferase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|347966757|ref|XP_321174.5| AGAP001888-PA [Anopheles gambiae str. PEST] gi|333469912|gb|EAA01061.5| AGAP001888-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312380130|gb|EFR26214.1| hypothetical protein AND_07861 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|194889456|ref|XP_001977089.1| GG18841 [Drosophila erecta] gi|190648738|gb|EDV46016.1| GG18841 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195355262|ref|XP_002044111.1| GM13053 [Drosophila sechellia] gi|194129380|gb|EDW51423.1| GM13053 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|18859827|ref|NP_572740.1| alpha1,6-fucosyltransferase [Drosophila melanogaster] gi|33112303|sp|Q9VYV5.1|FUT8_DROME RecName: Full=Alpha-(1,6)-fucosyltransferase; Short=Alpha1-6FucT; AltName: Full=GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase; AltName: Full=GDP-fucose--glycoprotein fucosyltransferase; AltName: Full=Glycoprotein 6-alpha-L-fucosyltransferase gi|24637307|gb|AAN63649.1|AF441264_1 alpha 1,6 fucosyltransferase [Drosophila melanogaster] gi|7292682|gb|AAF48079.1| alpha1,6-fucosyltransferase [Drosophila melanogaster] gi|15291213|gb|AAK92875.1| GH11963p [Drosophila melanogaster] gi|220945356|gb|ACL85221.1| FucT6-PA [synthetic construct] gi|220955164|gb|ACL90125.1| FucT6-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195480779|ref|XP_002101388.1| FucT6 [Drosophila yakuba] gi|194188912|gb|EDX02496.1| FucT6 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 905 | ||||||
| FB|FBgn0030327 | 619 | FucT6 "alpha1,6-fucosyltransfe | 0.372 | 0.544 | 0.607 | 1.6e-149 | |
| UNIPROTKB|F1SA54 | 575 | FUT8 "Alpha-(1,6)-fucosyltrans | 0.373 | 0.587 | 0.563 | 2.4e-140 | |
| ZFIN|ZDB-GENE-031118-20 | 581 | fut8 "fucosyltransferase 8 (al | 0.374 | 0.583 | 0.570 | 1.3e-139 | |
| UNIPROTKB|F1N4H9 | 575 | LOC100851836 "Uncharacterized | 0.373 | 0.587 | 0.565 | 3.5e-139 | |
| UNIPROTKB|F1PZQ9 | 575 | FUT8 "Alpha-(1,6)-fucosyltrans | 0.373 | 0.587 | 0.563 | 5.6e-139 | |
| RGD|1303096 | 575 | Fut8 "fucosyltransferase 8 (al | 0.373 | 0.587 | 0.565 | 1.2e-138 | |
| UNIPROTKB|Q6EV76 | 575 | Fut8 "Alpha-(1,6)-fucosyltrans | 0.373 | 0.587 | 0.565 | 1.2e-138 | |
| UNIPROTKB|P79282 | 575 | FUT8 "Alpha-(1,6)-fucosyltrans | 0.377 | 0.594 | 0.556 | 1.2e-138 | |
| UNIPROTKB|Q9N0W2 | 575 | FUT8 "Alpha-(1,6)-fucosyltrans | 0.373 | 0.587 | 0.563 | 1.5e-138 | |
| UNIPROTKB|Q9BYC5 | 575 | FUT8 "Alpha-(1,6)-fucosyltrans | 0.373 | 0.587 | 0.563 | 1.9e-138 |
| FB|FBgn0030327 FucT6 "alpha1,6-fucosyltransferase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1153 (410.9 bits), Expect = 1.6e-149, Sum P(3) = 1.6e-149
Identities = 206/339 (60%), Positives = 260/339 (76%)
Query: 357 EKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCG 416
++SLL + ++ D ++ WR KE+ DLSDLVQRRL +LQNP DC+ ARKLVC+LNKGCG
Sbjct: 209 KRSLLSDMERMRQSDGYEAWRHKEARDLSDLVQRRLHHLQNPSDCQNARKLVCKLNKGCG 268
Query: 417 YGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNS-GWP 475
YGCQLHHVVYCFIVAYAT RTLIL S+ W Y +GGWEEVFQPVS +C G +N+ WP
Sbjct: 269 YGCQLHHVVYCFIVAYATERTLILKSRGWRYHKGGWEEVFQPVSNSCHDA-GTANTYNWP 327
Query: 476 GNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPN 535
G +TQV+ LPII+ + PRPPYLPLA+PEDL PRL RLHGDPIVWW+GQFL +L P P
Sbjct: 328 GKPNTQVLVLPIIDSLMPRPPYLPLAVPEDLAPRLKRLHGDPIVWWVGQFLKYLLRPQPT 387
Query: 536 TREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDV 595
TR+ + + +++PIVG+H+RRTDKV TEAA H VEEYMT VE+YY+ L + +
Sbjct: 388 TRDFLTSGMRNLGWERPIVGVHVRRTDKVGTEAACHSVEEYMTYVEDYYRTLEVNGSTVA 447
Query: 596 KRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCD 655
+R+++A+DDA V+ E R KYPQY ++GDP +AR AS+ RY ++L GII D+H LS D
Sbjct: 448 RRIFLASDDAQVIEEARRKYPQYQIIGDPEVARMASVSTRYTDTALNGIILDIHLLSMSD 507
Query: 656 HLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFG 694
HLVCTFSSQ+CR AYE M +PDA+ R++SLDDIYY+G
Sbjct: 508 HLVCTFSSQVCRVAYEIMQTMYPDAAHRFKSLDDIYYYG 546
|
|
| UNIPROTKB|F1SA54 FUT8 "Alpha-(1,6)-fucosyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031118-20 fut8 "fucosyltransferase 8 (alpha (1,6) fucosyltransferase)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N4H9 LOC100851836 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PZQ9 FUT8 "Alpha-(1,6)-fucosyltransferase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1303096 Fut8 "fucosyltransferase 8 (alpha (1,6) fucosyltransferase)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6EV76 Fut8 "Alpha-(1,6)-fucosyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P79282 FUT8 "Alpha-(1,6)-fucosyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9N0W2 FUT8 "Alpha-(1,6)-fucosyltransferase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BYC5 FUT8 "Alpha-(1,6)-fucosyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 905 | |||
| cd11300 | 328 | cd11300, Fut8_like, Alpha 1-6-fucosyltransferase | 1e-175 | |
| cd11300 | 328 | cd11300, Fut8_like, Alpha 1-6-fucosyltransferase | 1e-127 | |
| cd11792 | 55 | cd11792, SH3_Fut8, Src homology 3 domain of Alpha1 | 9e-25 | |
| cd11792 | 55 | cd11792, SH3_Fut8, Src homology 3 domain of Alpha1 | 8e-24 | |
| cd11548 | 287 | cd11548, NodZ_like, Alpha 1,6-fucosyltransferase s | 5e-13 | |
| cd11296 | 206 | cd11296, O-FucT_like, GDP-fucose protein O-fucosyl | 4e-08 | |
| cd11548 | 287 | cd11548, NodZ_like, Alpha 1,6-fucosyltransferase s | 3e-06 | |
