Psyllid ID: psy1676

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGFP
cccccHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHcHHHHHHHHHHHHHHHHHHccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccEHHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
mskitsenrrtsDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLvkksafpenasnneWARFHFYLGRIKAVRLEYSTAHKNLVQALRKApqtaavgfrQTTQKLAVVVELLlgdipdrqIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYgnqfrtdyTFKLILRLRHNVIKTAIRSigasysritpTKIAeklglespedAEFIIAKAIRDGVIEATLDREKgymqskesadiyctvepqLAFHQRIAFCLDLHNQsvkamryppksygkdlESAEERREREQQDLELAKEMAeedddgfp
mskitsenrrtsdliAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAirsigasysritPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKemaeedddgfp
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKdlesaeerrereqqdlelaKEMAEEDDDGFP
************DLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSV*******************************************
*SK***ENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVK**********************************EED*DGFP
*********RTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPK******************DLELAK***********
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDLESAEERRER***DLELAKEMAE*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDxxxxxxxxxxxxxxxxxxxxxxxxxDDGFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
O61470496 Probable 26S proteasome n yes N/A 0.997 0.689 0.812 1e-159
Q9U5Z8500 Probable 26S proteasome n N/A N/A 0.997 0.684 0.809 1e-158
P25161494 Probable 26S proteasome n yes N/A 0.997 0.692 0.760 1e-151
P14685530 26S proteasome non-ATPase yes N/A 1.0 0.647 0.702 1e-133
Q2KJ46534 26S proteasome non-ATPase yes N/A 1.0 0.642 0.699 1e-133
O43242534 26S proteasome non-ATPase yes N/A 1.0 0.642 0.699 1e-133
O42897497 Probable 26S proteasome r yes N/A 0.982 0.678 0.507 8e-94
P93768488 Probable 26S proteasome n N/A N/A 0.991 0.696 0.544 3e-93
Q9LNU4488 Probable 26S proteasome n yes N/A 0.991 0.696 0.533 7e-91
Q04908504 26S proteasome non-ATPase yes N/A 0.994 0.676 0.514 8e-90
>sp|O61470|PSMD3_ANOGA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2 Back     alignment and function desciption
 Score =  561 bits (1447), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/342 (81%), Positives = 306/342 (89%)

Query: 1   MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
           M+K+  +NRR+ DLIAAK YFYHSRV EL N+L+ +RSFL++RLR ATLRNDFEGQAVLI
Sbjct: 155 MAKVVGQNRRSLDLIAAKSYFYHSRVAELNNDLESIRSFLHSRLRTATLRNDFEGQAVLI 214

Query: 61  NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
           NCLLRNYLHY+LYDQADKLV KS FPE ASNNE ARF +YLGRIKA +LEYS AHK LVQ
Sbjct: 215 NCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQ 274

Query: 121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
           ALRKAPQ AAVGFRQT QKL +VVELLLGDIP+R++FRQA LRR+L PYFQLTQAVRMG 
Sbjct: 275 ALRKAPQQAAVGFRQTVQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGN 334

Query: 181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESP 240
           LQ+F EVL  +G QFR D+TF LI+RLRHNVIKTAIRSIG +YSRI+P  IA KLGL+SP
Sbjct: 335 LQRFGEVLVNFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSP 394

Query: 241 EDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSV 300
           EDAEFI+AKAIRDGVIEATLD EKGYM+SKES DIY T EPQLAFHQRI+FCLDLHNQSV
Sbjct: 395 EDAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSV 454

Query: 301 KAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF 342
           KAMRYPPKSYGK+LESAEERREREQQDLELAKEMAEEDDDGF
Sbjct: 455 KAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF 496
Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Anopheles gambiae (taxid: 7165)
>sp|Q9U5Z8|PSMD3_ANOST Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles stephensi GN=DOXA2 PE=3 SV=1 Back     alignment and function description
>sp|P25161|PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=2 SV=1 Back     alignment and function description
>sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 Back     alignment and function description
>sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 Back     alignment and function description
>sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 Back     alignment and function description
>sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 Back     alignment and function description
>sp|P93768|PSMD3_TOBAC Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1 Back     alignment and function description
>sp|Q9LNU4|PSD31_ARATH Probable 26S proteasome non-ATPase regulatory subunit 3a OS=Arabidopsis thaliana GN=EMB2719 PE=1 SV=3 Back     alignment and function description
>sp|Q04908|PSMD3_CAEEL 26S proteasome non-ATPase regulatory subunit 3 OS=Caenorhabditis elegans GN=rpn-3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
307179423 505 Probable 26S proteasome non-ATPase regul 1.0 0.679 0.836 1e-164
307203008 501 Probable 26S proteasome non-ATPase regul 1.0 0.684 0.833 1e-164
322800341 501 hypothetical protein SINV_02611 [Solenop 1.0 0.684 0.833 1e-163
332024014 491 Putative 26S proteasome non-ATPase regul 0.985 0.688 0.816 1e-163
156542793 497 PREDICTED: probable 26S proteasome non-A 1.0 0.690 0.827 1e-163
389609323 495 regulatory particle non-ATPase 3, Dox-A2 1.0 0.692 0.833 1e-162
340713605 495 PREDICTED: probable 26S proteasome non-A 1.0 0.692 0.816 1e-160
350409395 495 PREDICTED: probable 26S proteasome non-A 1.0 0.692 0.816 1e-160
66546020 495 PREDICTED: probable 26S proteasome non-A 1.0 0.692 0.813 1e-159
380011417 495 PREDICTED: probable 26S proteasome non-A 1.0 0.692 0.813 1e-159
>gi|307179423|gb|EFN67747.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/343 (83%), Positives = 307/343 (89%)

Query: 1   MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
           + KI ++NRRT DLIAAKCYFYHSR +ELTN LDK+R FL+ RLR ATLRNDFEGQAVLI
Sbjct: 163 VQKIAAQNRRTIDLIAAKCYFYHSRAYELTNQLDKIRGFLHLRLRTATLRNDFEGQAVLI 222

Query: 61  NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
           NCLLRNYLHYNLYDQADKLV KS FPE+ASNNEWARF +YLGRIKA RLEYS AHK LVQ
Sbjct: 223 NCLLRNYLHYNLYDQADKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQ 282

Query: 121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
           A+RKAPQT AVGFRQT QKLAV VELLLGDIP+RQIFRQA LRRAL+PYFQLTQAVR+G 
Sbjct: 283 AMRKAPQTTAVGFRQTVQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGN 342

Query: 181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESP 240
           LQ+F EVL  +G QFR D+TF LILRLRHNVIKTAIRSIG SYSRI+PT IA KLGL+S 
Sbjct: 343 LQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIARKLGLDSS 402

Query: 241 EDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSV 300
            DAEFI+AKAIRDGVIEATLD E GYM+SKE+ DIYCT EP LAFHQRI FCLDLHNQSV
Sbjct: 403 VDAEFIVAKAIRDGVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSV 462

Query: 301 KAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGFP 343
           KAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGFP
Sbjct: 463 KAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGFP 505

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307203008|gb|EFN82224.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322800341|gb|EFZ21345.1| hypothetical protein SINV_02611 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332024014|gb|EGI64232.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156542793|ref|XP_001605959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|389609323|dbj|BAM18273.1| regulatory particle non-ATPase 3, Dox-A2 [Papilio xuthus] Back     alignment and taxonomy information
>gi|340713605|ref|XP_003395331.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350409395|ref|XP_003488721.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66546020|ref|XP_623947.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Apis mellifera] Back     alignment and taxonomy information
>gi|380011417|ref|XP_003689802.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
FB|FBgn0261396494 Rpn3 "Regulatory particle non- 0.997 0.692 0.704 7.8e-126
MGI|MGI:98858530 Psmd3 "proteasome (prosome, ma 1.0 0.647 0.650 6.9e-118
RGD|1311470530 Psmd3 "proteasome (prosome, ma 1.0 0.647 0.650 6.9e-118
UNIPROTKB|Q2KJ46534 PSMD3 "26S proteasome non-ATPa 1.0 0.642 0.647 2.3e-117
UNIPROTKB|E2QUY7534 PSMD3 "Uncharacterized protein 1.0 0.642 0.647 2.3e-117
UNIPROTKB|O43242534 PSMD3 "26S proteasome non-ATPa 1.0 0.642 0.647 2.3e-117
ZFIN|ZDB-GENE-040426-1444503 psmd3 "proteasome (prosome, ma 1.0 0.681 0.653 2.3e-117
UNIPROTKB|F1RXA7536 LOC100512253 "Uncharacterized 1.0 0.639 0.646 1e-116
UNIPROTKB|B4DT72356 PSMD3 "26S proteasome non-ATPa 0.877 0.845 0.674 1.7e-107
UNIPROTKB|I3LL55505 I3LL55 "Uncharacterized protei 0.874 0.594 0.617 3.7e-96
FB|FBgn0261396 Rpn3 "Regulatory particle non-ATPase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1236 (440.2 bits), Expect = 7.8e-126, P = 7.8e-126
 Identities = 241/342 (70%), Positives = 285/342 (83%)

