Psyllid ID: psy16825


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
DGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLR
ccccccccccccccccccccccccccccccccccHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHccccHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcc
ccccccccccEEccccccEEcEEccccEEcHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEcccccccccccccccHHHHHHHHHcHHHHHHHHHHHHcc
dgikeeelprrlclvcgdvasgfhyGVASCEACKAFFKRTIqgnieytcpasndceiNKRRRKACQACRFQKCLRKGmlkegvrldrvrggrqkyrrnpdllsqqwppnksipsledlernteiSCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLgdciyvlr
dgikeeelprrLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIeytcpasndceiNKRRRKACQACrfqkclrkgmlkegvrldrvrggrqkyrrnpdllsqqwppnksipsledlerNTEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEfsslkkfrnsilsslgdciyvlr
DGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLR
*********RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRV*********************************TEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVL*
************CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGML**************************************************************************************KFRNSILSSLGDCIYVLR
DGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLR
*******LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGML******************************************TEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISCTQVIDRLEHVAVSKEEYYFLKALVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q6QMY5 422 Steroid hormone receptor yes N/A 0.540 0.234 0.83 1e-46
P11474 423 Steroid hormone receptor yes N/A 0.508 0.219 0.872 2e-46
Q5QJV7 422 Steroid hormone receptor yes N/A 0.508 0.220 0.872 2e-46
O08580 422 Steroid hormone receptor yes N/A 0.508 0.220 0.872 2e-46
P11475 433 Steroid hormone receptor no N/A 0.562 0.237 0.761 4e-45
Q5RAM2 435 Estrogen-related receptor no N/A 0.502 0.211 0.838 4e-45
P62510 458 Estrogen-related receptor no N/A 0.502 0.200 0.838 5e-45
P62509 458 Estrogen-related receptor no N/A 0.502 0.200 0.838 5e-45
P62508 458 Estrogen-related receptor no N/A 0.502 0.200 0.838 5e-45
O95718 508 Steroid hormone receptor no N/A 0.562 0.202 0.761 6e-45
>sp|Q6QMY5|ERR1_CANFA Steroid hormone receptor ERR1 OS=Canis familiaris GN=ESRRA PE=2 SV=1 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%)

Query: 8   LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
           LP+RLCLVCGDVASG+HYGVASCEACKAFFKRTIQG+IEY+CPASN+CEI KRRRKACQA
Sbjct: 74  LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQA 133

Query: 68  CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWP 107
           CRF KCLR GMLKEGVRLDRVRGGRQKY+R P++    +P
Sbjct: 134 CRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFP 173




Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. May function as a modulator of the estrogen signaling pathway in the uterus.
Canis familiaris (taxid: 9615)
>sp|P11474|ERR1_HUMAN Steroid hormone receptor ERR1 OS=Homo sapiens GN=ESRRA PE=1 SV=3 Back     alignment and function description
>sp|Q5QJV7|ERR1_RAT Steroid hormone receptor ERR1 OS=Rattus norvegicus GN=Esrra PE=2 SV=2 Back     alignment and function description
>sp|O08580|ERR1_MOUSE Steroid hormone receptor ERR1 OS=Mus musculus GN=Esrra PE=1 SV=4 Back     alignment and function description
>sp|P11475|ERR2_RAT Steroid hormone receptor ERR2 OS=Rattus norvegicus GN=Esrrb PE=2 SV=1 Back     alignment and function description
>sp|Q5RAM2|ERR3_PONAB Estrogen-related receptor gamma OS=Pongo abelii GN=ESRRG PE=2 SV=1 Back     alignment and function description
>sp|P62510|ERR3_RAT Estrogen-related receptor gamma OS=Rattus norvegicus GN=Esrrg PE=2 SV=1 Back     alignment and function description
>sp|P62509|ERR3_MOUSE Estrogen-related receptor gamma OS=Mus musculus GN=Esrrg PE=1 SV=1 Back     alignment and function description
>sp|P62508|ERR3_HUMAN Estrogen-related receptor gamma OS=Homo sapiens GN=ESRRG PE=1 SV=1 Back     alignment and function description
>sp|O95718|ERR2_HUMAN Steroid hormone receptor ERR2 OS=Homo sapiens GN=ESRRB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
242021609 448 retinoid X receptor, putative [Pediculus 0.628 0.256 0.830 8e-52
213513284 415 estrogen-related receptor [Tribolium cas 0.546 0.240 0.92 2e-49
345496190 438 PREDICTED: steroid hormone receptor ERR2 0.612 0.255 0.822 2e-49
259906648 401 estrogen receptor-like protein [Teleogry 0.524 0.239 0.958 4e-49
109689232 505 estrogen receptor-related receptor homol 0.535 0.194 0.949 5e-49
345496188 450 PREDICTED: steroid hormone receptor ERR2 0.590 0.24 0.831 6e-49
170053275 446 estrogen-related receptor [Culex quinque 0.644 0.264 0.798 6e-49
158301679 507 AGAP001743-PA [Anopheles gambiae str. PE 0.535 0.193 0.949 7e-49
307201567 426 Steroid hormone receptor ERR2 [Harpegnat 0.612 0.262 0.822 8e-49
157136394 447 estrogen-related receptor (ERR) [Aedes a 0.535 0.219 0.939 8e-49
>gi|242021609|ref|XP_002431237.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212516486|gb|EEB18499.1| retinoid X receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 104/118 (88%), Gaps = 3/118 (2%)

Query: 3   IKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRR 62
           I+E++LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPA+NDCEINKRRR
Sbjct: 106 IREDDLPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPAANDCEINKRRR 165

Query: 63  KACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL---LSQQWPPNKSIPSLED 117
           KACQACRFQKCLR GMLKEGVRLDRVRGGRQKYRRN D    +    P    +PSLED
Sbjct: 166 KACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRNTDTPYQIHSMLPLKPYLPSLED 223




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|213513284|ref|NP_001135406.1| estrogen-related receptor [Tribolium castaneum] gi|270011014|gb|EFA07462.1| estrogen-related receptor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345496190|ref|XP_001604033.2| PREDICTED: steroid hormone receptor ERR2 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|259906648|gb|ACW84414.1| estrogen receptor-like protein [Teleogryllus emma] Back     alignment and taxonomy information
>gi|109689232|dbj|BAE96770.1| estrogen receptor-related receptor homolog [Anopheles stephensi] Back     alignment and taxonomy information
>gi|345496188|ref|XP_003427670.1| PREDICTED: steroid hormone receptor ERR2 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170053275|ref|XP_001862599.1| estrogen-related receptor [Culex quinquefasciatus] gi|167873854|gb|EDS37237.1| estrogen-related receptor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158301679|ref|XP_321343.4| AGAP001743-PA [Anopheles gambiae str. PEST] gi|157012589|gb|EAA00848.5| AGAP001743-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307201567|gb|EFN81329.1| Steroid hormone receptor ERR2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157136394|ref|XP_001663736.1| estrogen-related receptor (ERR) [Aedes aegypti] gi|108869963|gb|EAT34188.1| AAEL013546-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
UNIPROTKB|F1MBX3 422 ESRRA "Uncharacterized protein 0.513 0.222 0.872 2.6e-51
UNIPROTKB|F1PFF7 613 ESRRA "Steroid hormone recepto 0.513 0.153 0.872 2.6e-51
UNIPROTKB|Q6QMY5 422 ESRRA "Steroid hormone recepto 0.513 0.222 0.872 2.6e-51
UNIPROTKB|F1RQP2 422 ESRRA "Uncharacterized protein 0.513 0.222 0.872 2.6e-51
MGI|MGI:1346831 422 Esrra "estrogen related recept 0.513 0.222 0.872 2.6e-51
RGD|1583866 422 Esrra "estrogen related recept 0.513 0.222 0.872 2.6e-51
UNIPROTKB|F1N0K9 478 LOC100852315 "Uncharacterized 0.508 0.194 0.838 2e-49
UNIPROTKB|E2QSQ7 441 ESRRB "Uncharacterized protein 0.508 0.210 0.838 2e-49
UNIPROTKB|F6V776 438 ESRRB "Uncharacterized protein 0.508 0.212 0.838 2e-49
UNIPROTKB|E7EWD9 508 ESRRB "Steroid hormone recepto 0.508 0.183 0.838 2e-49
UNIPROTKB|F1MBX3 ESRRA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 2.6e-51, Sum P(2) = 2.6e-51
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query:     8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
             LP+RLCLVCGDVASG+HYGVASCEACKAFFKRTIQG+IEY+CPASN+CEI KRRRKACQA
Sbjct:    74 LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQA 133

Query:    68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 101
             CRF KCLR GMLKEGVRLDRVRGGRQKY+R P++
Sbjct:   134 CRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEV 167


GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005496 "steroid binding" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
UNIPROTKB|F1PFF7 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QMY5 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQP2 ESRRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1346831 Esrra "estrogen related receptor, alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1583866 Esrra "estrogen related receptor, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0K9 LOC100852315 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSQ7 ESRRB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6V776 ESRRB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWD9 ESRRB "Steroid hormone receptor ERR2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P11474ERR1_HUMANNo assigned EC number0.87230.50810.2198yesN/A
Q6QMY5ERR1_CANFANo assigned EC number0.830.54090.2345yesN/A
Q19345NHR25_CAEELNo assigned EC number0.54760.45900.1468yesN/A
O08580ERR1_MOUSENo assigned EC number0.87230.50810.2203yesN/A
Q5QJV7ERR1_RATNo assigned EC number0.87230.50810.2203yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
cd0717097 cd07170, NR_DBD_ERR, DNA-binding domain of estroge 2e-61
cd0715575 cd07155, NR_DBD_ER_like, DNA-binding domain of est 7e-44
cd0691672 cd06916, NR_DBD_like, DNA-binding domain of nuclea 5e-41
pfam0010570 pfam00105, zf-C4, Zinc finger, C4 type (two domain 1e-38
cd0716793 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain 1e-37
cd0717182 cd07171, NR_DBD_ER, DNA-binding domain of estrogen 1e-35
cd0696185 cd06961, NR_DBD_TR, DNA-binding domain of thyroid 8e-34
smart0039970 smart00399, ZnF_C4, c4 zinc finger in nuclear horm 1e-32
cd0716890 cd07168, NR_DBD_DHR4_like, DNA-binding domain of e 1e-32
cd0696076 cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto 1e-30
cd0696975 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the 7e-30
cd0696485 cd06964, NR_DBD_RAR, DNA-binding domain of retinoi 1e-28
cd0696787 cd06967, NR_DBD_TR2_like, DNA-binding domain of th 4e-28
cd0716990 cd07169, NR_DBD_GCNF_like, DNA-binding domain of G 1e-27
cd0715672 cd07156, NR_DBD_VDR_like, The DNA-binding domain o 1e-27
cd0695677 cd06956, NR_DBD_RXR, DNA-binding domain of retinoi 1e-26
cd0717974 cd07179, 2DBD_NR_DBD2, The second DNA-binding doma 3e-26
cd0715873 cd07158, NR_DBD_Ppar_like, The DNA-binding domain 1e-25
cd0716689 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV 1e-25
cd0717278 cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco 2e-25
cd0716581 cd07165, NR_DBD_DmE78_like, DNA-binding domain of 2e-25
cd0716478 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of 3e-25
cd0696584 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi 3e-25
cd0696895 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi 1e-23
cd0695873 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi 2e-23
cd0717382 cd07173, NR_DBD_AR, DNA-binding domain of androgen 7e-23
cd0715786 cd07157, 2DBD_NR_DBD1, The first DNA-binding domai 1e-22
cd0696373 cd06963, NR_DBD_GR_like, The DNA binding domain of 2e-22
cd0696694 cd06966, NR_DBD_CAR, DNA-binding domain of constit 6e-22
cd0695973 cd06959, NR_DBD_EcR_like, The DNA-binding domain o 8e-22
cd06955107 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin 1e-21
cd0715473 cd07154, NR_DBD_PNR_like, The DNA-binding domain o 1e-21
cd0716287 cd07162, NR_DBD_PXR, DNA-binding domain of pregnan 1e-21
cd07160101 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X 1e-20
cd0716191 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson 2e-20
cd0716392 cd07163, NR_DBD_TLX, DNA-binding domain of Tailles 2e-20
cd0697092 cd06970, NR_DBD_PNR, DNA-binding domain of the pho 4e-20
cd0696284 cd06962, NR_DBD_FXR, DNA-binding domain of Farneso 7e-20
cd0695782 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of 1e-19
cd06946221 cd06946, NR_LBD_ERR, The ligand binding domain of 4e-15
cd07068221 cd07068, NR_LBD_ER_like, The ligand binding domain 4e-12
cd06930165 cd06930, NR_LBD_F2, Ligand-binding domain of nucle 8e-05
>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
 Score =  185 bits (470), Expect = 2e-61
 Identities = 78/93 (83%), Positives = 87/93 (93%)