| cd11296 | 206 | cd11296, O-FucT_like, GDP-fucose protein O-fucosyl | 8e-05 | |
| cd11784 | 55 | cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain | 3e-04 | |
| cd11801 | 55 | cd11801, SH3_JIP1_like, Src homology 3 domain of J | 7e-04 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 8e-04 | |
| cd11301 | 265 | cd11301, Fut1_Fut2_like, Alpha-1,2-fucosyltransfer | 0.001 | |
| cd11801 | 55 | cd11801, SH3_JIP1_like, Src homology 3 domain of J | 0.002 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 0.002 | |
| cd11942 | 55 | cd11942, SH3_JIP2, Src homology 3 domain of JNK-in | 0.003 |
| >gnl|CDD|211386 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase | Back alignment and domain information |
|---|
Score = 510 bits (1315), Expect = e-175
Identities = 193/328 (58%), Positives = 237/328 (72%), Gaps = 5/328 (1%)
Query: 371 DSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIV 430
D +WR KE LS LVQ+R+ LQNP DC A+KLVC LNKGCG+GCQLHHVVYC IV
Sbjct: 1 DGDSEWRRKELKKLSKLVQKRIHKLQNPKDCSKAKKLVCNLNKGCGFGCQLHHVVYCLIV 60
Query: 431 AYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGW---PGNNDTQVIYLPI 487
AY T RTLILDSK W YS GGWE+VF P+S+TCT G + + W P N+D QV+ LPI
Sbjct: 61 AYGTNRTLILDSKGWRYSPGGWEKVFLPLSETCTDRSGDNTAVWWWEPTNSDVQVVKLPI 120
Query: 488 IEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKI 547
I+ ++ RPP+LPLA+PEDL RL RLHGDP VWWIGQ L +L P P ++ + + +++
Sbjct: 121 IDSLHSRPPFLPLAVPEDLAERLERLHGDPRVWWIGQLLKYLMRPQPWLQDEIDEAKKEL 180
Query: 548 KFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQ--TVDVKRVYVATDDA 605
F+ PIVG+HIRRTDK+ TEAA H +EEYM VEE+Y + L +RVY+ATDD
Sbjct: 181 GFKHPIVGVHIRRTDKLGTEAAFHSLEEYMEHVEEWYDKYELRGPSEKVKRRVYLATDDP 240
Query: 606 SVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQI 665
SV E + KYP Y +GDP I+++ASL RY SSL GII D+H LS CD+LVCTFSSQ+
Sbjct: 241 SVFDEAKNKYPNYFFIGDPGISKSASLSTRYSDSSLKGIIIDIHLLSECDYLVCTFSSQV 300
Query: 666 CRTAYEQMNAKFPDASDRYRSLDDIYYF 693
CR AYE M + PDASDR+ SLDDIYY+
Sbjct: 301 CRLAYELMQTRHPDASDRFHSLDDIYYY 328
|
Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. Length = 328 |
| >gnl|CDD|211386 cd11300, Fut8_like, Alpha 1-6-fucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|212726 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1,6-fucosyltransferase (Fut8) | Back alignment and domain information |
|---|
| >gnl|CDD|212726 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1,6-fucosyltransferase (Fut8) | Back alignment and domain information |
|---|
| >gnl|CDD|211389 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ | Back alignment and domain information |
|---|
| >gnl|CDD|211383 cd11296, O-FucT_like, GDP-fucose protein O-fucosyltransferase and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|211389 cd11548, NodZ_like, Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ | Back alignment and domain information |
|---|
| >gnl|CDD|211383 cd11296, O-FucT_like, GDP-fucose protein O-fucosyltransferase and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|211387 cd11301, Fut1_Fut2_like, Alpha-1,2-fucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting protein 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 905 | |||
| KOG3705|consensus | 580 | 100.0 | ||
| KOG3705|consensus | 580 | 100.0 | ||
| KOG4225|consensus | 489 | 99.98 | ||
| PF05830 | 321 | NodZ: Nodulation protein Z (NodZ); InterPro: IPR00 | 99.91 | |
| KOG4348|consensus | 627 | 99.87 | ||
| KOG4348|consensus | 627 | 99.86 | ||
| KOG1029|consensus | 1118 | 99.73 | ||
| KOG4226|consensus | 379 | 99.56 | ||
| KOG4225|consensus | 489 | 99.55 | ||
| KOG1029|consensus | 1118 | 99.49 | ||
| KOG4226|consensus | 379 | 99.47 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.38 | |
| PF05830 | 321 | NodZ: Nodulation protein Z (NodZ); InterPro: IPR00 | 99.24 | |
| PF03254 | 476 | XG_FTase: Xyloglucan fucosyltransferase; InterPro: | 99.18 | |
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.09 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.08 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.01 | |
| PF10250 | 351 | O-FucT: GDP-fucose protein O-fucosyltransferase; I | 98.95 | |
| PF01531 | 298 | Glyco_transf_11: Glycosyl transferase family 11; I | 98.91 | |
| KOG1118|consensus | 366 | 98.87 | ||
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 98.85 | |
| KOG3775|consensus | 482 | 98.83 | ||
| KOG2199|consensus | 462 | 98.82 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.81 | |
| KOG2996|consensus | 865 | 98.8 | ||
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 98.77 | |
| KOG3632|consensus | 1335 | 98.74 | ||
| KOG0162|consensus | 1106 | 98.58 | ||
| KOG3601|consensus | 222 | 98.57 | ||
| KOG4792|consensus | 293 | 98.54 | ||
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 98.53 | |
| KOG1702|consensus | 264 | 98.5 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.41 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 98.4 | |
| KOG2070|consensus | 661 | 98.35 | ||
| KOG2856|consensus | 472 | 98.34 | ||
| KOG2546|consensus | 483 | 98.14 | ||
| KOG2070|consensus | 661 | 97.96 | ||
| KOG2199|consensus | 462 | 97.92 | ||
| KOG1118|consensus | 366 | 97.88 | ||
| KOG3775|consensus | 482 | 97.85 | ||
| KOG3655|consensus | 484 | 97.75 | ||
| KOG1702|consensus | 264 | 97.73 | ||
| KOG4773|consensus | 386 | 97.71 | ||
| KOG2856|consensus | 472 | 97.66 | ||
| KOG3875|consensus | 362 | 97.66 | ||
| KOG0162|consensus | 1106 | 97.54 | ||
| KOG1264|consensus | 1267 | 97.52 | ||
| PF10250 | 351 | O-FucT: GDP-fucose protein O-fucosyltransferase; I | 97.38 | |
| KOG3523|consensus | 695 | 97.36 | ||
| KOG3601|consensus | 222 | 97.18 | ||
| KOG2996|consensus | 865 | 97.03 | ||
| KOG4792|consensus | 293 | 97.02 | ||
| PF01531 | 298 | Glyco_transf_11: Glycosyl transferase family 11; I | 96.95 | |
| KOG3565|consensus | 640 | 96.92 | ||
| KOG3849|consensus | 386 | 96.72 | ||
| KOG1843|consensus | 473 | 96.7 | ||
| KOG2528|consensus | 490 | 96.63 | ||
| KOG4429|consensus | 421 | 96.6 | ||
| KOG4575|consensus | 874 | 96.3 | ||
| KOG2546|consensus | 483 | 96.26 | ||
| KOG1264|consensus | 1267 | 96.09 | ||
| KOG3523|consensus | 695 | 96.03 | ||
| KOG0199|consensus | 1039 | 95.89 | ||
| KOG3655|consensus | 484 | 95.86 | ||
| KOG0515|consensus | 752 | 95.63 | ||
| KOG3875|consensus | 362 | 95.57 | ||
| PF03254 | 476 | XG_FTase: Xyloglucan fucosyltransferase; InterPro: | 95.5 | |
| KOG3632|consensus | 1335 | 95.44 | ||
| KOG2528|consensus | 490 | 95.27 | ||
| KOG3849|consensus | 386 | 95.17 | ||
| KOG0197|consensus | 468 | 94.94 | ||
| KOG1451|consensus | 812 | 94.48 | ||
| KOG1451|consensus | 812 | 93.72 | ||
| KOG3565|consensus | 640 | 93.15 | ||
| KOG4773|consensus | 386 | 92.98 | ||
| KOG0199|consensus | 1039 | 92.89 | ||
| KOG3771|consensus | 460 | 92.67 | ||
| KOG0609|consensus | 542 | 92.51 | ||
| KOG2222|consensus | 848 | 91.92 | ||
| KOG3725|consensus | 375 | 91.84 | ||
| KOG3771|consensus | 460 | 91.7 | ||
| KOG1843|consensus | 473 | 91.46 | ||
| KOG3725|consensus | 375 | 89.78 | ||
| KOG4278|consensus | 1157 | 88.72 | ||
| KOG3557|consensus | 721 | 88.09 | ||
| KOG4278|consensus | 1157 | 86.29 | ||
| KOG0197|consensus | 468 | 83.46 | ||
| KOG4575|consensus | 874 | 81.94 |
| >KOG3705|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-127 Score=1027.31 Aligned_cols=455 Identities=53% Similarity=0.973 Sum_probs=434.0
Q ss_pred hhHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhccCchhhhHHHHHHHHhhHHHHHHHHHHHHHhhccCCCchhhhhhhhh
Q psy16352 48 IQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHVLDTLKARDSFDDWRWKESLD 127 (905)
Q Consensus 48 ~~~e~~rr~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~sl~~~~~~l~~~~~~~~w~~~e~~~ 127 (905)
.+||.+||||+++++|||||++|||.|+|+.. ..++..+.+.+|-++++|++|||.|+..|++.||+++||.+|+..
T Consensus 116 ~dhE~~rRri~~~i~E~w~fl~Sel~kvr~~~---~~dl~e~~~~~LL~~~~h~rSlm~d~~~l~q~dG~e~wR~Kea~d 192 (580)
T KOG3705|consen 116 VDHEVQRRRIDDRIREMWYFLHSELGKVRKAA---SADLIENSTKILLETAEHMRSLMGDSAQLEQLDGSEEWRFKEATD 192 (580)
T ss_pred ccHHHHHHHHHhhHHHHHHHHHHHHHHHhhhh---hhhHHhhHHHHHHhhHHHHHHHHhHHHHHHhccCcHHHHHhHHhH
Confidence 58999999999999999999999999998863 458889999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHhhcCCCCCCCCCCeEEEEecCCccchhHHHHHHHHHHHHHhcCcEEEEcCCCCCCCCCCcccccccCCCCC
Q psy16352 128 LSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSKEWSYSRGGWEEVFQPVSKTC 207 (905)
Q Consensus 128 Lt~~vQ~~I~~~QNP~dC~~Ak~L~c~~~~~cGfGc~lH~~~~cl~~A~~~nRtli~d~~~~~Y~~~~w~~~F~P~S~~C 207 (905)
||++|||||+++|||+||++||+|||+++++||||||+||++|||++||+|.||||+.+.+|.|+.|||+++|+|+|++|
T Consensus 193 lt~lvqrri~~LQNPkdCs~AkkLVCnlnKgCGyGCQLHHVvYCfi~AyaTqRtliLks~gWrY~~gGWe~VF~pvS~~c 272 (580)
T KOG3705|consen 193 LTQLVQRRIEKLQNPKDCSEAKKLVCNLNKGCGYGCQLHHVVYCFITAYATQRTLILKSDGWRYSSGGWESVFKPVSKCC 272 (580)
T ss_pred HHHHHHHHHHHhcChHhhHHHhhheeeccCCcccccceeeeeEeeeeeeecceEEEEecCCceecCCChhhhhhhhhhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCCCCC--CCcceEEeccccccCCCCCCCCCCCCcchhHHHhhhcCCCchhHHHHHHHHHhCCChhHHHHHH
Q psy16352 208 TSPEGVSNSSWPGN--NDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLMFLNNPTPNTREIVA 285 (905)
Q Consensus 208 ~~~~~~~~~~w~~~--~~~~vv~~pi~~~~~~~~~f~p~~~p~~l~~~l~~~h~~P~~Ww~GQ~~~YL~RP~~~~~~~i~ 285 (905)
.+..+.+..+||+. ++++|+.+||+|++.++|||+|+++|+||+++|.++||+|.+||+||+++|||||||+++++|+
T Consensus 273 ~D~~~~nT~~wpg~~~~n~qVv~LpIvDSL~prPpyLPlAVPEdLa~rL~rlHgdP~vwwVgqFikYL~Rpqp~t~~~l~ 352 (580)
T KOG3705|consen 273 FDEAVGNTEAWPGAEPSNAQVVSLPIVDSLIPRPPYLPLAVPEDLAERLTRLHGDPPVWWVGQFIKYLMRPQPATQEKLD 352 (580)
T ss_pred cccccccccCCCCCCCCCceEEEeecccccCCCCCCccccCcHHHHHHHHHhcCCCceeeHHHHHHHHhCCChhhHHHHH
Confidence 99998888999985 4889999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhcCCCCCeeeeeeeecccccccccCCChHHHHHHHHHHHHHHhccCCCceeEEEEEecchhhhhHHHHhhhhhhhh
Q psy16352 286 KYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDASVLTEIREKSLLHVLG 365 (905)
Q Consensus 286 ~~~~~l~f~~PiVgvHVRrtDK~~~Ea~~~~leeYM~~v~~~~~~~~~~~~~~~~ri~LaTDd~~vi~EakekSL~~Dle 365 (905)
++.++++|.+||||||||||||++|||+||++||||++||.||+.++
T Consensus 353 ~a~k~lg~~~PivGvhvRRTDKVGTEAAfH~~eEYM~~vE~~f~~le--------------------------------- 399 (580)
T KOG3705|consen 353 KALKSLGLDKPIVGVHVRRTDKVGTEAAFHALEEYMEWVEIWFKVLE--------------------------------- 399 (580)
T ss_pred HHHHhCCCCCceeeEEEEecccccchhhhhhHHHHHHHHHHHHHHHH---------------------------------
Confidence 99999999999999999999999999999999999999999986210
Q ss_pred hhccCCchhhhhHhhhhhhHHHHHHHHHhhcCCCCccccceEEEeccCCcchHHHHHHHHHHHHHHHHcCcEEEEecCCC
Q psy16352 366 ILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEW 445 (905)
Q Consensus 366 ~L~~~d~~~~wr~~~~~~l~~~vq~~I~~~QNP~dCs~AK~Lvc~l~~~~GfG~~lh~l~~cL~lA~~t~RtLivd~~~w 445 (905)
.
T Consensus 400 ---------------------------------------------~---------------------------------- 400 (580)
T KOG3705|consen 400 ---------------------------------------------K---------------------------------- 400 (580)
T ss_pred ---------------------------------------------H----------------------------------
Confidence 0
Q ss_pred cccCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCeEEeceeeecCCCCCCCCCCCCCCchhHHhhhcCCchHHHHHHH
Q psy16352 446 SYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQF 525 (905)
Q Consensus 446 ~Y~~~gw~~~F~P~S~~C~~~~~~~~~~W~~~~~~~vv~~pii~~~~~~~~f~p~~vP~~l~~~L~~~h~~p~~Ww~gq~ 525 (905)
T Consensus 401 -------------------------------------------------------------------------------- 400 (580)
T KOG3705|consen 401 -------------------------------------------------------------------------------- 400 (580)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred hhhhccCChhHHHHHHHHhhhccCCCCcceeEEecCCCCCccccccChHHHHHHHHHHHHHHhccCCCCcceEEEEcCCH
Q psy16352 526 LTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYVATDDA 605 (905)
Q Consensus 526 ~~YLlRP~~~~~~~I~~~~~~l~f~~PiVGVHIRrgDK~~~Ea~~~~l~eYm~~ve~~~~~~~~~~~~~~~~IfLATDDp 605 (905)
|| | ...+|||||||||
T Consensus 401 ----------------------------------rg-~-----------------------------~~~rRiflAsDDp 416 (580)
T KOG3705|consen 401 ----------------------------------RG-K-----------------------------PLERRIFLASDDP 416 (580)
T ss_pred ----------------------------------hC-C-----------------------------chhheEEEecCCc
Confidence 00 0 0236999999999
Q ss_pred HHHHHHHhhCCCcEEEcCCcccccccccccchhhhhhHHHHHHHHHhcCCeEEEcccCcHhHHHHHHHhccCCCceeecc
Q psy16352 606 SVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQICRTAYEQMNAKFPDASDRYR 685 (905)
Q Consensus 606 ~Vi~e~k~~yp~y~~i~~~~~~~~a~~~~R~s~~~l~~~l~Dl~lLs~cD~~VgT~SSnv~RLa~eLrqt~~~d~~~~~~ 685 (905)
.|+.|++.+||+|.||++++++++|++.+||+++++.|+++||++||++||+||||||+|||++||+|||++
T Consensus 417 ~vv~EAk~kYPnYe~igd~eia~~A~l~nRYTd~sL~GvIlDIh~LS~~d~LVCTFSSQVCRvaYEimQt~~-------- 488 (580)
T KOG3705|consen 417 TVVPEAKNKYPNYEVIGDTEIAKTAQLNNRYTDASLMGVILDIHILSKVDYLVCTFSSQVCRVAYEIMQTSG-------- 488 (580)
T ss_pred hhchHhhccCCCcEEeccHHHHHHhhccccchhhhhhheeeeeeeecccceEEEechHHHHHHHHHHHhccC--------
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccccCCCceeeeeehhhHhhhhccCCCCCCCeeecccccccCCCcccceeeecCCCCCCCCCccccCCcEEEecc
Q psy16352 686 SLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAG 765 (905)
Q Consensus 686 slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ld~~~~~~~~~~~~~~v~~~~~~~~~~El~l~~GD~I~~~~ 765 (905)
|||+.+|+|||||||||||++|.++|+++|.|++++||+|++||+|+|+|
T Consensus 489 ------------------------------pDa~~~FhSLDDIYYfGGQnAHn~ivi~aH~prt~~ei~l~vGD~vgvAG 538 (580)
T KOG3705|consen 489 ------------------------------PDAGSKFHSLDDIYYFGGQNAHNVIVIEAHIPRTNKEIDLKVGDKVGVAG 538 (580)
T ss_pred ------------------------------CCcccccccccceeeecCccccceEEEEecCCCcccccCcccCCeeeecc
Confidence 99999999999999999999999999999999999999999999999999
Q ss_pred ccccceeeeeecCCCceeeeeCcccccCC----CCChh
Q psy16352 766 NHWNGYSKGRNLRTDQLALYPTFKTSADS----FPAFA 799 (905)
Q Consensus 766 ~~~~G~~~G~n~~tg~~GlfP~~~v~~~~----~p~~~ 799 (905)
||||||++|+|.+|++.|+||+|||++.. +|.|.
T Consensus 539 NHWdGySKG~Nr~t~~~GlfPSyKvrek~~t~k~ply~ 576 (580)
T KOG3705|consen 539 NHWDGYSKGTNRQTYKEGLFPSYKVREKFITIKIPLYV 576 (580)
T ss_pred cccccccccccccccccCCCccceeeeeEEEeeecchh
Confidence 99999999999999999999999999764 55543
|
|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >PF05830 NodZ: Nodulation protein Z (NodZ); InterPro: IPR008716 The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF05830 NodZ: Nodulation protein Z (NodZ); InterPro: IPR008716 The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation | Back alignment and domain information |
|---|
| >PF03254 XG_FTase: Xyloglucan fucosyltransferase; InterPro: IPR004938 Plant cell walls are crucial for development, signal transduction, and disease resistance in plants | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF10250 O-FucT: GDP-fucose protein O-fucosyltransferase; InterPro: IPR019378 This is a family of conserved proteins representing the enzyme responsible for adding O-fucose to EGF (epidermal growth factor-like) repeats | Back alignment and domain information |
|---|
| >PF01531 Glyco_transf_11: Glycosyl transferase family 11; InterPro: IPR002516 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >PF10250 O-FucT: GDP-fucose protein O-fucosyltransferase; InterPro: IPR019378 This is a family of conserved proteins representing the enzyme responsible for adding O-fucose to EGF (epidermal growth factor-like) repeats | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >PF01531 Glyco_transf_11: Glycosyl transferase family 11; InterPro: IPR002516 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >KOG3849|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >PF03254 XG_FTase: Xyloglucan fucosyltransferase; InterPro: IPR004938 Plant cell walls are crucial for development, signal transduction, and disease resistance in plants | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG3849|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 905 | ||||
| 2de0_X | 526 | Crystal Structure Of Human Alpha 1,6-fucosyltransfe | 1e-129 | ||
| 2de0_X | 526 | Crystal Structure Of Human Alpha 1,6-fucosyltransfe | 2e-13 |
| >pdb|2DE0|X Chain X, Crystal Structure Of Human Alpha 1,6-fucosyltransferase, Fut8 Length = 526 | Back alignment and structure |
|
| >pdb|2DE0|X Chain X, Crystal Structure Of Human Alpha 1,6-fucosyltransferase, Fut8 Length = 526 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 905 | |||
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 1e-136 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 1e-108 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 4e-18 | |
| 2hhc_A | 330 | NODZ, nodulation fucosyltransferase NODZ; glycosyl | 2e-55 | |
| 2hhc_A | 330 | NODZ, nodulation fucosyltransferase NODZ; glycosyl | 5e-44 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 7e-06 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-05 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 2e-04 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 6e-04 |
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
Score = 416 bits (1069), Expect = e-136
Identities = 222/466 (47%), Positives = 291/466 (62%), Gaps = 41/466 (8%)
Query: 356 REKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGC 415
E+S++ L L D DWR KE+ DL++LVQRR+ YLQNP DC A+KLVC +NKGC
Sbjct: 97 HERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGC 156
Query: 416 GYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWP 475
GYGCQLHHVVYCF++AY T+RTLIL+S+ W Y+ GGWE VF+PVS+TCT G+S W
Sbjct: 157 GYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWS 216
Query: 476 G---NNDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVWWIGQFLTFLNNP 532
G + + QV+ LPI++ ++PRPPYLPLA+PEDL RL R+HGDP VWW+ QF+ +L P
Sbjct: 217 GEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRP 276
Query: 533 TPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQT 592
P + + + +K+ F+ P++G+H+RRTDKV TEAA HP+EEYM VEE+++ LA
Sbjct: 277 QPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQ 336
Query: 593 VDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLS 652
VD KRVY+ATDD S+L E + KYP Y + D SI+ +A L +RY ++SL G+I D+H+LS
Sbjct: 337 VDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLS 396
Query: 653 NCDHLVCTFSSQICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMN 712
D LVCTFSSQ +CR AYE M
Sbjct: 397 QADFLVCTFSSQ--------------------------------------VCRVAYEIMQ 418
Query: 713 AKFPDASDRYRSLDDIYYFGGQLSRIHIAVLPHTPRHSSEMALLVGDRISVAGNHWNGYS 772
PDAS + SLDDIYYFGGQ + IA+ H PR + E+ + GD I VAGNHW+GYS
Sbjct: 419 TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYS 478
Query: 773 KGRNLRTDQLALYPTFKTSADSFPAFAYIFRRIHIAVLPHTPRHSS 818
KG N + + LYP++K + A H H
Sbjct: 479 KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEKAGGGHHHHHHG 524
|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
| >2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Length = 330 | Back alignment and structure |
|---|
| >2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* Length = 330 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 905 | |||
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 100.0 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 100.0 | |
| 2hhc_A | 330 | NODZ, nodulation fucosyltransferase NODZ; glycosyl | 99.9 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.8 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.78 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.75 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.73 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.57 | |
| 2hhc_A | 330 | NODZ, nodulation fucosyltransferase NODZ; glycosyl | 99.72 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.59 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.54 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.49 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.47 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.47 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.45 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.42 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.41 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.41 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.41 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.4 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.4 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.4 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.37 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.37 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.37 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.36 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.35 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.35 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.35 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.35 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.35 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.35 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.34 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.34 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.33 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.33 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.33 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.33 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.33 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.33 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.33 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.33 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.32 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.32 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.32 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.32 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.31 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.31 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.31 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.31 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.31 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.31 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.31 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.3 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.3 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.3 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.3 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.3 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.3 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.3 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.29 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.29 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.29 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.29 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.29 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.29 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.29 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.29 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.28 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.28 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.28 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.28 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.28 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.28 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.28 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.28 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.27 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.27 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.27 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.27 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.27 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.27 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.27 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.27 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.27 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.27 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.26 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.26 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.26 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.26 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.26 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.26 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.26 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.26 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.26 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.26 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.26 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.26 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.26 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.25 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.25 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.25 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.25 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.25 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.25 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.25 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.25 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.25 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.24 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.24 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.24 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.24 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.24 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.24 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.24 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.24 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.24 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.24 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.24 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.23 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.23 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.23 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.23 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.23 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.23 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.23 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.22 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.22 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.22 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.22 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.22 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.22 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.22 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.22 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.22 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.22 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.22 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.22 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.21 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.21 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.21 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.21 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.21 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.21 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.21 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.21 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.21 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.21 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.21 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.2 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.2 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.2 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.2 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.2 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.2 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.19 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.19 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.19 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.18 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.18 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.18 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.18 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.17 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.17 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.17 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.17 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.17 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.16 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.16 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.15 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.14 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.14 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.14 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.13 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.13 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.12 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.1 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.09 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.08 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.07 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.06 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.06 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.04 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.02 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.02 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.02 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.02 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.02 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.01 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 98.99 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 98.98 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 98.97 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 98.96 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 98.95 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 98.94 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 98.94 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 98.93 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 98.93 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 98.93 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 98.91 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 98.91 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 98.91 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 98.91 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 98.9 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 98.9 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 98.88 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 98.88 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 98.88 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 98.88 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 98.87 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 98.87 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 98.86 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 98.86 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 98.86 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 98.86 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 98.86 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 98.86 | |
| 3zy2_A | 362 | Putative GDP-fucose protein O-fucosyltransferase; | 98.86 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 98.85 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.85 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 98.85 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 98.84 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 98.84 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 98.84 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 98.84 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 98.84 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 98.84 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 98.84 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 98.83 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 98.83 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 98.83 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 98.82 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 98.82 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 98.82 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 98.82 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 98.81 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 98.81 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 98.81 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 98.81 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 98.81 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 98.81 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 98.8 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 98.8 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 98.8 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 98.8 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 98.8 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 98.8 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 98.8 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 98.8 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 98.79 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 98.79 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 98.79 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 98.78 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 98.78 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 98.78 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 98.77 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 98.77 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 98.77 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 98.77 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 98.77 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 98.77 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 98.77 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 98.76 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 98.76 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 98.76 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 98.76 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 98.76 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 98.75 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 98.75 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 98.75 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 98.75 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 98.75 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 98.74 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 98.74 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 98.74 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 98.74 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 98.74 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 98.74 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 98.73 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.72 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 98.72 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 98.72 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 98.72 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 98.72 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 98.71 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 98.71 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 98.71 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 98.71 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 98.71 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 98.71 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 98.7 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 98.7 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 98.7 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.7 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.16 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 98.7 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 98.7 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 98.69 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 98.69 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 98.69 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 98.69 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 98.69 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 98.69 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 98.69 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 98.68 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 98.68 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 98.68 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 98.68 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 98.68 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 98.68 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 98.68 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 98.67 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 98.67 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.67 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 98.67 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 98.67 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 98.66 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 98.66 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 98.66 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 98.65 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 98.65 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 98.65 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 98.65 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 98.63 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 98.63 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.63 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 98.63 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 98.63 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 98.63 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 98.62 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 98.62 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 98.62 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 98.61 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 98.61 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 98.61 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 98.61 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 98.61 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 98.61 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 98.61 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 98.6 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 98.6 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 98.6 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 98.6 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 98.6 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 98.59 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 98.59 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 98.59 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 98.59 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 98.58 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 98.58 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 98.58 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 98.57 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 98.57 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 98.57 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 98.57 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 98.57 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 98.57 | |
| 4ap5_A | 408 | GDP-fucose protein O-fucosyltransferase 2; GT-B, G | 98.56 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 98.56 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 98.56 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 98.55 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 98.55 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 98.55 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 98.53 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 98.52 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 98.51 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 98.51 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 98.51 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 98.45 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.44 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 98.43 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 98.37 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 98.37 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 98.33 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 98.33 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 98.32 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 98.31 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 98.25 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 98.21 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 98.13 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 98.04 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 98.03 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 98.02 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 98.01 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 97.98 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 97.97 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 97.85 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 97.85 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 97.81 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 97.78 | |
| 3zy2_A | 362 | Putative GDP-fucose protein O-fucosyltransferase; | 97.77 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 97.76 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 97.72 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 97.53 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 97.52 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 97.47 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 97.38 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 97.37 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 97.35 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 97.33 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 97.33 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.23 | |
| 4ap5_A | 408 | GDP-fucose protein O-fucosyltransferase 2; GT-B, G | 97.19 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 96.97 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 96.85 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 96.85 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 96.84 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 96.73 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 96.09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 95.91 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 95.79 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 95.26 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 95.22 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 95.1 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 95.06 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 94.53 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 94.26 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 94.17 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 92.17 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 85.56 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 83.84 |
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-94 Score=836.26 Aligned_cols=470 Identities=50% Similarity=0.948 Sum_probs=413.2
Q ss_pred hhhhhccccccccccCCCCChhHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhccCchhhhHHHHHHHHhhHHHHHHHHHH
Q psy16352 28 LTQFRTELVNKTPQLAGGPNIQYELARKRVSKDVQELWYYVSSELTQFRTELVNKTPQLAGKLDRIIAETAEHKRSLLHV 107 (905)
Q Consensus 28 ~~~~~~~~~~~~~~~~~~~~~~~e~~rr~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~sl~~~ 107 (905)
+++.+-...+++..+.+||+++||++|||++++++|||||++++|.||++ .+++++.+.+++++.++++|++||++|
T Consensus 28 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~e~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~l~~~ 104 (526)
T 2de0_X 28 LVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKN---LEGNELQRHADEFLLDLGHHERSIMTD 104 (526)
T ss_dssp ------------------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT---CCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HhhhhhhhhHHhcccCCCCChHHHHHHHHHHHhHHHHHHHHHHHHHHhhc---cCchHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34444446788899999999999999999999999999999999999866 246799999999999999999999999
Q ss_pred HHHhhccCCCchhhhhhhhhhHHHHHHHHhhcCCCCCCCCCCeEEEEecCCccchhHHHHHHHHHHHHHhcCcEEEEcCC
Q psy16352 108 LDTLKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATQRTLILDSK 187 (905)
Q Consensus 108 ~~~l~~~~~~~~w~~~e~~~Lt~~vQ~~I~~~QNP~dC~~Ak~L~c~~~~~cGfGc~lH~~~~cl~~A~~~nRtli~d~~ 187 (905)
+++|++.||+.+||.+++++||++||++|+.+|||+||++||+|+|+++.+|||||+||++++||.+|+++|||||+|++
T Consensus 105 ~~~l~~~~g~~~~r~~~~~~lt~~vq~~i~~~QnP~~Cs~aK~Lv~~~~~~~GfGs~lh~l~~~L~~A~~~~Rtliidd~ 184 (526)
T 2de0_X 105 LYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQ 184 (526)
T ss_dssp HHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHCCSCGGGSCEEEEECCCSSCHHHHHHHHHHHHHHHHHHTCEEEEECT
T ss_pred HHHHHhhhchhHHHHHHHHHHHHHHHHHHHHhcCCCcCCCCCEEEEEecCCCchHHHHHHHHHHHHHHHhhCCEEEEECC
Confidence 99999999999999999999999999999999999999999999999988999999999999999999999999999999
Q ss_pred CCCCCCCCcccccccCCCCCCCCCCCCCCCCCCC---CCcceEEeccccccCCCCCCCCCCCCcchhHHHhhhcCCCchh
Q psy16352 188 EWSYSRGGWEEVFQPVSKTCTSPEGVSNSSWPGN---NDTQVIYLPIIEFINPRPPYLPLAIPEDLEPRLSRLHGDPIVW 264 (905)
Q Consensus 188 ~~~Y~~~~w~~~F~P~S~~C~~~~~~~~~~w~~~---~~~~vv~~pi~~~~~~~~~f~p~~~p~~l~~~l~~~h~~P~~W 264 (905)
+|.|++|+|+|||+|+|++|..+.......|++. .+++||.+|+++..++.++|.|+++|+++.++|.++|++|.+|
T Consensus 185 ~w~Y~~g~w~~yF~P~s~~C~~~~~~~~~~w~~~~~~~~~~vV~~~~i~~~~~~~~~~~~~~P~~~~~~L~~l~~dp~~w 264 (526)
T 2de0_X 185 NWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVW 264 (526)
T ss_dssp TCSSCTTCGGGTBCCSCSSCCCCCCSCCCBCCCTTGGGGCSEEEECCGGGCSSCCSCCTTCEEGGGHHHHHHHCSCHHHH
T ss_pred CCCcCCCCHHHhhhCcCccccCCCccccCCCCCcccCCCcceEEeeccccccccccccccccchhHHHHHHhccCCcHHH
Confidence 9999999999999999999999877777899985 3788999999988888899999999999999999999999999
Q ss_pred HHHHHHHHHhCCChhHHHHHHHHhhhcCCCCCeeeeeeeecccccccccCCChHHHHHHHHHHHHHHhccCCCceeEEEE
Q psy16352 265 WIGQFLMFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYYKQLALTQTVDVKRVYV 344 (905)
Q Consensus 265 w~GQ~~~YL~RP~~~~~~~i~~~~~~l~f~~PiVgvHVRrtDK~~~Ea~~~~leeYM~~v~~~~~~~~~~~~~~~~ri~L 344 (905)
|+||+++|||||+++++++|++.+++++|+.|+||||||||||+..|+.++++++||++|++
T Consensus 265 ~~~q~~~yl~rP~~~i~~~I~~~~~~l~~~~piVGVHIRrGDk~~~E~~~~~~~~Y~~~v~~------------------ 326 (526)
T 2de0_X 265 WVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEE------------------ 326 (526)
T ss_dssp HHHHHHHHHTCBCHHHHHHHHHHHHHHTCCSSEEEEEECCC-----CCCSCSHHHHHHHHHH------------------
T ss_pred HHHHHHHHHcCCCHHHHHHHHHHHHHhCCCCCEEEEEEeCCCCCccccccCCHHHHHHHHHH------------------
Confidence 99999999999999999999999999887788888888888887668888888877755541
Q ss_pred EecchhhhhHHHHhhhhhhhhhhccCCchhhhhHhhhhhhHHHHHHHHHhhcCCCCccccceEEEeccCCcchHHHHHHH
Q psy16352 345 ATDDASVLTEIREKSLLHVLGILKARDSFDDWRWKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHV 424 (905)
Q Consensus 345 aTDd~~vi~EakekSL~~Dle~L~~~d~~~~wr~~~~~~l~~~vq~~I~~~QNP~dCs~AK~Lvc~l~~~~GfG~~lh~l 424 (905)
T Consensus 327 -------------------------------------------------------------------------------- 326 (526)
T 2de0_X 327 -------------------------------------------------------------------------------- 326 (526)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHHHHcCcEEEEecCCCcccCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCeEEeceeeecCCCCCCCCCCCCC
Q psy16352 425 VYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGNNDTQVIYLPIIEFINPRPPYLPLAIPE 504 (905)
Q Consensus 425 ~~cL~lA~~t~RtLivd~~~w~Y~~~gw~~~F~P~S~~C~~~~~~~~~~W~~~~~~~vv~~pii~~~~~~~~f~p~~vP~ 504 (905)
T Consensus 327 -------------------------------------------------------------------------------- 326 (526)
T 2de0_X 327 -------------------------------------------------------------------------------- 326 (526)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CchhHHhhhcCCchHHHHHHHhhhhccCChhHHHHHHHHhhhccCCCCcceeEEecCCCCCccccccChHHHHHHHHHHH
Q psy16352 505 DLEPRLSRLHGDPIVWWIGQFLTFLNNPTPNTREIVAKYGEKIKFQKPIVGIHIRRTDKVDTEAALHPVEEYMTGVEEYY 584 (905)
Q Consensus 505 ~l~~~L~~~h~~p~~Ww~gq~~~YLlRP~~~~~~~I~~~~~~l~f~~PiVGVHIRrgDK~~~Ea~~~~l~eYm~~ve~~~ 584 (905)
|+
T Consensus 327 ------------------------------------------------------------------------------~~ 328 (526)
T 2de0_X 327 ------------------------------------------------------------------------------HF 328 (526)
T ss_dssp ------------------------------------------------------------------------------HH
T ss_pred ------------------------------------------------------------------------------HH
Confidence 11
Q ss_pred HHHhccCCCCcceEEEEcCCHHHHHHHHhhCCCcEEEcCCcccccccccccchhhhhhHHHHHHHHHhcCCeEEEcccCc
Q psy16352 585 KQLALTQTVDVKRVYVATDDASVLTEIREKYPQYSVLGDPSIARTASLEHRYLKSSLLGIITDLHYLSNCDHLVCTFSSQ 664 (905)
Q Consensus 585 ~~~~~~~~~~~~~IfLATDDp~Vi~e~k~~yp~y~~i~~~~~~~~a~~~~R~s~~~l~~~l~Dl~lLs~cD~~VgT~SSn 664 (905)
+.+.........+||||||||+|+++++++||+|+|++++.+..++++.+|++.+++.++++||++||+||+||||+|||
T Consensus 329 ~~l~~~~~~~~~~ifLATDDp~v~~e~k~~~p~~~~~~d~~~~~~a~~~~R~s~~~l~~~l~DL~lLs~cd~~Vgt~sS~ 408 (526)
T 2de0_X 329 QLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQ 408 (526)
T ss_dssp HHHHTTSCCSSCEEEEEESCHHHHHHHHHHCTTSEEECCCCSSCSSGGGGGTCCTHHHHHHHHHHHHHHSSEEEECTTSH
T ss_pred HHHHhhcCCCCCeEEEEcCCHHHHHHHHHhCCCCEEecCcccccccCccccccHHHHHHHHHHHHHHhcCCeeecCCCCH
Confidence 11111112356899999999999999999999999999987777777888999999999999999999999999999999
Q ss_pred HhHHHHHHHhccCCCceeecccccccccccCCCceeeeeehhhHhhhhccCCCCCCCeeecccccccCCCcccceeeecC
Q psy16352 665 ICRTAYEQMNAKFPDASDRYRSLDDIYYFGVPTATIWCICRTAYEQMNAKFPDASDRYRSLDDIYYFGGQLSRIHIAVLP 744 (905)
Q Consensus 665 v~RLa~eLrqt~~~d~~~~~~slD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ld~~~~~~~~~~~~~~v~~~ 744 (905)
|||++++||++.+ |++...+.|||++|+||||.....+|+|+
T Consensus 409 ~srla~~l~~~~~--------------------------------------~~~~~~~~SLD~~~~~~Gq~~~~~~aly~ 450 (526)
T 2de0_X 409 VCRVAYEIMQTLH--------------------------------------PDASANFHSLDDIYYFGGQNAHNQIAIYA 450 (526)
T ss_dssp HHHHHHHHHTTSS--------------------------------------SCCTTCEEESSCCSCCTTCCCCEEEECSC
T ss_pred HHHHHHHHhcCcC--------------------------------------ccccccccCCccccccccccccceEEeec
Confidence 9999999999998 89999999999999999999999999999
Q ss_pred CCCCCCCCccccCCcEEEeccccccceeeeeecCCCceeeeeCcccccCC
Q psy16352 745 HTPRHSSEMALLVGDRISVAGNHWNGYSKGRNLRTDQLALYPTFKTSADS 794 (905)
Q Consensus 745 ~~~~~~~El~l~~GD~I~~~~~~~~G~~~G~n~~tg~~GlfP~~~v~~~~ 794 (905)
|+|+++|||+|++||+|.|..++++||++|+|.+||+.|+||++||++..
T Consensus 451 y~a~~~dELs~~~GD~i~v~~~~~~gW~~G~~~~~g~~G~fPsnyV~~~~ 500 (526)
T 2de0_X 451 HQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKI 500 (526)
T ss_dssp BCCSSTTBCCBCTTCEEEEEEECSSSEEEEEETTTTEEEEEEGGGEEECC
T ss_pred CCCCCCCcCCcCCCCEEEEccccCCCeeEEEeCCCCCEEEECchheeEcc
Confidence 99999999999999999999999999999999999999999999999754
|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2hhc_A NODZ, nodulation fucosyltransferase NODZ; glycosyltransferase; 1.54A {Bradyrhizobium SP} PDB: 2hlh_A 2ocx_A* 3siw_A* 3six_A* | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3zy2_A Putative GDP-fucose protein O-fucosyltransferase; glycosyltransferase, GT-B, catalytic mechanism,; HET: GDP; 1.54A {Caenorhabditis elegans} PDB: 3zy3_A* 3zy4_A* 3zy5_A* 3zy6_A* | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >4ap5_A GDP-fucose protein O-fucosyltransferase 2; GT-B, GT68; HET: NAG; 3.00A {Homo sapiens} PDB: 4ap6_A* | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zy2_A Putative GDP-fucose protein O-fucosyltransferase; glycosyltransferase, GT-B, catalytic mechanism,; HET: GDP; 1.54A {Caenorhabditis elegans} PDB: 3zy3_A* 3zy4_A* 3zy5_A* 3zy6_A* | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >4ap5_A GDP-fucose protein O-fucosyltransferase 2; GT-B, GT68; HET: NAG; 3.00A {Homo sapiens} PDB: 4ap6_A* | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 905 | |||
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.68 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.49 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.48 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.47 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.47 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.46 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.41 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.41 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.4 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.39 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.39 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.36 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.36 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.36 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.36 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.35 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.34 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.34 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.34 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.34 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.32 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.32 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.31 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.3 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.3 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.29 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.28 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.27 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.27 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.27 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.26 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.25 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.24 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.24 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.24 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.23 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.22 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.21 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.19 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.18 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.15 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.15 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.1 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.08 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.08 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.06 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.05 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.05 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.03 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.02 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.0 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.0 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 98.98 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 98.98 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 98.97 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 98.94 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 98.94 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.93 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.93 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.92 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 98.92 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 98.91 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 98.91 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 98.89 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 98.88 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 98.88 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.86 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 98.84 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 98.83 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 98.83 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 98.81 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 98.81 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 98.8 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 98.79 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 98.79 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 98.78 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 98.77 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.77 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.77 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.77 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 98.75 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.72 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.7 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 98.69 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 98.65 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 98.6 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 98.42 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 98.39 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 98.37 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.37 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 98.3 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 97.99 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 97.4 |
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Intersectin 2 (KIAA1256) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=1.3e-17 Score=151.01 Aligned_cols=89 Identities=15% Similarity=0.130 Sum_probs=72.9
Q ss_pred eeecCCCceeeeeCcccccCCCCC----hhhhhhhhheecccCCCCCCCCccccCCCEEEEeeeeecceecceecCCCce
Q psy16352 774 GRNLRTDQLALYPTFKTSADSFPA----FAYIFRRIHIAVLPHTPRHSSEMDLMVGDRISVAGNHWNGYSKGRNLRTDQL 849 (905)
Q Consensus 774 G~n~~tg~~GlfP~~~v~~~~~p~----~~~~~~~~~~a~y~y~~~~~dEL~l~~GD~i~v~~~~~dgw~~G~n~rtg~~ 849 (905)
|+...+|+.|+||+.+|++...+. ........++|||+|.|++++||+|++||+|.|+++.++|||.|+. +|+.
T Consensus 1 g~~~~~G~~G~~P~~yv~~~~~~~~~~~~~~~~~~~~~Alydy~a~~~~ELsf~~Gd~i~Vl~~~~~gWw~g~~--~g~~ 78 (98)
T d1udla_ 1 GSSGSSGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEI--NGVT 78 (98)
T ss_dssp CCCCCSSCCSSCCCCCCCCCSCCCCCCCSCCCCSEEEEESSCCCCSSTTSCCCCTTCEEEECBCCSSSEEBCBS--SSCB
T ss_pred CCcCCCCceeeEcccceeECCCcccccCCCCCCccEEEEccCCCCCCCCEeeEcCCCEEEEeEecCCCeEEEEE--CCeE
Confidence 455578999999999998765322 1222345689999999999999999999999999999999999974 8999
Q ss_pred eeccCCCceecccCCC
Q psy16352 850 ALYPTFKSVPHVETAR 865 (905)
Q Consensus 850 GlfP~~~v~~v~~~~~ 865 (905)
|+||+|||+.+ .+.+
T Consensus 79 G~~P~nyVe~~-~~~~ 93 (98)
T d1udla_ 79 GLFPSNYVKMT-TDSS 93 (98)
T ss_dssp CCEETTSEEEC-CCCS
T ss_pred EEEchHHEEEC-CCCC
Confidence 99999999754 4443
|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|