Psyllid ID: psy16825
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| 242021609 | 448 | retinoid X receptor, putative [Pediculus | 0.628 | 0.256 | 0.830 | 8e-52 | |
| 213513284 | 415 | estrogen-related receptor [Tribolium cas | 0.546 | 0.240 | 0.92 | 2e-49 | |
| 345496190 | 438 | PREDICTED: steroid hormone receptor ERR2 | 0.612 | 0.255 | 0.822 | 2e-49 | |
| 259906648 | 401 | estrogen receptor-like protein [Teleogry | 0.524 | 0.239 | 0.958 | 4e-49 | |
| 109689232 | 505 | estrogen receptor-related receptor homol | 0.535 | 0.194 | 0.949 | 5e-49 | |
| 345496188 | 450 | PREDICTED: steroid hormone receptor ERR2 | 0.590 | 0.24 | 0.831 | 6e-49 | |
| 170053275 | 446 | estrogen-related receptor [Culex quinque | 0.644 | 0.264 | 0.798 | 6e-49 | |
| 158301679 | 507 | AGAP001743-PA [Anopheles gambiae str. PE | 0.535 | 0.193 | 0.949 | 7e-49 | |
| 307201567 | 426 | Steroid hormone receptor ERR2 [Harpegnat | 0.612 | 0.262 | 0.822 | 8e-49 | |
| 157136394 | 447 | estrogen-related receptor (ERR) [Aedes a | 0.535 | 0.219 | 0.939 | 8e-49 |
| >gi|242021609|ref|XP_002431237.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212516486|gb|EEB18499.1| retinoid X receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 208 bits (529), Expect = 8e-52, Method: Compositional matrix adjust.
Identities = 98/118 (83%), Positives = 104/118 (88%), Gaps = 3/118 (2%)
Query: 3 IKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRR 62
I+E++LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPA+NDCEINKRRR
Sbjct: 106 IREDDLPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPAANDCEINKRRR 165
Query: 63 KACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL---LSQQWPPNKSIPSLED 117
KACQACRFQKCLR GMLKEGVRLDRVRGGRQKYRRN D + P +PSLED
Sbjct: 166 KACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRNTDTPYQIHSMLPLKPYLPSLED 223
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|213513284|ref|NP_001135406.1| estrogen-related receptor [Tribolium castaneum] gi|270011014|gb|EFA07462.1| estrogen-related receptor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345496190|ref|XP_001604033.2| PREDICTED: steroid hormone receptor ERR2 isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|259906648|gb|ACW84414.1| estrogen receptor-like protein [Teleogryllus emma] | Back alignment and taxonomy information |
|---|
| >gi|109689232|dbj|BAE96770.1| estrogen receptor-related receptor homolog [Anopheles stephensi] | Back alignment and taxonomy information |
|---|
| >gi|345496188|ref|XP_003427670.1| PREDICTED: steroid hormone receptor ERR2 isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|170053275|ref|XP_001862599.1| estrogen-related receptor [Culex quinquefasciatus] gi|167873854|gb|EDS37237.1| estrogen-related receptor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158301679|ref|XP_321343.4| AGAP001743-PA [Anopheles gambiae str. PEST] gi|157012589|gb|EAA00848.5| AGAP001743-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|307201567|gb|EFN81329.1| Steroid hormone receptor ERR2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|157136394|ref|XP_001663736.1| estrogen-related receptor (ERR) [Aedes aegypti] gi|108869963|gb|EAT34188.1| AAEL013546-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| UNIPROTKB|F1MBX3 | 422 | ESRRA "Uncharacterized protein | 0.513 | 0.222 | 0.872 | 2.6e-51 | |
| UNIPROTKB|F1PFF7 | 613 | ESRRA "Steroid hormone recepto | 0.513 | 0.153 | 0.872 | 2.6e-51 | |
| UNIPROTKB|Q6QMY5 | 422 | ESRRA "Steroid hormone recepto | 0.513 | 0.222 | 0.872 | 2.6e-51 | |
| UNIPROTKB|F1RQP2 | 422 | ESRRA "Uncharacterized protein | 0.513 | 0.222 | 0.872 | 2.6e-51 | |
| MGI|MGI:1346831 | 422 | Esrra "estrogen related recept | 0.513 | 0.222 | 0.872 | 2.6e-51 | |
| RGD|1583866 | 422 | Esrra "estrogen related recept | 0.513 | 0.222 | 0.872 | 2.6e-51 | |
| UNIPROTKB|F1N0K9 | 478 | LOC100852315 "Uncharacterized | 0.508 | 0.194 | 0.838 | 2e-49 | |
| UNIPROTKB|E2QSQ7 | 441 | ESRRB "Uncharacterized protein | 0.508 | 0.210 | 0.838 | 2e-49 | |
| UNIPROTKB|F6V776 | 438 | ESRRB "Uncharacterized protein | 0.508 | 0.212 | 0.838 | 2e-49 | |
| UNIPROTKB|E7EWD9 | 508 | ESRRB "Steroid hormone recepto | 0.508 | 0.183 | 0.838 | 2e-49 |
| UNIPROTKB|F1MBX3 ESRRA "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 462 (167.7 bits), Expect = 2.6e-51, Sum P(2) = 2.6e-51
Identities = 82/94 (87%), Positives = 90/94 (95%)
Query: 8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
LP+RLCLVCGDVASG+HYGVASCEACKAFFKRTIQG+IEY+CPASN+CEI KRRRKACQA
Sbjct: 74 LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQA 133
Query: 68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 101
CRF KCLR GMLKEGVRLDRVRGGRQKY+R P++
Sbjct: 134 CRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEV 167
|
|
| UNIPROTKB|F1PFF7 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6QMY5 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQP2 ESRRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1346831 Esrra "estrogen related receptor, alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1583866 Esrra "estrogen related receptor, alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N0K9 LOC100852315 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QSQ7 ESRRB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6V776 ESRRB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EWD9 ESRRB "Steroid hormone receptor ERR2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 2e-61 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 7e-44 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 5e-41 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 1e-38 | |
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 1e-37 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 1e-35 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 8e-34 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 1e-32 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 1e-32 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 1e-30 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 7e-30 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 1e-28 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 4e-28 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 1e-27 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 1e-27 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 1e-26 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 3e-26 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 1e-25 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 1e-25 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 2e-25 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 2e-25 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 3e-25 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 3e-25 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 1e-23 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 2e-23 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 7e-23 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 1e-22 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 2e-22 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 6e-22 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 8e-22 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 1e-21 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 1e-21 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 1e-21 | |
| cd07160 | 101 | cd07160, NR_DBD_LXR, DNA-binding domain of Liver X | 1e-20 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 2e-20 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 2e-20 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 4e-20 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 7e-20 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 1e-19 | |
| cd06946 | 221 | cd06946, NR_LBD_ERR, The ligand binding domain of | 4e-15 | |
| cd07068 | 221 | cd07068, NR_LBD_ER_like, The ligand binding domain | 4e-12 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 8e-05 |
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Score = 185 bits (470), Expect = 2e-61
Identities = 78/93 (83%), Positives = 87/93 (93%)
Query: 9 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQAC 68
P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQAC
Sbjct: 3 PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQAC 62
Query: 69 RFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 101
RF KCL+ GMLKEGVRLDRVRGGRQKY+R D
Sbjct: 63 RFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDA 95
|
DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 97 |
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| KOG4215|consensus | 432 | 100.0 | ||
| KOG4217|consensus | 605 | 100.0 | ||
| KOG4216|consensus | 479 | 100.0 | ||
| KOG4218|consensus | 475 | 100.0 | ||
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 100.0 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 99.98 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 99.98 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 99.98 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 99.97 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 99.97 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 99.97 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 99.97 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 99.97 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 99.97 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 99.97 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 99.97 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 99.97 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 99.97 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 99.97 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 99.97 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 99.97 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 99.97 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 99.97 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 99.97 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 99.97 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 99.97 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 99.97 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 99.97 | |
| KOG4846|consensus | 538 | 99.97 | ||
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 99.97 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 99.97 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 99.97 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 99.97 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 99.97 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 99.97 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 99.97 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 99.97 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 99.97 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 99.97 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 99.97 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 99.97 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 99.97 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 99.96 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 99.95 | |
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 99.44 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.4 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 99.4 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.39 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.39 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.37 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.36 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.36 | |
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 99.35 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 99.35 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.35 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.35 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 99.35 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 99.34 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 99.33 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 99.33 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.33 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.32 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.31 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.31 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.3 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.29 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.28 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 99.28 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 99.27 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 99.26 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.26 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 99.26 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 99.25 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.23 | |
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.22 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.18 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.16 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.15 | |
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 99.14 | |
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.12 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.11 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 98.98 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 98.69 | |
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 98.67 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 98.07 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 89.51 |
| >KOG4215|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-51 Score=323.82 Aligned_cols=173 Identities=34% Similarity=0.661 Sum_probs=152.7
Q ss_pred CCCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeeccc
Q psy16825 9 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRV 88 (183)
Q Consensus 9 ~~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r~ 88 (183)
....|.||||++.|.|||+.+|+||||||||+|.++..|+|+.+.+|.|||+.|+.||+|||+||+++||+++|||.+|+
T Consensus 18 ~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERD 97 (432)
T KOG4215|consen 18 VAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERD 97 (432)
T ss_pred ccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccc
Confidence 34679999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccccCCCCC--CC---------------------------CC---CC------------------------CCCCC
Q psy16825 89 RGGRQKYRRNPDL--LS---------------------------QQ---WP------------------------PNKSI 112 (183)
Q Consensus 89 ~~~~~~~~~~~~~--~~---------------------------~~---~~------------------------~~k~i 112 (183)
+.+.++....... .+ .+ -+ |.|.+
T Consensus 98 rIg~Rr~~~~~~n~~~~~id~L~~aE~~~~q~~~srs~~~~~~~~d~r~~~~n~~~at~~Dv~eSm~qqLlllVEWAK~i 177 (432)
T KOG4215|consen 98 RIGSRRPSYEAGNENSPSIDALVQAEALVRQLRSSRSGGVPGIDGDIRQGPPNKKIATENDVCESMKQQLLLLVEWAKYI 177 (432)
T ss_pred cccccCCCCCCCCCCchhHHHHHhHHHHHhhhhccccccCcCcchhhhcCccccccccHHHHHHHHHHHHHHHHHHHHhc
Confidence 9877654433211 00 00 00 11889
Q ss_pred CCccccccccc--------------------------------------------------chhhhhhhhchhcccChhH
Q psy16825 113 PSLEDLERNTE--------------------------------------------------ISCTQVIDRLEHVAVSKEE 142 (183)
Q Consensus 113 P~f~~L~~~dq--------------------------------------------------~~~~~lv~~~~~l~~~~~E 142 (183)
|.|.+++.+|| +++.+++..|++|++|..|
T Consensus 178 ~~F~el~l~DqvaLLk~~a~~hllLg~a~RSm~l~~v~ll~N~~v~~~~~~~~~eis~v~~RIiDElv~Pmr~L~md~~E 257 (432)
T KOG4215|consen 178 PPFCELPLDDQVALLKAHAGQHLLLGAAFRSMHLKDVCLLNNTYVLHRHAPDLPEISRVAPRIIDELVNPMRRLQMDEIE 257 (432)
T ss_pred cchhcCCchhHHHHHHccchhhhhhhhhhccccccceEEecCceeeccCCCChHHHHHHHHHHHHHHhhHHHHhccchHH
Confidence 99999999999 5678999999999999999
Q ss_pred HHHHHHHHhcCCCCC-CCchh--HHHHHHHHHHHHHHHHHHh
Q psy16825 143 YYFLKALVLANSDVK-LDEFS--SLKKFRNSILSSLGDCIYV 181 (183)
Q Consensus 143 ~~~lkai~L~~~d~~-L~~~~--~v~~~~~~~~~~L~~~~~~ 181 (183)
|+|||||+||+||+. |++.. .|++.+++++.+|..||.-
T Consensus 258 y~cLKAi~FfdP~akGis~~s~~~I~~aR~~vl~sLe~yi~d 299 (432)
T KOG4215|consen 258 YVCLKAIAFFDPDAKGLSDPSQIRIREARNRVLKSLEAYISD 299 (432)
T ss_pred HHHHHHHHhcCccccccCCchHhHHHHHHHHHHHHHHHHHhh
Confidence 999999999999986 99988 8999999999999999964
|
|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 183 | ||||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 9e-43 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 4e-26 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 4e-25 | ||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 9e-25 | ||
| 1hcp_A | 76 | Dna Recognition By The Oestrogen Receptor: From Sol | 1e-23 | ||
| 4aa6_E | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 4e-23 | ||
| 4aa6_A | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 4e-23 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 2e-22 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 7e-22 | ||
| 1ynw_B | 99 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 1e-21 | ||
| 1dsz_B | 85 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 3e-21 | ||
| 1rxr_A | 83 | High Resolution Solution Structure Of The Retinoid | 3e-20 | ||
| 1by4_A | 82 | Structure And Mechanism Of The Homodimeric Assembly | 3e-20 | ||
| 1hlz_A | 94 | Crystal Structure Of The Orphan Nuclear Receptor Re | 7e-20 | ||
| 1r0n_A | 81 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 9e-20 | ||
| 1dsz_A | 86 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 1e-19 | ||
| 2han_A | 93 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 3e-19 | ||
| 4hn5_A | 117 | Gr Dna Binding Domain - Tslp Ngre Complex Length = | 3e-19 | ||
| 1r0o_A | 86 | Crystal Structure Of The Heterodimeric Ecdysone Rec | 4e-19 | ||
| 1hra_A | 80 | The Solution Structure Of The Human Retinoic Acid R | 6e-19 | ||
| 1r4o_A | 92 | Crystallographic Analysis Of The Interaction Of The | 2e-18 | ||
| 4hn6_A | 114 | Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl | 2e-18 | ||
| 1r4r_B | 92 | Crystallographic Analysis Of The Interaction Of The | 2e-18 | ||
| 1glu_A | 81 | Crystallographic Analysis Of The Interaction Of The | 2e-18 | ||
| 2c7a_A | 78 | Structure Of The Progesterone Receptor-Dna Complex | 2e-18 | ||
| 1ynw_A | 110 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 2e-18 | ||
| 2nll_A | 66 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 6e-18 | ||
| 1kb2_A | 110 | Crystal Structure Of Vdr Dna-Binding Domain Bound T | 6e-18 | ||
| 1lat_A | 82 | Glucocorticoid Receptor MutantDNA COMPLEX Length = | 7e-18 | ||
| 1gdc_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 8e-18 | ||
| 3g9p_B | 90 | Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 | 8e-18 | ||
| 2gda_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 9e-18 | ||
| 1r4i_A | 105 | Crystal Structure Of Androgen Receptor Dna-Binding | 2e-17 | ||
| 3dzu_D | 419 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 2e-17 | ||
| 2ebl_A | 89 | Solution Structure Of The Zinc Finger, C4-type Doma | 2e-17 | ||
| 1rgd_A | 71 | Structure Refinement Of The Glucocorticoid Receptor | 3e-17 | ||
| 2env_A | 88 | Solution Sturcture Of The C4-Type Zinc Finger Domai | 8e-17 | ||
| 3cbb_A | 78 | Crystal Structure Of Hepatocyte Nuclear Factor 4alp | 2e-16 | ||
| 3g6t_A | 91 | Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L | 2e-16 | ||
| 2nll_B | 103 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 6e-16 | ||
| 3m9e_A | 105 | Thyroid Hormone Beta Dna Binding Domain Homodimer W | 3e-15 | ||
| 1r0n_B | 109 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 8e-15 | ||
| 2han_B | 119 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 9e-15 |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
|
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
| >pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 | Back alignment and structure |
| >pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 | Back alignment and structure |
| >pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 | Back alignment and structure |
| >pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 | Back alignment and structure |
| >pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 | Back alignment and structure |
| >pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 | Back alignment and structure |
| >pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 | Back alignment and structure |
| >pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 | Back alignment and structure |
| >pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 | Back alignment and structure |
| >pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 | Back alignment and structure |
| >pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 | Back alignment and structure |
| >pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 | Back alignment and structure |
| >pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 | Back alignment and structure |
| >pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 | Back alignment and structure |
| >pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 | Back alignment and structure |
| >pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 | Back alignment and structure |
| >pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 | Back alignment and structure |
| >pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 | Back alignment and structure |
| >pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 | Back alignment and structure |
| >pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 | Back alignment and structure |
| >pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 | Back alignment and structure |
| >pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 | Back alignment and structure |
| >pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 | Back alignment and structure |
| >pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 | Back alignment and structure |
| >pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 | Back alignment and structure |
| >pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 | Back alignment and structure |
| >pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 | Back alignment and structure |
| >pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 | Back alignment and structure |
| >pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 | Back alignment and structure |
| >pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 | Back alignment and structure |
| >pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 3e-52 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 1e-48 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 1e-47 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 2e-47 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 8e-46 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 8e-46 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 3e-45 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-44 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 2e-44 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 2e-44 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 7e-44 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 3e-43 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 2e-41 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 4e-41 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 6e-39 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 6e-38 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 6e-38 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 4e-37 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 7e-08 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 2e-07 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 3e-07 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 5e-07 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 6e-07 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 1e-06 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 1e-06 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 3e-04 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 2e-06 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 3e-06 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 4e-06 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 9e-06 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 9e-06 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 1e-05 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 1e-05 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 2e-05 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 3e-04 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 2e-05 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 3e-05 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 8e-05 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 8e-05 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 8e-05 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 1e-04 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 4e-04 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 7e-04 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 7e-04 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 8e-04 |
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
Score = 161 bits (409), Expect = 3e-52
Identities = 77/93 (82%), Positives = 87/93 (93%)
Query: 8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
+P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQA
Sbjct: 2 IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQA 61
Query: 68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 100
CRF K L+ GMLKEGVRLDRVRGGRQKY+R D
Sbjct: 62 CRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94
|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 100.0 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 100.0 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 100.0 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 100.0 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 100.0 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 100.0 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 100.0 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 100.0 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 100.0 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 100.0 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 100.0 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 100.0 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 100.0 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 100.0 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 100.0 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 100.0 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 100.0 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 100.0 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 100.0 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 99.85 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 99.74 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.48 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.43 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.39 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 99.33 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 99.31 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.3 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.3 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.28 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 99.28 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.27 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.27 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.27 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 99.26 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 99.26 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.26 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.25 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.25 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.25 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.25 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.24 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 99.24 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.24 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 99.23 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.23 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.21 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.21 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.21 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.2 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 99.2 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 99.2 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.19 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.19 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.18 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.17 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.17 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.16 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 99.16 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.15 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.15 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.12 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.11 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.1 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.07 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.06 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.03 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.01 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.0 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.0 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 98.98 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 98.94 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 98.9 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 84.73 |
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-44 Score=304.06 Aligned_cols=173 Identities=36% Similarity=0.687 Sum_probs=145.9
Q ss_pred CCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeecccc
Q psy16825 10 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVR 89 (183)
Q Consensus 10 ~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r~~ 89 (183)
...|.|||++++|+||||.+|+|||+||||+|.++..|.|+.+++|.+++..|+.||+|||+||+++||++++||.+|++
T Consensus 137 ~~~C~VCg~~a~g~hygv~sC~~Ck~FFrR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~r~~ 216 (467)
T 3dzy_A 137 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR 216 (467)
T ss_dssp CEECTTTSSEECSEETTEECCHHHHHHHHHHHHTTCCCCCSSSSCCCCCSSSSSSCHHHHHHHHHHTTCCGGGCCCCSCC
T ss_pred CCcceeCCCCCCCCcCCCcchhhhhHhccccccCCCceeCCCCCCCCCCcccccccccchhhhhhhccccchhhhccccc
Confidence 34699999999999999999999999999999999999999999999999999999999999999999999999999987
Q ss_pred cccccccCCCC--CCC-------------------C---C-----------CC-----------------CCCCCCCccc
Q psy16825 90 GGRQKYRRNPD--LLS-------------------Q---Q-----------WP-----------------PNKSIPSLED 117 (183)
Q Consensus 90 ~~~~~~~~~~~--~~~-------------------~---~-----------~~-----------------~~k~iP~f~~ 117 (183)
...+....... ... . . .+ +.+.+|+|.+
T Consensus 217 ~k~r~~~~~~~~~~~~~~~~~~~ll~a~~~~e~~~~~~~~~~~~~~~~~~~~~~~~l~e~a~~~L~~vVeWAK~iP~F~~ 296 (467)
T 3dzy_A 217 GKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSE 296 (467)
T ss_dssp CCCCSCSSCTTSTTCSCSSCHHHHHHHHHC----------------------CCTTHHHHHHHHHHHHHHHHHHSTTSTT
T ss_pred cccccccccccccccCCCCchhhhhhhhhhhcccchhhhhhcccCCCCcccchHHHHHHHHHHHHHHHHHHHHhCcchhc
Confidence 64432110000 000 0 0 00 0166899999
Q ss_pred cccccc--------------------------------------------------chhhhhhhhchhcccChhHHHHHH
Q psy16825 118 LERNTE--------------------------------------------------ISCTQVIDRLEHVAVSKEEYYFLK 147 (183)
Q Consensus 118 L~~~dq--------------------------------------------------~~~~~lv~~~~~l~~~~~E~~~lk 147 (183)
|+.+|| ..+.+++.+|++|++|.+||++|+
T Consensus 297 L~~~DQi~LLK~~w~elliL~~a~rs~~~~~~~ll~~g~~i~~~~~~~~~~~~~~~~il~~lv~~l~~L~ld~~E~~lLk 376 (467)
T 3dzy_A 297 LPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLR 376 (467)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHTSSSTTBCCCSSSCCCBTHHHHTTTCHHHHHHHHHHTHHHHHHHTCCHHHHHHHH
T ss_pred CCHHHHHHHHHhHHHHHHHHHHHHHhccCCCceEecCCceechhhhhhhcchHHHHHHHHHHHHHHHHhcCCHHHHHHHH
Confidence 999999 123478999999999999999999
Q ss_pred HHHhcCCCCC-CCchhHHHHHHHHHHHHHHHHHHhc
Q psy16825 148 ALVLANSDVK-LDEFSSLKKFRNSILSSLGDCIYVL 182 (183)
Q Consensus 148 ai~L~~~d~~-L~~~~~v~~~~~~~~~~L~~~~~~~ 182 (183)
||+||+||+. |++...|+++|++++.+|.+|+...
T Consensus 377 AIvLfnpd~~gL~~~~~Ve~lQe~~~~aL~~Y~~~~ 412 (467)
T 3dzy_A 377 AIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHK 412 (467)
T ss_dssp HHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHhCcCCCCCCCHHHHHHHHHHHHHHHHHHHHhc
Confidence 9999999986 9999999999999999999999654
|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 183 | ||||
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 1e-33 | |
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 4e-31 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 1e-30 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 2e-28 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 3e-27 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 4e-27 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 2e-26 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 4e-26 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 9e-25 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 2e-24 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 2e-21 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 3e-04 | |
| d2qw4a1 | 233 | a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 | 5e-04 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 0.001 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 0.002 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 0.002 | |
| d1xvpb_ | 246 | a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) | 0.003 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 0.003 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 0.004 |
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Steroid hormone receptor Err2 DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 112 bits (282), Expect = 1e-33
Identities = 75/89 (84%), Positives = 85/89 (95%)
Query: 8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
+P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQA
Sbjct: 2 IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQA 61
Query: 68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYR 96
CRF K L+ GMLKEGVRLDRVRGGRQKY+
Sbjct: 62 CRFMKALKVGMLKEGVRLDRVRGGRQKYK 90
|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 100.0 | |
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 100.0 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 100.0 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 100.0 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 100.0 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 100.0 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 100.0 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 100.0 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 99.97 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 99.97 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 99.97 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.37 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.36 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.36 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.36 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.34 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.33 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.33 | |
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 99.33 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.32 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.32 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.31 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 99.29 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 99.28 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.28 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.27 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 99.27 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.27 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.26 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.25 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.25 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.24 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.23 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.22 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.22 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.22 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.21 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 99.19 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.05 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 98.91 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 90.43 | |
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 86.39 |
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Steroid hormone receptor Err2 DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.8e-36 Score=198.43 Aligned_cols=87 Identities=85% Similarity=1.546 Sum_probs=81.9
Q ss_pred CCCCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeecc
Q psy16825 8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDR 87 (183)
Q Consensus 8 ~~~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r 87 (183)
.|..+|.|||++++|+||||++|+||++||||+|..+..|.|..+++|.+++..++.|++|||+|||++||++++||.+|
T Consensus 2 ~P~~~C~VCg~~~~~~hyG~~sC~aC~~FFRR~v~~~~~~~c~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~r 81 (90)
T d1lo1a_ 2 IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDR 81 (90)
T ss_dssp CCCCEETTTTEECSEESSSSEECHHHHHHHHHHHHTTCCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSC
T ss_pred CCCCcCCcCCCcCCceEcCeeechhhHHHHHHHHhcCCccchhcCCCCccCCCCccccchhhHHHHHHcCCCHHHhcccc
Confidence 35678999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccc
Q psy16825 88 VRGGRQK 94 (183)
Q Consensus 88 ~~~~~~~ 94 (183)
++.++++
T Consensus 82 ~~~~r~k 88 (90)
T d1lo1a_ 82 VRGGRQK 88 (90)
T ss_dssp CTTCCCC
T ss_pred ccccccC
Confidence 8876654
|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|