Query: 9   PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQAC 68
           P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQAC
Sbjct: 3   PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQAC 62

Query: 69  RFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 101
           RF KCL+ GMLKEGVRLDRVRGGRQKY+R  D 
Sbjct: 63  RFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDA 95


DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 97

>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) Back     alignment and domain information
>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
KOG4215|consensus 432 100.0
KOG4217|consensus605 100.0
KOG4216|consensus 479 100.0
KOG4218|consensus 475 100.0
cd0717097 NR_DBD_ERR DNA-binding domain of estrogen related 100.0
cd0696185 NR_DBD_TR DNA-binding domain of thyroid hormone re 99.98
cd0696485 NR_DBD_RAR DNA-binding domain of retinoic acid rec 99.98
cd07160101 NR_DBD_LXR DNA-binding domain of Liver X receptors 99.98
cd0716890 NR_DBD_DHR4_like DNA-binding domain of ecdysone-in 99.97
cd0696787 NR_DBD_TR2_like DNA-binding domain of the TR2 and 99.97
cd0695677 NR_DBD_RXR DNA-binding domain of retinoid X recept 99.97
cd0697092 NR_DBD_PNR DNA-binding domain of the photoreceptor 99.97
cd0695782 NR_DBD_PNR_like_2 DNA-binding domain of the photor 99.97
cd0717182 NR_DBD_ER DNA-binding domain of estrogen receptors 99.97
cd0716392 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is 99.97
cd0716990 NR_DBD_GCNF_like DNA-binding domain of Germ cell n 99.97
cd0715575 NR_DBD_ER_like DNA-binding domain of estrogen rece 99.97
cd0716689 NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep 99.97
cd0716581 NR_DBD_DmE78_like DNA-binding domain of Drosophila 99.97
cd0716478 NR_DBD_PNR_like_1 DNA-binding domain of the photor 99.97
cd0716793 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 99.97
cd0716191 NR_DBD_EcR DNA-binding domain of Ecdysone receptor 99.97
cd0696284 NR_DBD_FXR DNA-binding domain of Farnesoid X recep 99.97
cd0696076 NR_DBD_HNF4A DNA-binding domain of heptocyte nucle 99.97
cd0696975 NR_DBD_NGFI-B DNA-binding domain of the orphan nuc 99.97
cd0696895 NR_DBD_ROR DNA-binding domain of Retinoid-related 99.97
cd0717974 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o 99.97
cd0696694 NR_DBD_CAR DNA-binding domain of constitutive andr 99.97
KOG4846|consensus 538 99.97
cd0717278 NR_DBD_GR_PR DNA-binding domain of glucocorticoid 99.97
cd0715672 NR_DBD_VDR_like The DNA-binding domain of vitamin 99.97
cd0695873 NR_DBD_COUP_TF DNA-binding domain of chicken ovalb 99.97
cd0717382 NR_DBD_AR DNA-binding domain of androgen receptor 99.97
cd0695973 NR_DBD_EcR_like The DNA-binding domain of Ecdysone 99.97
cd0696584 NR_DBD_Ppar DNA-binding domain of peroxisome proli 99.97
cd0696373 NR_DBD_GR_like The DNA binding domain of GR_like n 99.97
cd0715473 NR_DBD_PNR_like The DNA-binding domain of the phot 99.97
cd0715786 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of 99.97
cd06955107 NR_DBD_VDR DNA-binding domain of vitamin D recepto 99.97
cd0691672 NR_DBD_like DNA-binding domain of nuclear receptor 99.97
cd0716287 NR_DBD_PXR DNA-binding domain of pregnane X recept 99.97
cd0715873 NR_DBD_Ppar_like The DNA-binding domain of peroxis 99.97
smart0039970 ZnF_C4 c4 zinc finger in nuclear hormone receptors 99.96
PF0010570 zf-C4: Zinc finger, C4 type (two domains); InterPr 99.95
cd07076247 NR_LBD_GR Ligand binding domain of the glucocortic 99.44
cd06934226 NR_LBD_PXR_like The ligand binding domain of xenob 99.4
cd06937231 NR_LBD_RAR The ligand binding domain (LBD) of reti 99.4
cd06940189 NR_LBD_REV_ERB The ligand binding domain of REV-ER 99.39
cd06935243 NR_LBD_TR The ligand binding domain of thyroid hor 99.39
cd07073246 NR_LBD_AR Ligand binding domain of the nuclear rec 99.37
cd06939241 NR_LBD_ROR_like The ligand binding domain of Retin 99.36
cd06933238 NR_LBD_VDR The ligand binding domain of vitamin D 99.36
cd07349222 NR_LBD_SHP The ligand binding domain of DAX1 prote 99.35
cd07069241 NR_LBD_Lrh-1 The ligand binding domain of the live 99.35
cd06947246 NR_LBD_GR_Like Ligand binding domain of nuclear ho 99.35
cd06932259 NR_LBD_PPAR The ligand binding domain of peroxisom 99.35
cd07070237 NR_LBD_SF-1 The ligand binding domain of nuclear r 99.35
cd06950206 NR_LBD_Tlx_PNR_like The ligand binding domain of T 99.34
cd06951222 NR_LBD_Dax1_like The ligand binding domain of DAX1 99.33
cd07348238 NR_LBD_NGFI-B The ligand binding domain of Nurr1, 99.33
cd07075248 NR_LBD_MR Ligand binding domain of the mineralocor 99.33
cd06954236 NR_LBD_LXR The ligand binding domain of Liver X re 99.32
cd06953213 NR_LBD_DHR4_like The ligand binding domain of orph 99.31
cd06941195 NR_LBD_DmE78_like The ligand binding domain of Dro 99.31
cd06936221 NR_LBD_Fxr The ligand binding domain of Farnesoid 99.3
cd06945239 NR_LBD_Nurr1_like The ligand binding domain of Nur 99.29
cd07074248 NR_LBD_PR Ligand binding domain of the progesteron 99.28
cd07071238 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a 99.28
cd06943207 NR_LBD_RXR_like The ligand binding domain of the r 99.27
cd06944237 NR_LBD_Ftz-F1_like The ligand binding domain of FT 99.26
cd07072239 NR_LBD_DHR38_like Ligand binding domain of DHR38_l 99.26
cd06949235 NR_LBD_ER Ligand binding domain of Estrogen recept 99.26
cd06948236 NR_LBD_COUP-TF Ligand binding domain of chicken ov 99.25
cd06946221 NR_LBD_ERR The ligand binding domain of estrogen r 99.23
cd06929174 NR_LBD_F1 Ligand-binding domain of nuclear recepto 99.22
cd06930165 NR_LBD_F2 Ligand-binding domain of nuclear recepto 99.18
cd07068221 NR_LBD_ER_like The ligand binding domain of estrog 99.16
cd06942191 NR_LBD_Sex_1_like The ligand binding domain of Cae 99.15
cd07350232 NR_LBD_Dax1 The ligand binding domain of DAX1 prot 99.14
cd06938231 NR_LBD_EcR The ligand binding domain (LBD) of the 99.12
cd06952222 NR_LBD_TR2_like The ligand binding domain of the o 99.11
cd06931222 NR_LBD_HNF4_like The ligand binding domain of hept 98.98
cd06157168 NR_LBD The ligand binding domain of nuclear recept 98.69
smart00430163 HOLI Ligand binding domain of hormone receptors. 98.67
PF00104203 Hormone_recep: Ligand-binding domain of nuclear ho 98.07
PF01412116 ArfGap: Putative GTPase activating protein for Arf 89.51
>KOG4215|consensus Back     alignment and domain information
Probab=100.00  E-value=3.7e-51  Score=323.82  Aligned_cols=173  Identities=34%  Similarity=0.661  Sum_probs=152.7

Q ss_pred             CCCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeeccc
Q psy16825          9 PRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRV   88 (183)
Q Consensus         9 ~~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r~   88 (183)
                      ....|.||||++.|.|||+.+|+||||||||+|.++..|+|+.+.+|.|||+.|+.||+|||+||+++||+++|||.+|+
T Consensus        18 ~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERD   97 (432)
T KOG4215|consen   18 VAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERD   97 (432)
T ss_pred             ccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccc
Confidence            34679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCCCC--CC---------------------------CC---CC------------------------CCCCC
Q psy16825         89 RGGRQKYRRNPDL--LS---------------------------QQ---WP------------------------PNKSI  112 (183)
Q Consensus        89 ~~~~~~~~~~~~~--~~---------------------------~~---~~------------------------~~k~i  112 (183)
                      +.+.++.......  .+                           .+   -+                        |.|.+
T Consensus        98 rIg~Rr~~~~~~n~~~~~id~L~~aE~~~~q~~~srs~~~~~~~~d~r~~~~n~~~at~~Dv~eSm~qqLlllVEWAK~i  177 (432)
T KOG4215|consen   98 RIGSRRPSYEAGNENSPSIDALVQAEALVRQLRSSRSGGVPGIDGDIRQGPPNKKIATENDVCESMKQQLLLLVEWAKYI  177 (432)
T ss_pred             cccccCCCCCCCCCCchhHHHHHhHHHHHhhhhccccccCcCcchhhhcCccccccccHHHHHHHHHHHHHHHHHHHHhc
Confidence            9877654433211  00                           00   00                        11889


Q ss_pred             CCccccccccc--------------------------------------------------chhhhhhhhchhcccChhH
Q psy16825        113 PSLEDLERNTE--------------------------------------------------ISCTQVIDRLEHVAVSKEE  142 (183)
Q Consensus       113 P~f~~L~~~dq--------------------------------------------------~~~~~lv~~~~~l~~~~~E  142 (183)
                      |.|.+++.+||                                                  +++.+++..|++|++|..|
T Consensus       178 ~~F~el~l~DqvaLLk~~a~~hllLg~a~RSm~l~~v~ll~N~~v~~~~~~~~~eis~v~~RIiDElv~Pmr~L~md~~E  257 (432)
T KOG4215|consen  178 PPFCELPLDDQVALLKAHAGQHLLLGAAFRSMHLKDVCLLNNTYVLHRHAPDLPEISRVAPRIIDELVNPMRRLQMDEIE  257 (432)
T ss_pred             cchhcCCchhHHHHHHccchhhhhhhhhhccccccceEEecCceeeccCCCChHHHHHHHHHHHHHHhhHHHHhccchHH
Confidence            99999999999                                                  5678999999999999999


Q ss_pred             HHHHHHHHhcCCCCC-CCchh--HHHHHHHHHHHHHHHHHHh
Q psy16825        143 YYFLKALVLANSDVK-LDEFS--SLKKFRNSILSSLGDCIYV  181 (183)
Q Consensus       143 ~~~lkai~L~~~d~~-L~~~~--~v~~~~~~~~~~L~~~~~~  181 (183)
                      |+|||||+||+||+. |++..  .|++.+++++.+|..||.-
T Consensus       258 y~cLKAi~FfdP~akGis~~s~~~I~~aR~~vl~sLe~yi~d  299 (432)
T KOG4215|consen  258 YVCLKAIAFFDPDAKGLSDPSQIRIREARNRVLKSLEAYISD  299 (432)
T ss_pred             HHHHHHHHhcCccccccCCchHhHHHHHHHHHHHHHHHHHhh
Confidence            999999999999986 99988  8999999999999999964



>KOG4217|consensus Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor Back     alignment and domain information
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily Back     alignment and domain information
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors Back     alignment and domain information
>cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator Back     alignment and domain information
>cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily Back     alignment and domain information
>cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, Back     alignment and domain information
>cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor Back     alignment and domain information
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors Back     alignment and domain information
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily Back     alignment and domain information
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors Back     alignment and domain information
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors Back     alignment and domain information
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 Back     alignment and domain information
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily Back     alignment and domain information
>cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors Back     alignment and domain information
>cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily Back     alignment and domain information
>cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor Back     alignment and domain information
>cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors Back     alignment and domain information
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily Back     alignment and domain information
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors Back     alignment and domain information
>cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily Back     alignment and domain information
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) Back     alignment and domain information
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family Back     alignment and domain information
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors Back     alignment and domain information
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 Back     alignment and domain information
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 Back     alignment and domain information
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors Back     alignment and domain information
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein Back     alignment and domain information
>cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain Back     alignment and domain information
>cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family Back     alignment and domain information
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 Back     alignment and domain information
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes Back     alignment and domain information
>cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators Back     alignment and domain information
>smart00430 HOLI Ligand binding domain of hormone receptors Back     alignment and domain information
>PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1lo1_A98 Estrogen Related Receptor 2 Dna Binding Domain In C 9e-43
1hcq_A84 The Crystal Structure Of The Estrogen Receptor Dna- 4e-26
2ff0_A102 Solution Structure Of Steroidogenic Factor 1 Dna Bi 4e-25
2a66_A113 Human Liver Receptor Homologue Dna-Binding Domain ( 9e-25
1hcp_A76 Dna Recognition By The Oestrogen Receptor: From Sol 1e-23
4aa6_E71 The Oestrogen Receptor Recognizes An Imperfectly Pa 4e-23
4aa6_A71 The Oestrogen Receptor Recognizes An Imperfectly Pa 4e-23
3dzu_A 467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 2e-22
1cit_A89 Dna-Binding Mechanism Of The Monomeric Orphan Nucle 7e-22
1ynw_B99 Crystal Structure Of Vitamin D Receptor And 9-Cis R 1e-21
1dsz_B85 Structure Of The RxrRAR DNA-Binding Domain Heterodi 3e-21
1rxr_A83 High Resolution Solution Structure Of The Retinoid 3e-20
1by4_A82 Structure And Mechanism Of The Homodimeric Assembly 3e-20
1hlz_A94 Crystal Structure Of The Orphan Nuclear Receptor Re 7e-20
1r0n_A81 Crystal Structure Of Heterodimeric Ecdsyone Recepto 9e-20
1dsz_A86 Structure Of The RxrRAR DNA-Binding Domain Heterodi 1e-19
2han_A93 Structural Basis Of Heterodimeric Ecdysteroid Recep 3e-19
4hn5_A117 Gr Dna Binding Domain - Tslp Ngre Complex Length = 3e-19
1r0o_A86 Crystal Structure Of The Heterodimeric Ecdysone Rec 4e-19
1hra_A80 The Solution Structure Of The Human Retinoic Acid R 6e-19
1r4o_A92 Crystallographic Analysis Of The Interaction Of The 2e-18
4hn6_A114 Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl 2e-18
1r4r_B92 Crystallographic Analysis Of The Interaction Of The 2e-18
1glu_A81 Crystallographic Analysis Of The Interaction Of The 2e-18
2c7a_A78 Structure Of The Progesterone Receptor-Dna Complex 2e-18
1ynw_A110 Crystal Structure Of Vitamin D Receptor And 9-Cis R 2e-18
2nll_A66 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 6e-18
1kb2_A110 Crystal Structure Of Vdr Dna-Binding Domain Bound T 6e-18
1lat_A82 Glucocorticoid Receptor MutantDNA COMPLEX Length = 7e-18
1gdc_A72 Refined Solution Structure Of The Glucocorticoid Re 8e-18
3g9p_B90 Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 8e-18
2gda_A72 Refined Solution Structure Of The Glucocorticoid Re 9e-18
1r4i_A105 Crystal Structure Of Androgen Receptor Dna-Binding 2e-17
3dzu_D 419 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 2e-17
2ebl_A89 Solution Structure Of The Zinc Finger, C4-type Doma 2e-17
1rgd_A71 Structure Refinement Of The Glucocorticoid Receptor 3e-17
2env_A88 Solution Sturcture Of The C4-Type Zinc Finger Domai 8e-17
3cbb_A78 Crystal Structure Of Hepatocyte Nuclear Factor 4alp 2e-16
3g6t_A91 Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L 2e-16
2nll_B103 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 6e-16
3m9e_A105 Thyroid Hormone Beta Dna Binding Domain Homodimer W 3e-15
1r0n_B109 Crystal Structure Of Heterodimeric Ecdsyone Recepto 8e-15
2han_B119 Structural Basis Of Heterodimeric Ecdysteroid Recep 9e-15
>pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 Back     alignment and structure

Iteration: 1

Score = 169 bits (427), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 77/93 (82%), Positives = 87/93 (93%) Query: 8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67 +P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQA Sbjct: 2 IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQA 61 Query: 68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 100 CRF K L+ GMLKEGVRLDRVRGGRQKY+R D Sbjct: 62 CRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94
>pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 Back     alignment and structure
>pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 Back     alignment and structure
>pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 Back     alignment and structure
>pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 Back     alignment and structure
>pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure
>pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 Back     alignment and structure
>pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 Back     alignment and structure
>pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 Back     alignment and structure
>pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 Back     alignment and structure
>pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 Back     alignment and structure
>pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 Back     alignment and structure
>pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 Back     alignment and structure
>pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 Back     alignment and structure
>pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 Back     alignment and structure
>pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 Back     alignment and structure
>pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 Back     alignment and structure
>pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 Back     alignment and structure
>pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 Back     alignment and structure
>pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 Back     alignment and structure
>pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 Back     alignment and structure
>pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 Back     alignment and structure
>pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 Back     alignment and structure
>pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 Back     alignment and structure
>pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 Back     alignment and structure
>pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 Back     alignment and structure
>pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 Back     alignment and structure
>pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 Back     alignment and structure
>pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 Back     alignment and structure
>pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 Back     alignment and structure
>pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 Back     alignment and structure
>pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 Back     alignment and structure
>pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 Back     alignment and structure
>pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 Back     alignment and structure
>pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 Back     alignment and structure
>pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 Back     alignment and structure
>pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 3e-52
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 1e-48
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 1e-47
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 2e-47
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 8e-46
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 8e-46
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 3e-45
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-44
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 2e-44
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 2e-44
2han_A93 Protein ultraspiracle; transcription regulation, t 7e-44
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 3e-43
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 2e-41
2han_B119 Ecdysone receptor; transcription regulation, trans 4e-41
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 6e-39
2nll_B103 Protein (thyroid hormone receptor); complex (trans 6e-38
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 6e-38
3dzy_D 419 Peroxisome proliferator-activated receptor gamma; 4e-37
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 7e-08
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 2e-07
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 3e-07
1z5x_E 310 Ecdysone receptor ligand binding domain; ponastero 5e-07
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 6e-07
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 1e-06
1ovl_A 271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 1e-06
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 3e-04
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 2e-06
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 3e-06
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 4e-06
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 9e-06
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 9e-06
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 1e-05
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 1e-05
1lbd_A 282 RXR_LBD, retinoid X receptor; transcription factor 2e-05
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 3e-04
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 2e-05
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 3e-05
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 8e-05
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 8e-05
1t7r_A269 Androgen receptor; nuclear receptor, transcription 8e-05
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 1e-04
2ocf_A 298 Estrogen receptor; estrogen receptor, LBD, monobod 4e-04
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 7e-04
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 7e-04
2hc4_A 302 Vitamin D receptor; alpha helical sandwich, gene r 8e-04
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 Back     alignment and structure
 Score =  161 bits (409), Expect = 3e-52
 Identities = 77/93 (82%), Positives = 87/93 (93%)

Query: 8   LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
           +P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQA
Sbjct: 2   IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQA 61

Query: 68  CRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 100
           CRF K L+ GMLKEGVRLDRVRGGRQKY+R  D
Sbjct: 62  CRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94


>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 100.0
3dzy_D419 Peroxisome proliferator-activated receptor gamma; 100.0
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 100.0
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 100.0
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 100.0
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 100.0
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 100.0
2han_A93 Protein ultraspiracle; transcription regulation, t 100.0
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 100.0
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 100.0
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 100.0
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 100.0
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 100.0
2han_B119 Ecdysone receptor; transcription regulation, trans 100.0
4hn5_A117 Glucocorticoid receptor; glucocorticoid receptor, 100.0
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 100.0
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 100.0
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 100.0
2nll_B103 Protein (thyroid hormone receptor); complex (trans 100.0
2lze_A87 A primordial catalytic fold generated by in vitro 99.85
1lbd_A282 RXR_LBD, retinoid X receptor; transcription factor 99.74
1xdk_B303 RAR-beta, retinoic acid receptor, beta; nuclear re 99.48
3vi8_A273 Peroxisome proliferator-activated receptor alpha; 99.43
1ovl_A271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 99.39
3cqv_A199 Nuclear receptor subfamily 1 group D member 2; rev 99.33
1fcy_A236 RAR-gamma-1, retinoic acid receptor gamma-1; isoty 99.31
3v3e_B257 Nuclear receptor subfamily 4 group A member 1; orp 99.3
3l0l_A248 Nuclear receptor ROR-gamma; nuclear receptor, rorg 99.3
2e2r_A244 Estrogen-related receptor gamma; ERR gamma, BPA, n 99.28
3ltx_A243 Estrogen receptor; constitutive, nuclear receptor, 99.28
3u9q_A269 Peroxisome proliferator-activated receptor gamma; 99.27
3n00_A245 REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s 99.27
3kmr_A266 Retinoic acid receptor alpha; nuclear receptor tra 99.27
3k6p_A248 Steroid hormone receptor ERR1; estrogen related re 99.26
2iz2_A243 FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc 99.26
1n83_A270 Nuclear receptor ROR-alpha; three-layered alpha he 99.26
2hc4_A302 Vitamin D receptor; alpha helical sandwich, gene r 99.25
1xvp_B246 Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR 99.25
3cjw_A244 COUP transcription factor 2; COUP-TFII, nuclear re 99.25
1osh_A232 BIle acid receptor; nuclear receptor, ligand bindi 99.25
3b0t_A254 Vitamin D3 receptor; nuclear receptor, transcripti 99.24
3p0u_A249 Nuclear receptor subfamily 2 group C member 2; lig 99.24
1nq7_A244 Nuclear receptor ROR-beta; ligand-binding domain, 99.24
2nxx_A235 Ultraspiracle (USP, NR2B4); hormone receptor, APO 99.23
3ilz_A267 Thyroid hormone receptor, alpha isoform 1 variant; 99.23
3ipq_A283 Oxysterols receptor LXR-alpha; LXR homodimer, LXR 99.21
2o4j_A292 Vitamin D3 receptor; nuclear receptor-ligand compl 99.21
3mnp_A261 Glucocorticoid receptor; protein-ligand complex, s 99.21
3vhv_A260 Mineralocorticoid receptor; nuclear receptor, tran 99.2
1ymt_A246 Steroidogenic factor 1; SF-1, ligand-binding domai 99.2
3plz_A257 FTZ-F1 related protein; alpha helical sandwhich, f 99.2
1pdu_A244 DHR38, nuclear hormone receptor HR38; nuclear rece 99.19
1t7r_A269 Androgen receptor; nuclear receptor, transcription 99.19
2r40_D266 Ecdysone receptor, 20-hydroxy-ecdysone receptor; n 99.18
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 99.17
1nrl_A316 Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- 99.17
1sqn_A261 PR, progesterone receptor; nuclear receptor, stero 99.16
2p1t_A240 Retinoic acid receptor RXR-alpha; protein-ligand c 99.16
3vhu_A294 Mineralocorticoid receptor; nuclear receptor, tran 99.15
2nxx_E248 Ecdysone receptor (ECR, NRH1); hormone receptor, A 99.15
1z5x_E310 Ecdysone receptor ligand binding domain; ponastero 99.12
2ocf_A 298 Estrogen receptor; estrogen receptor, LBD, monobod 99.11
1xpc_A248 Estrogen receptor; nuclear receptor, transcription 99.1
3up3_A243 Acedaf-12; ligand binding domain, nematode, steroi 99.07
1yye_A268 ER-beta, estrogen receptor beta; ER-beta, nuclear 99.06
3oll_A240 Estrogen receptor beta; steroid binding, phosphory 99.03
1pzl_A237 Hepatocyte nuclear factor 4-alpha; transcription; 99.01
3f5c_B268 Nuclear receptor subfamily 0 group B member 1; tra 99.0
1l2j_A271 Estrogen receptor beta; nuclear receptor, transcri 99.0
1g2n_A264 Ultraspiracle protein; antiparallel alpha-helical 98.98
1hg4_A279 Ultraspiracle; nuclear hormone receptor, transcrip 98.94
3gyt_A244 Nuclear hormone receptor of the steroid/thyroid ho 98.9
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 84.73
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-44  Score=304.06  Aligned_cols=173  Identities=36%  Similarity=0.687  Sum_probs=145.9

Q ss_pred             CCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeecccc
Q psy16825         10 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVR   89 (183)
Q Consensus        10 ~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r~~   89 (183)
                      ...|.|||++++|+||||.+|+|||+||||+|.++..|.|+.+++|.+++..|+.||+|||+||+++||++++||.+|++
T Consensus       137 ~~~C~VCg~~a~g~hygv~sC~~Ck~FFrR~~~~~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~r~~  216 (467)
T 3dzy_A          137 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR  216 (467)
T ss_dssp             CEECTTTSSEECSEETTEECCHHHHHHHHHHHHTTCCCCCSSSSCCCCCSSSSSSCHHHHHHHHHHTTCCGGGCCCCSCC
T ss_pred             CCcceeCCCCCCCCcCCCcchhhhhHhccccccCCCceeCCCCCCCCCCcccccccccchhhhhhhccccchhhhccccc
Confidence            34699999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             cccccccCCCC--CCC-------------------C---C-----------CC-----------------CCCCCCCccc
Q psy16825         90 GGRQKYRRNPD--LLS-------------------Q---Q-----------WP-----------------PNKSIPSLED  117 (183)
Q Consensus        90 ~~~~~~~~~~~--~~~-------------------~---~-----------~~-----------------~~k~iP~f~~  117 (183)
                      ...+.......  ...                   .   .           .+                 +.+.+|+|.+
T Consensus       217 ~k~r~~~~~~~~~~~~~~~~~~~ll~a~~~~e~~~~~~~~~~~~~~~~~~~~~~~~l~e~a~~~L~~vVeWAK~iP~F~~  296 (467)
T 3dzy_A          217 GKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSE  296 (467)
T ss_dssp             CCCCSCSSCTTSTTCSCSSCHHHHHHHHHC----------------------CCTTHHHHHHHHHHHHHHHHHHSTTSTT
T ss_pred             cccccccccccccccCCCCchhhhhhhhhhhcccchhhhhhcccCCCCcccchHHHHHHHHHHHHHHHHHHHHhCcchhc
Confidence            64432110000  000                   0   0           00                 0166899999


Q ss_pred             cccccc--------------------------------------------------chhhhhhhhchhcccChhHHHHHH
Q psy16825        118 LERNTE--------------------------------------------------ISCTQVIDRLEHVAVSKEEYYFLK  147 (183)
Q Consensus       118 L~~~dq--------------------------------------------------~~~~~lv~~~~~l~~~~~E~~~lk  147 (183)
                      |+.+||                                                  ..+.+++.+|++|++|.+||++|+
T Consensus       297 L~~~DQi~LLK~~w~elliL~~a~rs~~~~~~~ll~~g~~i~~~~~~~~~~~~~~~~il~~lv~~l~~L~ld~~E~~lLk  376 (467)
T 3dzy_A          297 LPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLR  376 (467)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHTSSSTTBCCCSSSCCCBTHHHHTTTCHHHHHHHHHHTHHHHHHHTCCHHHHHHHH
T ss_pred             CCHHHHHHHHHhHHHHHHHHHHHHHhccCCCceEecCCceechhhhhhhcchHHHHHHHHHHHHHHHHhcCCHHHHHHHH
Confidence            999999                                                  123478999999999999999999


Q ss_pred             HHHhcCCCCC-CCchhHHHHHHHHHHHHHHHHHHhc
Q psy16825        148 ALVLANSDVK-LDEFSSLKKFRNSILSSLGDCIYVL  182 (183)
Q Consensus       148 ai~L~~~d~~-L~~~~~v~~~~~~~~~~L~~~~~~~  182 (183)
                      ||+||+||+. |++...|+++|++++.+|.+|+...
T Consensus       377 AIvLfnpd~~gL~~~~~Ve~lQe~~~~aL~~Y~~~~  412 (467)
T 3dzy_A          377 AIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHK  412 (467)
T ss_dssp             HHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhCcCCCCCCCHHHHHHHHHHHHHHHHHHHHhc
Confidence            9999999986 9999999999999999999999654



>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Back     alignment and structure
>4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Back     alignment and structure
>2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure
>3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Back     alignment and structure
>1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Back     alignment and structure
>3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A Back     alignment and structure
>3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* Back     alignment and structure
>2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Back     alignment and structure
>3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Back     alignment and structure
>3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Back     alignment and structure
>3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Back     alignment and structure
>3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Back     alignment and structure
>3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A Back     alignment and structure
>1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Back     alignment and structure
>1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Back     alignment and structure
>3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Back     alignment and structure
>1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Back     alignment and structure
>3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Back     alignment and structure
>3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Back     alignment and structure
>1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Back     alignment and structure
>2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Back     alignment and structure
>3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Back     alignment and structure
>2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Back     alignment and structure
>3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Back     alignment and structure
>3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* Back     alignment and structure
>1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Back     alignment and structure
>3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Back     alignment and structure
>1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Back     alignment and structure
>2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Back     alignment and structure
>1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Back     alignment and structure
>1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Back     alignment and structure
>2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Back     alignment and structure
>3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Back     alignment and structure
>2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Back     alignment and structure
>2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Back     alignment and structure
>3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Back     alignment and structure
>1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Back     alignment and structure
>3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Back     alignment and structure
>1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Back     alignment and structure
>3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Back     alignment and structure
>1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Back     alignment and structure
>1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Back     alignment and structure
>3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1lo1a_90 g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi 1e-33
d1dszb_84 g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- 4e-31
d1cita_89 g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b 1e-30
d1kb2a_89 g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin 2e-28
d1a6ya_78 g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b 3e-27
d2hanb183 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do 4e-27
d1r4ia_74 g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve 2e-26
d1dsza_75 g.39.1.2 (A:) Retinoic acid receptor DNA-binding d 4e-26
d1hcqa_74 g.39.1.2 (A:) Estrogen receptor DNA-binding domain 9e-25
d1lata_71 g.39.1.2 (A:) Glucocorticoid receptor DNA-binding 2e-24
d2nllb_103 g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D 2e-21
d1pdua_230 a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui 3e-04
d2qw4a1233 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 5e-04
d1sqna_251 a.123.1.1 (A:) Progesterone receptor {Human (Homo 0.001
d3d24a1227 a.123.1.1 (A:194-420) Steroid hormone receptor ERR 0.002
d1nhza_247 a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom 0.002
d1xvpb_246 a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) 0.003
d1ovla_236 a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma 0.003
d1hg4a_265 a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph 0.004
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Steroid hormone receptor Err2 DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  112 bits (282), Expect = 1e-33
 Identities = 75/89 (84%), Positives = 85/89 (95%)

Query: 8  LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQA 67
          +P+RLCLVCGD+ASG+HYGVASCEACKAFFKRTIQGNIEY+CPA+N+CEI KRRRK+CQA
Sbjct: 2  IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQA 61

Query: 68 CRFQKCLRKGMLKEGVRLDRVRGGRQKYR 96
          CRF K L+ GMLKEGVRLDRVRGGRQKY+
Sbjct: 62 CRFMKALKVGMLKEGVRLDRVRGGRQKYK 90


>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1lo1a_90 Steroid hormone receptor Err2 DNA-binding domain { 100.0
d1dszb_84 Retinoid X receptor (RXR-alpha) DNA-binding domain 100.0
d2hanb183 Ecdysone receptor DNA-binding domain {Fruit fly (D 100.0
d1dsza_75 Retinoic acid receptor DNA-binding domain {Human ( 100.0
d1kb2a_89 Vitamin D3 receptor, VDR, DNA-binding domain {Huma 100.0
d1a6ya_78 Orphan nuclear receptor reverb DNA-binding domain 100.0
d1r4ia_74 Androgen receptor {Rat (Rattus norvegicus) [TaxId: 100.0
d1cita_89 Orphan nuclear receptor NGFI-B DNA-binding domain 100.0
d2nllb_103 Thyroid hormone receptor (TR-beta) DNA-binding dom 99.97
d1lata_71 Glucocorticoid receptor DNA-binding domain {Rat (R 99.97
d1hcqa_74 Estrogen receptor DNA-binding domain {Human and ch 99.97
d1osha_231 Bile acid receptor FXR {Human (Homo sapiens) [TaxI 99.37
d1xnxa_232 Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu 99.36
d1ie9a_255 Vitamin D nuclear receptor {Human (Homo sapiens) [ 99.36
d1xvpb_246 Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s 99.36
d1pq9a_239 Oxysterols receptor LXR-beta {Human (Homo sapiens) 99.34
d2p54a1267 Peroxisome proliferator activated receptor alpha, 99.33
d1n46a_251 Thyroid hormone receptor beta (TR-beta) {Human (Ho 99.33
d1g2na_256 Ultraspiracle protein, usp {Heliothis virescens [T 99.33
d2fvja1271 Peroxisome proliferator activated receptor gamma, 99.32
d2e2ra1223 Orphan nuclear receptor ERR3 {Human (Homo sapiens) 99.32
d1fcya_236 Retinoic acid receptor gamma (RAR-gamma) {Human (H 99.31
d1hg4a_265 Ultraspiracle protein, usp {Drosophila melanogaste 99.29
d1pk5a_242 Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus 99.28
d1nrla_292 Pregnane x receptor, PXR {Human (Homo sapiens) [Ta 99.28
d1n83a_251 Orphan nuclear receptor ROR-alpha {Human (Homo sap 99.27
d1pzla_233 Hepatocyte nuclear factor 4-alpha {Human (Homo sap 99.27
d3d24a1227 Steroid hormone receptor ERR1 {Human (Homo sapiens 99.27
d1ovla_236 Orphan nuclear receptor NURR1 {Human (Homo sapiens 99.26
d1nhza_247 Glucocorticoid receptor {Human (Homo sapiens) [Tax 99.25
d1pdua_230 Nuclear hormone receptor HR38 {Fruit fly (Drosophi 99.25
d2qw4a1233 Orphan nuclear receptor NR4A1 {Human (Homo sapiens 99.24
d1sqna_251 Progesterone receptor {Human (Homo sapiens) [TaxId 99.23
d2b50b1265 Peroxisome proliferator-activated receptor delta, 99.22
d1t7ra_250 Androgen receptor {Chimpanzee (Pan troglodytes) [T 99.22
d1nq7a_244 Orphan nuclear receptor ROR-beta {Rat (Rattus norv 99.22
d2r40d1243 Ecdysone receptor {Noctuid moth (Heliothis viresce 99.21
d2p1ta1230 Retinoid-X receptor alpha (RXR-alpha) {Human (Homo 99.19
d1xpca_245 Estrogen receptor alpha {Human (Homo sapiens) [Tax 99.05
d2j7ya1236 Estrogen receptor beta {Rat (Rattus norvegicus) [T 98.91
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 90.43
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 86.39
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Steroid hormone receptor Err2 DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.8e-36  Score=198.43  Aligned_cols=87  Identities=85%  Similarity=1.546  Sum_probs=81.9

Q ss_pred             CCCCcccccCCCCcccccccccccchhhhhhccccCCceeecCCCCCccccccccccccchhhhHHhhhcccccceeecc
Q psy16825          8 LPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDR   87 (183)
Q Consensus         8 ~~~~~C~vC~~~~~~~hyg~~~C~~C~~FFrR~v~~~~~~~C~~~~~C~~~k~~r~~C~~CR~~KCl~~GM~~~~v~~~r   87 (183)
                      .|..+|.|||++++|+||||++|+||++||||+|..+..|.|..+++|.+++..++.|++|||+|||++||++++||.+|
T Consensus         2 ~P~~~C~VCg~~~~~~hyG~~sC~aC~~FFRR~v~~~~~~~c~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~r   81 (90)
T d1lo1a_           2 IPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDR   81 (90)
T ss_dssp             CCCCEETTTTEECSEESSSSEECHHHHHHHHHHHHTTCCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSC
T ss_pred             CCCCcCCcCCCcCCceEcCeeechhhHHHHHHHHhcCCccchhcCCCCccCCCCccccchhhHHHHHHcCCCHHHhcccc
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccc
Q psy16825         88 VRGGRQK   94 (183)
Q Consensus        88 ~~~~~~~   94 (183)
                      ++.++++
T Consensus        82 ~~~~r~k   88 (90)
T d1lo1a_          82 VRGGRQK   88 (90)
T ss_dssp             CTTCCCC
T ss_pred             ccccccC
Confidence            8876654



>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Back     information, alignment and structure
>d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Back     information, alignment and structure
>d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Back     information, alignment and structure
>d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Back     information, alignment and structure
>d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure