Psyllid ID: psy16693
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| 443721618 | 471 | hypothetical protein CAPTEDRAFT_200496, | 0.668 | 0.278 | 0.362 | 4e-15 | |
| 427791807 | 1212 | Putative tick transposon, partial [Rhipi | 0.653 | 0.105 | 0.364 | 1e-14 | |
| 427791321 | 1210 | Putative tick transposon, partial [Rhipi | 0.653 | 0.105 | 0.364 | 1e-14 | |
| 443695973 | 261 | hypothetical protein CAPTEDRAFT_23017, p | 0.658 | 0.494 | 0.373 | 4e-14 | |
| 443693558 | 502 | hypothetical protein CAPTEDRAFT_189741, | 0.709 | 0.276 | 0.372 | 7e-14 | |
| 443694523 | 364 | hypothetical protein CAPTEDRAFT_227708 [ | 0.464 | 0.25 | 0.457 | 1e-12 | |
| 125901787 | 1222 | pol-like protein [Biomphalaria glabrata] | 0.780 | 0.125 | 0.335 | 2e-12 | |
| 443712830 | 397 | hypothetical protein CAPTEDRAFT_202466 [ | 0.709 | 0.350 | 0.359 | 4e-12 | |
| 443713753 | 266 | hypothetical protein CAPTEDRAFT_215116 [ | 0.653 | 0.481 | 0.325 | 1e-11 | |
| 443733872 | 400 | hypothetical protein CAPTEDRAFT_197082 [ | 0.734 | 0.36 | 0.345 | 1e-11 |
| >gi|443721618|gb|ELU10867.1| hypothetical protein CAPTEDRAFT_200496, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
Score = 87.0 bits (214), Expect = 4e-15, Method: Compositional matrix adjust.
Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 7/138 (5%)
Query: 30 YLTPDNSLSALQSIQNVSSSNP----IAREIRNLLDKNKHVFSLHFTWVPSHVGIAGNEE 85
++ +SLSA+ +I + +P + I+++ + K V F W PSHVGI GNE
Sbjct: 79 FVICSDSLSAIMAIHGMDVRHPYVLQVLYAIKSISQQEKIVV---FMWCPSHVGIPGNEM 135
Query: 86 ADRLAKEALSSNSPPVNTIPINDFKRFFKSKILTTWNTEWANLADNKLRQIKEENRPWNP 145
AD LAKEALSS + +P +D + K I + W EW NKL I PW P
Sbjct: 136 ADTLAKEALSSTNLAELPVPASDLRCLIKKYIRSRWQHEWDEQHSNKLHSIHPTIGPWPP 195
Query: 146 PFSMSRKEQVSITRLRIG 163
R+E++ + R+RIG
Sbjct: 196 CQREKRREEIVLARIRIG 213
|
Source: Capitella teleta Species: Capitella teleta Genus: Capitella Family: Capitellidae Order: Capitellida Class: Polychaeta Phylum: Annelida Superkingdom: Eukaryota |
| >gi|427791807|gb|JAA61355.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791321|gb|JAA61112.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|443695973|gb|ELT96755.1| hypothetical protein CAPTEDRAFT_23017, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|443693558|gb|ELT94903.1| hypothetical protein CAPTEDRAFT_189741, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|443694523|gb|ELT95634.1| hypothetical protein CAPTEDRAFT_227708 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|125901787|gb|ABN58714.1| pol-like protein [Biomphalaria glabrata] | Back alignment and taxonomy information |
|---|
| >gi|443712830|gb|ELU05953.1| hypothetical protein CAPTEDRAFT_202466 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|443713753|gb|ELU06453.1| hypothetical protein CAPTEDRAFT_215116 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|443733872|gb|ELU18078.1| hypothetical protein CAPTEDRAFT_197082 [Capitella teleta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| ASPGD|ASPL0000075333 | 486 | AN10625 [Emericella nidulans ( | 0.301 | 0.121 | 0.412 | 0.00019 |
| ASPGD|ASPL0000075333 AN10625 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Score = 115 (45.5 bits), Expect = 0.00019, P = 0.00019
Identities = 26/63 (41%), Positives = 39/63 (61%)
Query: 34 DNSLSALQSIQNVSSSNP--IAREIRNLLDKNKHV-FSLHFTWVPSHVGIAGNEEADRLA 90
DN + LQ+++N S + I I L+K + ++HF W+P+H G+ GNE+ADR A
Sbjct: 249 DNQ-ATLQALRNPGSQSGQYILEAIIMALNKGRKAGLNVHFRWIPAHRGVEGNEQADRRA 307
Query: 91 KEA 93
KEA
Sbjct: 308 KEA 310
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.316 0.131 0.400 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 196 196 0.00080 111 3 11 22 0.37 33
31 0.44 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 614 (65 KB)
Total size of DFA: 185 KB (2106 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 19.79u 0.11s 19.90t Elapsed: 00:00:08
Total cpu time: 19.79u 0.11s 19.90t Elapsed: 00:00:08
Start: Thu Aug 15 15:51:27 2013 End: Thu Aug 15 15:51:35 2013
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 2e-17 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 6e-13 | |
| cd09277 | 133 | cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI | 4e-09 | |
| cd09280 | 150 | cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase | 2e-08 | |
| COG0328 | 154 | COG0328, RnhA, Ribonuclease HI [DNA replication, r | 1e-05 | |
| cd09278 | 139 | cd09278, RNase_HI_prokaryote_like, RNase HI family | 2e-05 | |
| cd09279 | 128 | cd09279, RNase_HI_archaeal_like, RNAse HI family t | 3e-04 | |
| cd06222 | 123 | cd06222, RNase_H, RNase H is an endonuclease that | 0.001 |
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
Score = 74.2 bits (183), Expect = 2e-17
Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
Query: 18 LTGTAEKSECQVYLTPDNSLSALQSIQNVSSSNPIAREIRNLLDK-NKHVFSLHFTWVPS 76
L + ++ D S +AL+++++ SS+P+ IR + + H + WVP
Sbjct: 53 LREGRRARKITIFS--D-SQAALKALRSPRSSSPLVLRIRKAIRELANHGVKVRLHWVPG 109
Query: 77 HVGIAGNEEADRLAKEALS 95
H GI GNE ADRLAKEA
Sbjct: 110 HSGIEGNERADRLAKEAAK 128
|
Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128 |
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|187701 cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI containing a hybrid binding domain (HBD) at the N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|187704 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase H is longer and more complex than their prokaryotic counterparts and unlike prokaryote, RNase H are essential in higher eukaryote | Back alignment and domain information |
|---|
| >gnl|CDD|223405 COG0328, RnhA, Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|187702 cd09278, RNase_HI_prokaryote_like, RNase HI family found mainly in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|187703 cd09279, RNase_HI_archaeal_like, RNAse HI family that includes Archaeal RNase HI | Back alignment and domain information |
|---|
| >gnl|CDD|187690 cd06222, RNase_H, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 99.61 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 99.6 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 99.59 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 99.56 | |
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 99.47 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 99.33 | |
| KOG3752|consensus | 371 | 98.9 | ||
| PRK13907 | 128 | rnhA ribonuclease H; Provisional | 98.85 | |
| PF13456 | 87 | RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH | 98.79 | |
| PRK07708 | 219 | hypothetical protein; Validated | 98.38 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 98.31 |
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
Probab=99.61 E-value=2.6e-15 Score=113.29 Aligned_cols=80 Identities=36% Similarity=0.553 Sum_probs=62.2
Q ss_pred HHHHHHHHHHH--hc-CCCEEEEecccHHHHHHHhc-----ccC-C--C-hHHHHHHHHHHhccCCceEEEEecCCCCCC
Q psy16693 13 YYQVDLTGTAE--KS-ECQVYLTPDNSLSALQSIQN-----VSS-S--N-PIAREIRNLLDKNKHVFSLHFTWVPSHVGI 80 (196)
Q Consensus 13 ~~~~e~~~~~~--~~-~~~~i~I~tDs~sal~~l~~-----~~~-~--~-~~~~~i~~l~~~~~~~~~v~~~WvpgH~gi 80 (196)
.+.+|+.|+.. +. ....+.|+|||++++..+.. .+. . . ++..+|.+++.. +..|.|.|||||+|+
T Consensus 40 ~~~aEl~Ai~~AL~~~~~~~v~I~tDS~~v~~~l~~~~~~~~~~~~~~~~~i~~~i~~~~~~---~~~v~~~~V~~H~~~ 116 (132)
T PF00075_consen 40 NNRAELQAIIEALKALEHRKVTIYTDSQYVLNALNKWLHGNGWKKTSNGRPIKNEIWELLSR---GIKVRFRWVPGHSGV 116 (132)
T ss_dssp HHHHHHHHHHHHHHTHSTSEEEEEES-HHHHHHHHTHHHHTTSBSCTSSSBHTHHHHHHHHH---SSEEEEEESSSSSSS
T ss_pred hhhhheehHHHHHHHhhcccccccccHHHHHHHHHHhccccccccccccccchhheeecccc---ceEEeeeeccCcCCC
Confidence 57899998752 22 45899999999999998888 332 1 2 466777777733 348999999999999
Q ss_pred -ccchHHhHHHHHHhh
Q psy16693 81 -AGNEEADRLAKEALS 95 (196)
Q Consensus 81 -~gNe~aD~~A~~a~~ 95 (196)
.|||.||+|||+|+.
T Consensus 117 ~~~N~~aD~lAk~a~~ 132 (132)
T PF00075_consen 117 PQGNERADRLAKEAAQ 132 (132)
T ss_dssp HHHHHHHHHHHHHHHH
T ss_pred chhHHHHHHHHHHhcC
Confidence 699999999999974
|
This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids. The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D .... |
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >PRK13907 rnhA ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B | Back alignment and domain information |
|---|
| >PRK07708 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 196 | ||||
| 4b3p_A | 560 | Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A | 4e-04 | ||
| 4b3q_A | 560 | Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A | 5e-04 | ||
| 4b3o_A | 560 | Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A | 5e-04 | ||
| 1s1t_A | 560 | Crystal Structure Of L100i Mutant Hiv-1 Reverse Tra | 5e-04 | ||
| 1s1w_A | 560 | Crystal Structure Of V106a Mutant Hiv-1 Reverse Tra | 5e-04 | ||
| 3ffi_A | 561 | Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Len | 5e-04 | ||
| 3drr_A | 563 | Hiv Reverse Transcriptase Y181c Mutant In Complex W | 5e-04 | ||
| 2rki_A | 560 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 2ynf_A | 563 | Hiv-1 Reverse Transcriptase Y188l Mutant In Complex | 6e-04 | ||
| 1s1x_A | 560 | Crystal Structure Of V108i Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1eet_A | 557 | Hiv-1 Reverse Transcriptase In Complex With The Inh | 6e-04 | ||
| 3med_A | 560 | Hiv-1 K103n Reverse Transcriptase In Complex With T | 6e-04 | ||
| 3jsm_A | 558 | K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linke | 6e-04 | ||
| 2rf2_A | 563 | Hiv Reverse Transcriptase In Complex With Inhibitor | 6e-04 | ||
| 1lwe_A | 560 | Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse | 6e-04 | ||
| 1hni_A | 558 | Structure Of Hiv-1 Reverse Transcriptase In A Compl | 6e-04 | ||
| 1jkh_A | 560 | Crystal Structure Of Y181c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 3kle_A | 562 | Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr | 6e-04 | ||
| 3di6_A | 561 | Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor | 6e-04 | ||
| 1dlo_A | 556 | Human Immunodeficiency Virus Type 1 Length = 556 | 6e-04 | ||
| 1ikv_A | 560 | K103n Mutant Hiv-1 Reverse Transcriptase In Complex | 6e-04 | ||
| 1lw0_A | 560 | Crystal Structure Of T215y Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1jlf_A | 560 | Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1lwc_A | 560 | Crystal Structure Of M184v Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 3kjv_A | 560 | Hiv-1 Reverse Transcriptase In Complex With Dna Len | 6e-04 | ||
| 1hmv_A | 560 | The Structure Of Unliganded Reverse Transcriptase F | 6e-04 | ||
| 1jle_A | 560 | Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1qe1_A | 558 | Crystal Structure Of 3tc-Resistant M184i Mutant Of | 6e-04 | ||
| 3klh_A | 564 | Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr | 6e-04 | ||
| 2jle_A | 566 | Novel Indazole Nnrtis Created Using Molecular Templ | 6e-04 | ||
| 3dmj_A | 560 | Crystal Structure Of Hiv-1 V106a And Y181c Mutant R | 6e-04 | ||
| 2vg5_A | 557 | Crystal Structures Of Hiv-1 Reverse Transcriptase C | 6e-04 | ||
| 1lwf_A | 560 | Crystal Structure Of A Mutant Hiv-1 Reverse Transcr | 6e-04 | ||
| 1n5y_A | 558 | Hiv-1 Reverse Transcriptase Crosslinked To Post- Tr | 6e-04 | ||
| 1ikw_A | 560 | Wild Type Hiv-1 Reverse Transcriptase In Complex Wi | 6e-04 | ||
| 1rev_A | 560 | Hiv-1 Reverse Transcriptase Length = 560 | 6e-04 | ||
| 1s6p_A | 560 | Crystal Structure Of Human Immunodeficiency Virus T | 6e-04 | ||
| 1rt3_A | 560 | Azt Drug Resistant Hiv-1 Reverse Transcriptase Comp | 6e-04 | ||
| 2iaj_A | 560 | Crystal Structure Of K103nY181C MUTANT HIV-1 Revers | 6e-04 | ||
| 1uwb_A | 558 | Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 | 6e-04 | ||
| 3dm2_A | 560 | Crystal Structure Of Hiv-1 K103n Mutant Reverse Tra | 6e-04 | ||
| 3hvt_A | 556 | Structural Basis Of Asymmetry In The Human Immunode | 6e-04 | ||
| 1hpz_A | 560 | Human Immunodeficiency Virus Type 1 Length = 560 | 6e-04 | ||
| 3drs_A | 563 | Hiv Reverse Transcriptase K103n Mutant In Complex W | 6e-04 | ||
| 2ykn_A | 562 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 6e-04 | ||
| 2ykm_A | 562 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 6e-04 | ||
| 3v4i_A | 556 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 6e-04 | ||
| 3ig1_A | 555 | Hiv-1 Reverse Transcriptase With The Inhibitor Beta | 7e-04 | ||
| 3dlk_A | 556 | Crystal Structure Of An Engineered Form Of The Hiv- | 7e-04 | ||
| 3qo9_A | 557 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 7e-04 | ||
| 2i5j_A | 552 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 7e-04 | ||
| 1hys_A | 553 | Crystal Structure Of Hiv-1 Reverse Transcriptase In | 7e-04 | ||
| 3qlh_A | 555 | Hiv-1 Reverse Transcriptase In Complex With Manicol | 7e-04 | ||
| 1hvu_A | 554 | Human Immunodeficiency Virus Type 1 Reverse Transcr | 7e-04 | ||
| 3irx_A | 558 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 7e-04 | ||
| 3klf_A | 557 | Crystal Structure Of Wild-Type Hiv-1 Reverse Transc | 7e-04 | ||
| 2zd1_A | 557 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 7e-04 | ||
| 2ze2_A | 557 | Crystal Structure Of L100iK103N MUTANT HIV-1 Revers | 8e-04 | ||
| 3bgr_A | 557 | Crystal Structure Of K103nY181C MUTANT HIV-1 Revers | 8e-04 | ||
| 1rtd_A | 554 | Structure Of A Catalytic Complex Of Hiv-1 Reverse T | 8e-04 |
| >pdb|4B3P|A Chain A, Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A Unique Rt Conformation And Substrate Interface Length = 560 | Back alignment and structure |
|
| >pdb|4B3Q|A Chain A, Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A Unique Rt Conformation And Substrate Interface Length = 560 | Back alignment and structure |
| >pdb|4B3O|A Chain A, Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A Unique Rt Conformation And Substrate Interface Length = 560 | Back alignment and structure |
| >pdb|1S1T|A Chain A, Crystal Structure Of L100i Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 | Back alignment and structure |
| >pdb|1S1W|A Chain A, Crystal Structure Of V106a Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 | Back alignment and structure |
| >pdb|3FFI|A Chain A, Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Length = 561 | Back alignment and structure |
| >pdb|3DRR|A Chain A, Hiv Reverse Transcriptase Y181c Mutant In Complex With Inhibitor R8e Length = 563 | Back alignment and structure |
| >pdb|2RKI|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With A Triazole Derived Nnrti Length = 560 | Back alignment and structure |
| >pdb|2YNF|A Chain A, Hiv-1 Reverse Transcriptase Y188l Mutant In Complex With Inhibitor Gsk560 Length = 563 | Back alignment and structure |
| >pdb|1S1X|A Chain A, Crystal Structure Of V108i Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1EET|A Chain A, Hiv-1 Reverse Transcriptase In Complex With The Inhibitor Msc204 Length = 557 | Back alignment and structure |
| >pdb|3MED|A Chain A, Hiv-1 K103n Reverse Transcriptase In Complex With Tmc125 Length = 560 | Back alignment and structure |
| >pdb|3JSM|A Chain A, K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linked To Ds-Dna And Complexed With Tenofovir-Diphosphate As The Incoming Nucleotide Substrate Length = 558 | Back alignment and structure |
| >pdb|2RF2|A Chain A, Hiv Reverse Transcriptase In Complex With Inhibitor 7e (Nnrti) Length = 563 | Back alignment and structure |
| >pdb|1LWE|A Chain A, Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse Transcriptase (Rtmn) In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1HNI|A Chain A, Structure Of Hiv-1 Reverse Transcriptase In A Complex With The Nonnucleoside Inhibitor Alpha-Apa R 95845 At 2.8 Angstroms Resolution Length = 558 | Back alignment and structure |
| >pdb|1JKH|A Chain A, Crystal Structure Of Y181c Mutant Hiv-1 Reverse Transcriptase In Complex With Dmp-266(Efavirenz) Length = 560 | Back alignment and structure |
| >pdb|3KLE|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 562 | Back alignment and structure |
| >pdb|3DI6|A Chain A, Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor Length = 561 | Back alignment and structure |
| >pdb|1DLO|A Chain A, Human Immunodeficiency Virus Type 1 Length = 556 | Back alignment and structure |
| >pdb|1IKV|A Chain A, K103n Mutant Hiv-1 Reverse Transcriptase In Complex With Efivarenz Length = 560 | Back alignment and structure |
| >pdb|1LW0|A Chain A, Crystal Structure Of T215y Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1JLF|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1LWC|A Chain A, Crystal Structure Of M184v Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|3KJV|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Dna Length = 560 | Back alignment and structure |
| >pdb|1HMV|A Chain A, The Structure Of Unliganded Reverse Transcriptase From The Human Immunodeficiency Virus Type 1 Length = 560 | Back alignment and structure |
| >pdb|1JLE|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase Length = 560 | Back alignment and structure |
| >pdb|1QE1|A Chain A, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1 Reverse Transcriptase Length = 558 | Back alignment and structure |
| >pdb|3KLH|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To Post-Translocation Aztmp-Terminated Dna (Complex P) Length = 564 | Back alignment and structure |
| >pdb|2JLE|A Chain A, Novel Indazole Nnrtis Created Using Molecular Template Hybridization Based On Crystallographic Overlays Length = 566 | Back alignment and structure |
| >pdb|3DMJ|A Chain A, Crystal Structure Of Hiv-1 V106a And Y181c Mutant Reverse Transcriptase In Complex With Gw564511 Length = 560 | Back alignment and structure |
| >pdb|2VG5|A Chain A, Crystal Structures Of Hiv-1 Reverse Transcriptase Complexes With Thiocarbamate Non-Nucleoside Inhibitors Length = 557 | Back alignment and structure |
| >pdb|1LWF|A Chain A, Crystal Structure Of A Mutant Hiv-1 Reverse Transcriptase (rtmq+m184v: M41l/d67n/k70r/m184v/t215y) In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1N5Y|A Chain A, Hiv-1 Reverse Transcriptase Crosslinked To Post- Translocation Aztmp-Terminated Dna (Complex P) Length = 558 | Back alignment and structure |
| >pdb|1IKW|A Chain A, Wild Type Hiv-1 Reverse Transcriptase In Complex With Efavirenz Length = 560 | Back alignment and structure |
| >pdb|1REV|A Chain A, Hiv-1 Reverse Transcriptase Length = 560 | Back alignment and structure |
| >pdb|1S6P|A Chain A, Crystal Structure Of Human Immunodeficiency Virus Type 1 Reverse Transcriptase (Rt) In Complex With Janssen-R100943 Length = 560 | Back alignment and structure |
| >pdb|1RT3|A Chain A, Azt Drug Resistant Hiv-1 Reverse Transcriptase Complexed With 1051u91 Length = 560 | Back alignment and structure |
| >pdb|2IAJ|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Atp Length = 560 | Back alignment and structure |
| >pdb|1UWB|A Chain A, Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 | Back alignment and structure |
| >pdb|3DM2|A Chain A, Crystal Structure Of Hiv-1 K103n Mutant Reverse Transcriptase In Complex With Gw564511. Length = 560 | Back alignment and structure |
| >pdb|3HVT|A Chain A, Structural Basis Of Asymmetry In The Human Immunodeficiency Virus Type 1 Reverse Transcriptase Heterodimer Length = 556 | Back alignment and structure |
| >pdb|1HPZ|A Chain A, Human Immunodeficiency Virus Type 1 Length = 560 | Back alignment and structure |
| >pdb|3DRS|A Chain A, Hiv Reverse Transcriptase K103n Mutant In Complex With Inhibitor R8d Length = 563 | Back alignment and structure |
| >pdb|2YKN|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With A Difluoromethylbenzoxazole (Dfmb) Pyrimidine Thioether Derivative, A Non-Nucleoside Rt Inhibitor (Nnrti) Length = 562 | Back alignment and structure |
| >pdb|2YKM|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With A Difluoromethylbenzoxazole (Dfmb) Pyrimidine Thioether Derivative, A Non-Nucleoside Rt Inhibitor (Nnrti) Length = 562 | Back alignment and structure |
| >pdb|3V4I|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) With Dna And Azttp Length = 556 | Back alignment and structure |
| >pdb|3IG1|A Chain A, Hiv-1 Reverse Transcriptase With The Inhibitor Beta- Thujaplicinol Bound At The Rnase H Active Site Length = 555 | Back alignment and structure |
| >pdb|3DLK|A Chain A, Crystal Structure Of An Engineered Form Of The Hiv-1 Reverse Transcriptase, Rt69a Length = 556 | Back alignment and structure |
| >pdb|3QO9|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tsao-T, A Non-Nucleoside Rt Inhibitor (Nnrti) Length = 557 | Back alignment and structure |
| >pdb|2I5J|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Dhbnh, An Rnase H Inhibitor Length = 552 | Back alignment and structure |
| >pdb|1HYS|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase In Complex With A Polypurine Tract Rna:dna Length = 553 | Back alignment and structure |
| >pdb|3QLH|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Manicol At The Rnase H Active Site And Tmc278 (rilpivirine) At The Nnrti Binding Pocket Length = 555 | Back alignment and structure |
| >pdb|1HVU|A Chain A, Human Immunodeficiency Virus Type 1 Reverse Transcriptase Complexed With A 33-Base Nucleotide Rna Pseudoknot Length = 554 | Back alignment and structure |
| >pdb|3IRX|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With The Non-Nucleoside Rt Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-Oxo-2, 3-Dihydrobenzo[d]oxazol-5-Yl)-5- (5-Methyl-1,3,4-Oxadiazol-2-Yl)pent-1-Enyl)-2-Methoxy-3- Methylbenzothioate. Length = 558 | Back alignment and structure |
| >pdb|3KLF|A Chain A, Crystal Structure Of Wild-Type Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 557 | Back alignment and structure |
| >pdb|2ZD1|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|2ZE2|A Chain A, Crystal Structure Of L100iK103N MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|3BGR|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|1RTD|A Chain A, Structure Of A Catalytic Complex Of Hiv-1 Reverse Transcriptase: Implications For Nucleoside Analog Drug Resistance Length = 554 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 8e-10 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 3e-06 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 7e-06 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 3e-05 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 4e-05 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 7e-05 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 7e-05 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 1e-04 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 2e-04 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 2e-04 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 6e-04 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 6e-04 |
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Length = 147 | Back alignment and structure |
|---|
Score = 53.9 bits (130), Expect = 8e-10
Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 2/45 (4%)
Query: 50 NPIAREIRNLLDKNKHVFSLHFTWVPSHVGIAGNEEADRLAKEAL 94
N + L+++ + F V +H G N+ D AK AL
Sbjct: 93 NEFTQAYAKLMNQYRG--IYSFEKVKAHSGNEFNDYVDMKAKSAL 135
|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Length = 154 | Back alignment and structure |
|---|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Length = 150 | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Length = 146 | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A Length = 149 | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... Length = 155 | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A Length = 158 | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A Length = 165 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Length = 141 | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A Length = 166 | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Length = 557 | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} Length = 140 | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Length = 555 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 99.68 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 99.67 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 99.65 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 99.62 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 99.6 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 99.6 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 99.57 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 99.52 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 99.51 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 99.44 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 99.39 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 99.31 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 99.3 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 99.24 | |
| 1zbf_A | 142 | Ribonuclease H-related protein; RNAse H, RNA/DNA h | 97.01 | |
| 4htu_A | 134 | Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, | 93.55 |
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
Probab=99.68 E-value=6.5e-17 Score=125.36 Aligned_cols=85 Identities=20% Similarity=0.319 Sum_probs=63.4
Q ss_pred HHHHHHHHHHH--HhcCCCEEEEecccHHHHHHHhccc---CCC--------hH--HHHHHHHHHhccCCceEEEEecCC
Q psy16693 12 IYYQVDLTGTA--EKSECQVYLTPDNSLSALQSIQNVS---SSN--------PI--AREIRNLLDKNKHVFSLHFTWVPS 76 (196)
Q Consensus 12 ~~~~~e~~~~~--~~~~~~~i~I~tDs~sal~~l~~~~---~~~--------~~--~~~i~~l~~~~~~~~~v~~~Wvpg 76 (196)
+...+|+.|+. .+....++.|+|||++++++|.+|. ..+ ++ ...++++++...+...|.|.||||
T Consensus 48 Tnn~aEl~A~i~AL~~~~~~v~i~tDS~~v~~~i~~w~~~W~~~gw~~~~g~~v~n~~l~~~l~~~l~~~~~v~~~wV~g 127 (150)
T 3qio_A 48 TNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWKTADKKPVKNVDLVNQIIEQLIKKEKVYLAWVPA 127 (150)
T ss_dssp CHHHHHHHHHHHHHHHSCSEEEEEESCHHHHHHHHHHHHHHCC------------CHHHHHHHHHHHTTCSEEEEEECCT
T ss_pred CHHHHHHHHHHHHHHhCCCcEEEEeCcHHHHHHHHHHHHHHhhcCcCcCcCcccccHHHHHHHHHHHhhcCceEEEEccC
Confidence 46789999875 3444689999999999999999862 111 11 122344444334456899999999
Q ss_pred CCCCccchHHhHHHHHHhhc
Q psy16693 77 HVGIAGNEEADRLAKEALSS 96 (196)
Q Consensus 77 H~gi~gNe~aD~~A~~a~~~ 96 (196)
|+|++|||.||+||++|+..
T Consensus 128 H~g~~~Ne~AD~LA~~a~~~ 147 (150)
T 3qio_A 128 HKGIGGNEQVDKLVSAGIRK 147 (150)
T ss_dssp TSCCHHHHHHHHHHHTTTSC
T ss_pred cCCChhHHHHHHHHHHHHHH
Confidence 99999999999999999875
|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* | Back alignment and structure |
|---|
| >4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 196 | ||||
| d1mu2a1 | 126 | c.55.3.1 (A:430-555) HIV RNase H (Domain of revers | 3e-08 | |
| d1rila_ | 147 | c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermoph | 6e-07 | |
| d1jl1a_ | 152 | c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli | 5e-06 |
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: HIV RNase H (Domain of reverse transcriptase) species: Human immunodeficiency virus type 2 [TaxId: 11709]
Score = 48.4 bits (114), Expect = 3e-08
Identities = 11/33 (33%), Positives = 19/33 (57%)
Query: 62 KNKHVFSLHFTWVPSHVGIAGNEEADRLAKEAL 94
+ +++ WVP+H GI GN+E D L + +
Sbjct: 94 EMIKKEAIYVAWVPAHKGIGGNQEVDHLVSQGI 126
|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.72 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 99.57 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 99.52 | |
| d1s1ta1 | 110 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.09 | |
| d1zbfa1 | 132 | BH0863-like Ribonuclease H {Bacillus halodurans [T | 98.03 |
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: HIV RNase H (Domain of reverse transcriptase) species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=99.72 E-value=9.1e-18 Score=124.31 Aligned_cols=79 Identities=22% Similarity=0.330 Sum_probs=62.1
Q ss_pred HHHHHHHHHHH--HhcCCCEEEEecccHHHHHHHhcccC--CChHHH-HHHHHHHhccCCceEEEEecCCCCCCccchHH
Q psy16693 12 IYYQVDLTGTA--EKSECQVYLTPDNSLSALQSIQNVSS--SNPIAR-EIRNLLDKNKHVFSLHFTWVPSHVGIAGNEEA 86 (196)
Q Consensus 12 ~~~~~e~~~~~--~~~~~~~i~I~tDs~sal~~l~~~~~--~~~~~~-~i~~l~~~~~~~~~v~~~WvpgH~gi~gNe~a 86 (196)
+.+.||+.|+. .+.....+.|+|||+++++.+.+++. .+.... .+..+.. ...|.|.|||||+|++|||.|
T Consensus 43 tnn~AEl~Ai~~al~~~~~~i~I~tDS~~v~~~~~~~~~~~~~~~~~~~~~~~~~----~~~v~~~wV~gH~g~~gNe~A 118 (126)
T d1mu2a1 43 TNQQAELEAFAMALTDSGPKVNIIVDSQYVMGIVASQPTESESKIVNQIIEEMIK----KEAIYVAWVPAHKGIGGNQEV 118 (126)
T ss_dssp CHHHHHHHHHHHHHHTSCSEEEEEESCHHHHHHHHTCCSEESCHHHHHHHHHHHH----CSEEEEEECCSSSCCTTHHHH
T ss_pred cchHHHHHHHHHHhccCCcceEEEechHHHHHHHhcCCccccchHHHHHHHHhhh----cceeEEEEEeCCCCCcchHHH
Confidence 36789999876 46677899999999999999999764 333333 3333333 237999999999999999999
Q ss_pred hHHHHHHh
Q psy16693 87 DRLAKEAL 94 (196)
Q Consensus 87 D~~A~~a~ 94 (196)
|+||++|.
T Consensus 119 D~LA~~ai 126 (126)
T d1mu2a1 119 DHLVSQGI 126 (126)
T ss_dssp HHHHHTTC
T ss_pred HHHHHhhC
Confidence 99999874
|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|