Query:     1 MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
             M+KI+ +NRRT DLI AK YFY SRV EL N+L+ +RSFL+ARLR ATLRNDFEGQAVLI
Sbjct:   153 MAKISIQNRRTLDLIGAKSYFYFSRVAELKNSLEGIRSFLHARLRTATLRNDFEGQAVLI 212

Query:    61 NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
             NCLLRNYLHY LYDQADKLVKKS +PE+ASNNEWARF +YLGRIKA +LEYS AHK+LVQ
Sbjct:   213 NCLLRNYLHYALYDQADKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQ 272

Query:   121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
             ALRK+PQ AA+GFRQT QKL +VVELLLG+IP+R +FRQA LR++L  YFQLTQAVR+G 
Sbjct:   273 ALRKSPQHAAIGFRQTVQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGN 332

Query:   181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESP 240
             L++F +V++ YG +F+ D+TF LI+RLRHNVIKTAIRSIG SYSRI+P  IA++L L+S 
Sbjct:   333 LKRFGDVVSQYGPKFQLDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSA 392

Query:   241 EDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSV 300
             EDAEFI++KAIRDGVIEATLD  + +M+SKES DIY T EPQLAFH+RI+FCL+LHNQSV
Sbjct:   393 EDAEFIVSKAIRDGVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSV 452

Query:   301 KAMRYPPKSYGKXXXXXXXXXXXXXXXXXXXKEMAEEDDDGF 342
             KAMRYPPKSYGK                   KEMAE+D+DGF
Sbjct:   453 KAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEDDEDGF 494
GO:0004175 "endopeptidase activity" evidence=ISS;IDA
GO:0000502 "proteasome complex" evidence=ISS
GO:0006508 "proteolysis" evidence=ISS;IDA
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA
GO:0030234 "enzyme regulator activity" evidence=IEA
GO:0042176 "regulation of protein catabolic process" evidence=IEA
MGI|MGI:98858 Psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311470 Psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ46 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUY7 PSMD3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43242 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1444 psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXA7 LOC100512253 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DT72 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL55 I3LL55 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q04908PSMD3_CAEELNo assigned EC number0.51440.99410.6765yesN/A
Q9LNU4PSD31_ARATHNo assigned EC number0.53330.99120.6967yesN/A
P40016RPN3_YEASTNo assigned EC number0.37320.97660.6405yesN/A
Q9U5Z8PSMD3_ANOSTNo assigned EC number0.80990.99700.684N/AN/A
P14685PSMD3_MOUSENo assigned EC number0.70261.00.6471yesN/A
O42897RPN3_SCHPONo assigned EC number0.50720.98250.6780yesN/A
Q1ZXD3PSMD3_DICDINo assigned EC number0.49110.95330.6488yesN/A
Q2KJ46PSMD3_BOVINNo assigned EC number0.69971.00.6423yesN/A
O61470PSMD3_ANOGANo assigned EC number0.81280.99700.6895yesN/A
O43242PSMD3_HUMANNo assigned EC number0.69971.00.6423yesN/A
P25161PSMD3_DROMENo assigned EC number0.76020.99700.6923yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
pfam0837568 pfam08375, Rpn3_C, Proteasome regulatory subunit C 5e-31
pfam01399100 pfam01399, PCI, PCI domain 6e-20
smart0075388 smart00753, PAM, PCI/PINT associated module 3e-17
smart0008888 smart00088, PINT, motif in proteasome subunits, In 3e-17
>gnl|CDD|149439 pfam08375, Rpn3_C, Proteasome regulatory subunit C-terminal Back     alignment and domain information 
 Score =  111 bits (279), Expect = 5e-31
 Identities = 42/67 (62%), Positives = 50/67 (74%)

Query: 274 DIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKE 333
           D+Y T EPQ AF +RI FCL LHN +VKAMRYPP    K+ E AEE RER+Q +LELAKE
Sbjct: 1   DVYSTKEPQQAFDERIQFCLQLHNDAVKAMRYPPDKEKKEEEKAEEARERDQLELELAKE 60

Query: 334 MAEEDDD 340
           ++E D D
Sbjct: 61  LSEGDLD 67

This eukaryotic domain is found at the C-terminus of 26S proteasome regulatory subunits such as the non-ATPase Rpn3 subunit which is essential for proteasomal function. It occurs together with the PCI/PINT domain (pfam01399). Length = 68
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
KOG2581|consensus493 100.0
KOG2688|consensus394 100.0
COG5600413 Transcription-associated recombination protein [DN 99.98
KOG2582|consensus422 99.96
PF0837568 Rpn3_C: Proteasome regulatory subunit C-terminal; 99.95
KOG1497|consensus399 99.78
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.76
KOG1498|consensus439 99.73
KOG1463|consensus411 99.7
KOG1464|consensus440 99.61
KOG2908|consensus380 99.59
COG5159421 RPN6 26S proteasome regulatory complex component [ 99.5
COG5071439 RPN5 26S proteasome regulatory complex component [ 99.47
smart0075388 PAM PCI/PINT associated module. 99.25
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.25
KOG1076|consensus843 98.29
KOG0687|consensus393 98.17
COG5187412 RPN7 26S proteasome regulatory complex component, 98.03
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 98.01
KOG0686|consensus466 97.78
KOG2753|consensus378 97.59
KOG2758|consensus432 97.37
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.3
KOG2072|consensus 988 97.24
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 96.21
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.01
PF1337173 TPR_9: Tetratricopeptide repeat 95.75
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.65
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.64
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.47
PRK15359144 type III secretion system chaperone protein SscB; 95.41
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.4
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.4
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.86
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.43
PRK11788389 tetratricopeptide repeat protein; Provisional 94.2
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 93.84
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 93.49
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.43
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 93.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.12
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.75
CHL00033168 ycf3 photosystem I assembly protein Ycf3 92.7
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 92.56
PRK11788389 tetratricopeptide repeat protein; Provisional 92.34
PRK02603172 photosystem I assembly protein Ycf3; Provisional 92.21
PRK11189296 lipoprotein NlpI; Provisional 92.13
PRK10370198 formate-dependent nitrite reductase complex subuni 91.89
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 91.86
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 91.47
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.17
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 90.76
KOG4162|consensus799 90.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.23
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 89.88
PRK12370553 invasion protein regulator; Provisional 89.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 89.33
cd00189100 TPR Tetratricopeptide repeat domain; typically con 89.26
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 89.18
KOG1840|consensus508 89.06
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 88.22
PRK15174656 Vi polysaccharide export protein VexE; Provisional 88.04
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 86.64
KOG2002|consensus 1018 86.44
cd05804355 StaR_like StaR_like; a well-conserved protein foun 86.33
PRK10803263 tol-pal system protein YbgF; Provisional 86.26
PF12688120 TPR_5: Tetratrico peptide repeat 85.87
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 85.68
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 84.49
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 84.36
KOG2076|consensus 895 84.22
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.1
PRK12370553 invasion protein regulator; Provisional 84.08
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 83.83
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 83.73
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 83.63
KOG2300|consensus629 83.54
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 83.41
KOG1173|consensus611 82.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 82.25
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 81.27
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.91
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 80.57
PF1342844 TPR_14: Tetratricopeptide repeat 80.05
>KOG2581|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.5e-96  Score=695.60  Aligned_cols=340  Identities=68%  Similarity=1.028  Sum_probs=335.3

Q ss_pred             cccchhccchhHHHHHHHHHHHHHHHhhcccHHHHHHHHHHHHHHhhhcCCcchhHHHHHHHHHHHHhhccHHHHHhhhh
Q psy1676           2 SKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVK   81 (343)
Q Consensus         2 ~~~~~~~~~~~d~~~a~~~~y~~~~~e~~~~~~~~~~~l~~~~r~a~~~~~~~~~~~l~n~Llr~yl~~~~~~~a~~li~   81 (343)
                      ..+...|||++|.++||+|||++++||..+++..+|++|++.+|||+++||.+||++++|+|||+|+..+.|++|.++++
T Consensus       154 ~~i~~~nrRtlD~i~ak~~fy~~l~~E~~~~l~~~rs~l~~~lrtAtLrhd~e~qavLiN~LLr~yL~n~lydqa~~lvs  233 (493)
T KOG2581|consen  154 ASISIQNRRTLDLIAAKLYFYLYLSYELEGRLADIRSFLHALLRTATLRHDEEGQAVLINLLLRNYLHNKLYDQADKLVS  233 (493)
T ss_pred             HHHHhcchhhHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHhhhcCcchhHHHHHHHHHHHHhhhHHHHHHHHHhh
Confidence            34677899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCCChHHHHHHHHHHHHHHHHhhCHHHHHHHHHHHHhhCCccchHHHHHHHHHHHHHHHHhcCCCCChhhhhhHh
Q psy1676          82 KSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAV  161 (343)
Q Consensus        82 k~~~p~~~~~~~~~~Y~YY~Gri~~~~~~y~~A~~~L~~A~~~~~~~sa~~~~~~i~K~li~v~LL~G~iP~~~~~~~~~  161 (343)
                      |+.+|+.+++++++||+||.|+|.+++++|+.|.++|.+|++++|+..+.||++++.||+|++.|++|+||++++|.+|.
T Consensus       234 K~~~pe~~snne~ARY~yY~GrIkaiqldYssA~~~~~qa~rkapq~~alGf~q~v~k~~ivv~ll~geiPers~F~Qp~  313 (493)
T KOG2581|consen  234 KSVYPEAASNNEWARYLYYLGRIKAIQLDYSSALEYFLQALRKAPQHAALGFRQQVNKLMIVVELLLGEIPERSVFRQPG  313 (493)
T ss_pred             cccCccccccHHHHHHHHHHhhHHHhhcchhHHHHHHHHHHHhCcchhhhhHHHHHHHHHHHHHHHcCCCcchhhhcCcc
Confidence            99999999999999999999999999999999999999999999988789999999999999999999999999999999


Q ss_pred             HhhhhhhhHHHHHHHHhCCHHHHHHHHHhccccccccccHHHHHHHHHHHHHHHHHHHhhcccccChHHHHHHhCCCCHH
Q psy1676         162 LRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPE  241 (343)
Q Consensus       162 l~~~l~~Y~~L~~Av~~Gdl~~f~~~l~~~~~~f~~d~~~~Lv~~l~~~v~r~~ir~i~~~ys~Isl~dIa~~l~l~s~~  241 (343)
                      +++.|.||..|++||+.||+++|+++++++...|..||+|.|+.|||++||+++||+|+.+|||||+.|||++|+++|++
T Consensus       314 ~~ksL~~Yf~Lt~AVr~gdlkkF~~~leq~k~~f~~D~ty~LivRLR~NVIkTgIR~ISlsYSRISl~DIA~kL~l~See  393 (493)
T KOG2581|consen  314 MRKSLRPYFKLTQAVRLGDLKKFNETLEQFKDKFQADGTYTLIVRLRHNVIKTGIRKISLSYSRISLQDIAKKLGLNSEE  393 (493)
T ss_pred             HHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhhCCcchHHHHHHHHHHHHhhhheeeeeeeccHHHHHHHhcCCCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHcCCceEEeeCCCceEEEccCccccccccchHHHHHHHHHHHHhhHHHhhhcCCCCCCCCcchhhHHHHH
Q psy1676         242 DAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKDLESAEERR  321 (343)
Q Consensus       242 e~E~ila~lI~~G~I~a~Id~~~g~v~~~~~~~v~s~~ep~~~~~~rI~~cl~l~~~~~~am~~~~~~~~~~~~~~~~~~  321 (343)
                      ++|+||+++|+||.|+|+|||++|+|++++..++|+|.+|+.+|+.||+||++|||++|+||||||+.| +++|++|++|
T Consensus       394 d~EyiVakAIRDGvIea~Id~~~g~m~skE~~diy~t~epQ~~f~~rI~fCl~LhN~~vkamRyPp~~~-~~~Es~E~~r  472 (493)
T KOG2581|consen  394 DAEYIVAKAIRDGVIEAKIDHEDGFMQSKETFDIYSTREPQTAFDERIRFCLQLHNEAVKAMRYPPKKK-KDLESAEKRR  472 (493)
T ss_pred             hHHHHHHHHHHhccceeeeccccCceehhhhhhhhccCCchhhHhHHHHHHHHHHHHHHHHhcCCCcch-hhHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999 9999999999


Q ss_pred             HhhHhhHHHHHHhccccCCCC
Q psy1676         322 EREQQDLELAKEMAEEDDDGF  342 (343)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~  342 (343)
                      ||||||+|+||||+|||||||
T Consensus       473 ereqq~~e~akemae~Ddd~F  493 (493)
T KOG2581|consen  473 EREQQELELAKEMAEEDDDDF  493 (493)
T ss_pred             hhhhhHHHHHHHhhhcccCCC
Confidence            999999999999999999998

>KOG2688|consensus Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2582|consensus Back     alignment and domain information
>PF08375 Rpn3_C: Proteasome regulatory subunit C-terminal; InterPro: IPR013586 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG1498|consensus Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG2908|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>KOG1076|consensus Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>KOG2753|consensus Back     alignment and domain information
>KOG2758|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2072|consensus Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
4b4t_S523 Near-Atomic Resolution Structural Model Of The Yeas 1e-62
>pdb|4B4T|S Chain S, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 523 Back     alignment and structure 
Iteration: 1

 Score =  236 bits (602), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 202/311 (64%), Gaps = 12/311 (3%)
Query: 8   NRRTSDLIAAKCYFYHSRVHEL---------TNNLDKV-RSFLNARLRIATLRNDFEGQA 57
           N R+ +LI AK +FY    HE          ++N + + RS +   L+IA+L++D E +A
Sbjct: 172 NLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKA 231
Query: 58  VLINCLLRNYLHYNLYDQADKLVKKSAFPE-NASNNEWARFHFYLGRIKAVRLEYSTAHK 116
           +LIN +LR++L+    D A   + K  +P  + S++  AR+ FYL +I A++L+YSTA++
Sbjct: 232 MLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANE 291
Query: 117 NLVQALRKAPQTA-AVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQA 175
            ++ A+RKAP  + ++GF Q + KL   ++LL+GDIP+   F Q+ ++++L PY+ LT+A
Sbjct: 292 YIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKA 351
Query: 176 VRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKL 235
           V++G+L+KF   +T Y      D T++L +RLR NVIKT IR I  +Y +I+   I  KL
Sbjct: 352 VKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKL 411
Query: 236 GLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDL 295
            L+S +  E+++++AIRDGVIEA ++ E G++++ E  +IY + +PQ  F +RI F   L
Sbjct: 412 NLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQL 471
Query: 296 HNQSVKAMRYP 306
           H++ + +MRYP
Sbjct: 472 HDEYLVSMRYP 482

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 2e-51
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 2e-46
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 2e-12
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Length = 455 Back     alignment and structure
 Score =  175 bits (445), Expect = 2e-51
 Identities = 43/278 (15%), Positives = 88/278 (31%), Gaps = 41/278 (14%)

Query: 59  LINCLLRNYLHYNLYDQADKLVK----KSAFP--ENASNNEWARFHFYLGRIKAVRLEYS 112
           L+N L   Y           + K    KS          ++   + + LGR   +  +  
Sbjct: 178 LVNKLNNIYFRIESPQLCSNIFKNFQPKSMLAHFNEYQLDQQIEYRYLLGRYYLLNSQVH 237

Query: 113 TAHKNLVQALRKAPQTAAVGFRQTTQK-----LAVVVELLLGDIPDRQIFRQAVLRRALS 167
            A     +A +            T          +   L+LG +      R  + +  + 
Sbjct: 238 NAFVQFNEAFQSLLNLPLTNQAITRNGTRILNYMIPTGLILGKMVKWGPLRPFLSQETID 297

Query: 168 PYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLIL---------------------- 205
            +  L + VR G +Q  +  L              ++L                      
Sbjct: 298 NWSVLYKHVRYGNIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLIKTVIKSWTTE 357

Query: 206 ----RLRHNVIKTAIR-SIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATL 260
               +L +++I+  ++ SIG ++      +I    G+ SP++ E ++   I  G++ A  
Sbjct: 358 WGQNKLPYSLIERVLQLSIGPTFEDPGAQEITIYNGIHSPKNVENVLVTLINLGLLRANC 417

Query: 261 DREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQ 298
             +      K++  I    E     ++RI      H+ 
Sbjct: 418 FPQLQLCVVKKTTMIQ---EIVPPVNERITKMFPAHSH 452
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 100.0
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 100.0
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 100.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 99.96
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 99.93
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.86
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 99.76
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.73
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 99.55
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.32
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 98.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.95
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.5
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.41
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.38
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.31
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.25
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.21
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.2
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.12
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.12
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.0
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.95
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.59
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.51
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.43
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.41
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.39
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.38
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 96.38
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.38
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.31
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.31
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.3
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.22
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.22
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 96.18
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.1
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 95.99
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.97
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.96
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 95.89
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.86
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.77
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.74
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.73
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.66
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.59
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.54
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.45
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.44
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.39
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.38
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.31
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.29
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.22
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.08
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.01
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.99
3u4t_A272 TPR repeat-containing protein; structural genomics 94.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.93
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.93
3k9i_A117 BH0479 protein; putative protein binding protein, 94.89
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 94.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 94.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.69
2gw1_A514 Mitochondrial precursor proteins import receptor; 94.65
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.5
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.49
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.37
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.32
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.15
3u4t_A272 TPR repeat-containing protein; structural genomics 94.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 93.91
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 93.87
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 93.75
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.68
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 93.55
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 93.43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.38
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.34
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.32
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.2
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 93.15
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 93.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 92.99
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 92.85
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.55
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.33
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.0
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.93
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 91.84
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 91.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 91.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 91.62
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 91.55
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 91.51
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 91.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 91.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.29
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 91.27
2l6j_A111 TPR repeat-containing protein associated with HSP; 91.26
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 91.11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.0
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 90.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 90.9
2gw1_A 514 Mitochondrial precursor proteins import receptor; 90.89
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 90.87
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.86
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 90.81
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 90.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 90.67
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 90.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 90.5
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 90.24
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 90.07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 90.06
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 89.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 89.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 89.2
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 89.11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 88.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 88.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 88.41
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 88.28
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 88.1
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 87.96
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 87.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 87.35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 87.04
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 86.43
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 85.9
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 84.09
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 83.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 83.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 82.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 81.82
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 81.8
1qbj_A81 Protein (double-stranded RNA specific adenosine D 81.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 81.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 80.57
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.53
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.2e-86  Score=663.13  Aligned_cols=335  Identities=38%  Similarity=0.660  Sum_probs=234.9

Q ss_pred             cccchhccchhHHHHHHHHHHHHHHHhhcccHH----------HHHHHHHHHHHHhhhcCCcchhHHHHHHHHHHHHhhc
Q psy1676           2 SKITSENRRTSDLIAAKCYFYHSRVHELTNNLD----------KVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYN   71 (343)
Q Consensus         2 ~~~~~~~~~~~d~~~a~~~~y~~~~~e~~~~~~----------~~~~~l~~~~r~a~~~~~~~~~~~l~n~Llr~yl~~~   71 (343)
                      ++++++||||||+|+||+||||||+||+.+++.          +||+.|++++|||++|||.++|++++|+|+|+|++.+
T Consensus       166 ~~l~~~nrrtlD~l~ak~~fY~s~~~e~~~~~~~~~~~~~~~~~ir~~Ll~~~rta~lr~D~~~qa~l~nllLRnYL~~~  245 (523)
T 4b4t_S          166 NLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNG  245 (523)
T ss_dssp             -------------------------------------CHHHHHHHHTHHHHHHHHCCSCSSSCHHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHhHHhHHHHHHHHHHHHHHHHHHhcccccccccccchhhHHHHHHHHHHHHhcccCcchhHHHHHHHHHHHHccC
Confidence            578999999999999999999999999998775          4999999999999999999999999999999999999


Q ss_pred             cHHHHHhhhhhcCCCCC-CChHHHHHHHHHHHHHHHHhhCHHHHHHHHHHHHhhCCcc-chHHHHHHHHHHHHHHHHhcC
Q psy1676          72 LYDQADKLVKKSAFPEN-ASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQT-AAVGFRQTTQKLAVVVELLLG  149 (343)
Q Consensus        72 ~~~~a~~li~k~~~p~~-~~~~~~~~Y~YY~Gri~~~~~~y~~A~~~L~~A~~~~~~~-sa~~~~~~i~K~li~v~LL~G  149 (343)
                      .|++|.++++|+.||++ .+++|+++|+||.|||++++++|.+|+++|++|+++||+. .+.+|++.++||+|||.||+|
T Consensus       246 ~y~qA~~lvsk~~fP~~~~sn~q~~rY~YY~GRI~a~q~~Y~eA~~~L~~A~rkap~~~~a~gfr~~a~K~lI~V~LLlG  325 (523)
T 4b4t_S          246 EVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMG  325 (523)
T ss_dssp             CSTTHHHHHHHHCSCTTTSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHTSSCSCSSSCSHHHHHHHHHHHHHHHHHT
T ss_pred             cHHHHHHHHhcCcCCcccCCHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCcchhhhhHHHHHHHHHHhHHhhcC
Confidence            99999999999999986 6899999999999999999999999999999999999876 467899999999999999999


Q ss_pred             CCCChhhhhhHhHhhhhhhhHHHHHHHHhCCHHHHHHHHHhccccccccccHHHHHHHHHHHHHHHHHHHhhcccccChH
Q psy1676         150 DIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPT  229 (343)
Q Consensus       150 ~iP~~~~~~~~~l~~~l~~Y~~L~~Av~~Gdl~~f~~~l~~~~~~f~~d~~~~Lv~~l~~~v~r~~ir~i~~~ys~Isl~  229 (343)
                      ++|++++|.++.++..+.||.+|++||+.||+..|+.++++|+..|.+||+|+||++|+++|+|++||+|+++|++||++
T Consensus       326 ~iP~r~lf~q~~l~~~L~pY~~Lv~Avr~GdL~~F~~~L~~h~~~F~~Dgty~LI~rLr~~vir~~irkis~~YsrIsL~  405 (523)
T 4b4t_S          326 DIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLR  405 (523)
T ss_dssp             CCCCHHHHTTTSCHHHHHHHHHHHHHHHHTCHHHHHHHHHHTHHHHHHTTCTHHHHHHHHHHHHHHHHHSCCCSSEECHH
T ss_pred             CCCChHHhhchhHHHHHHHHHHHHHHHHcCCHHHHHHHHHHhcceeccCChhHHHHHHHHHHHHHHHHHHHHHHhcccHH
Confidence            99999999999988899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCHHHHHHHHHHhHHcCCceEEeeCCCceEEEccCccccccccchHHHHHHHHHHHHhhHHHhhhcCCCCCC
Q psy1676         230 KIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKS  309 (343)
Q Consensus       230 dIa~~l~l~s~~e~E~ila~lI~~G~I~a~Id~~~g~v~~~~~~~v~s~~ep~~~~~~rI~~cl~l~~~~~~am~~~~~~  309 (343)
                      |||.+++++|+++|||+||+||.+|.|+|+|||++|+|+|++.+|+|+|.||+.+||+||++|++|||++||||||||++
T Consensus       406 dIa~kL~L~s~eeaE~iVAkmI~dG~I~A~Idh~~g~v~ske~~d~yst~ep~~af~~RI~~cl~L~ne~vkaMryp~~~  485 (523)
T 4b4t_S          406 DICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDK  485 (523)
T ss_dssp             HHHHHHHHHHSSCHHHHHHHHHHHTSSCCEECTTTCCEECCSSSCC----------------------------------
T ss_pred             HHHHHhCCCCHHHHHHHHHHHHHcCCceEEEecCCCEEEeCccccccccHHHHHHHHHHHHHHHHHHHHHHHHccCCccc
Confidence            99999999888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcchhhHHHHHHhhH-hhHHHHHHhcc
Q psy1676         310 YGKDLESAEERREREQ-QDLELAKEMAE  336 (343)
Q Consensus       310 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~  336 (343)
                      ++++.+++++++++++ .+.+++.+++|
T Consensus       486 ~~~~~~~~~~~~~~~~~~~~~~~d~~~d  513 (523)
T 4b4t_S          486 KTQQNEKSENGENDDDTLDGDLMDDMSD  513 (523)
T ss_dssp             ----------------------------
T ss_pred             chhhHHHHHHHhhhhhhhhhcccccccc
Confidence            9888888887776654 45566666654
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 9e-16
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 69.4 bits (170), Expect = 9e-16
 Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 207 LRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKG- 265
           L   VI+  + S    Y+ IT  ++   L +     AE I ++ I +G +   +D+  G 
Sbjct: 12  LDRAVIEHNLLSASKLYNNITFEELGALLEIP-AAKAEKIASQMITEGRMNGFIDQIDGI 70

Query: 266 -YMQSKESAD 274
            + +++E++ 
Sbjct: 71  VHFETREASG 80

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.38
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.01
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.97
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 95.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.59
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.25
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.6
d1hz4a_366 Transcription factor MalT domain III {Escherichia 94.45
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.34
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.2
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.16
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.15
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.98
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.32
d1hz4a_366 Transcription factor MalT domain III {Escherichia 93.19
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 93.04
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.96
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 92.88
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 92.49
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 92.01
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 91.56
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 91.27
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 90.35
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 90.26
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 89.67
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 89.31
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 89.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 88.82
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 88.75
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 88.46
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 86.66
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.03
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 85.86
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.39
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 85.12
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 83.42
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 80.69
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 80.31
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 80.03
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.38  E-value=3.3e-13  Score=102.01  Aligned_cols=68  Identities=22%  Similarity=0.305  Sum_probs=63.6

Q ss_pred             HHHHHHHHHHHHHHHhhcccccChHHHHHHhCCCCHHHHHHHHHHhHHcCCceEEeeCCCceEEEccCc
Q psy1676         205 LRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPEDAEFIIAKAIRDGVIEATLDREKGYMQSKESA  273 (343)
Q Consensus       205 ~~l~~~v~r~~ir~i~~~ys~Isl~dIa~~l~l~s~~e~E~ila~lI~~G~I~a~Id~~~g~v~~~~~~  273 (343)
                      .-|+.++++++|+++++.|++|+++++|+.++++ ++++|.+|++||.+|.|+|+|||.+|+|.|....
T Consensus        10 t~L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~-~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e   77 (84)
T d1ufma_          10 SILDRAVIEHNLLSASKLYNNITFEELGALLEIP-AAKAEKIASQMITEGRMNGFIDQIDGIVHFETRE   77 (84)
T ss_dssp             CCCCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSC-HHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSS
T ss_pred             HHHHHHHHHHHHHHHHHhhceeeHHHHHHHHCCC-HHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCC
Confidence            3467889999999999999999999999999995 9999999999999999999999999999998754
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure