Psyllid ID: psy16829


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MNNTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNESASSQVQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALFE
ccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccc
cccccccccccccccHHHEHHHcccccccEEEcccccEccccHHHHHHHccccccccccccccHccccEccccHHHHHHHHccccccccccccccEccccHHHHHEEccccccccccccHccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccccHccccEccccHHHHHHHHccccccccHHHHHHHHHHcc
MNNTVQAMGYVLDTVKLMIRFKGilgssglnllnnesassqvqyeedkdyddgedkpllLTCVECNEDFINVNDFVshlrghdstshvcdicleafpssddrdlHFLSHltsdglyqcneceFVGKRLTHLKTHKKIHEKVYGVYCdvcgrgfhqnneVTLHKikehnafpfqcEICHkiftnkstmwshkkahkpedqipwecehchkvypnkrsykrhkqVHLGvkheceggpipalalfe
MNNTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNESASSQVQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAhkpedqipweCEHCHKVYPNKRSYKRHKQVHLGvkheceggpipalalfe
MNNTVQAMGYVLDTVKLMIRFKgilgssglnllnnesassQVQyeedkdyddgedkPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALFE
*****QAMGYVLDTVKLMIRFKGILGSSGLNLL***********************PLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGG*********
*NNTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNESASSQVQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALF*
MNNTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNE****************GEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKST***********DQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALFE
**NTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNESASSQVQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPAL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNTVQAMGYVLDTVKLMIRFKGILGSSGLNLLNNESASSQVQYEEDKDYDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHECEGGPIPALALFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
O75437 659 Zinc finger protein 254 O yes N/A 0.683 0.251 0.371 3e-20
Q9H8G1 570 Zinc finger protein 430 O no N/A 0.691 0.294 0.346 7e-19
Q03938601 Zinc finger protein 90 OS no N/A 0.699 0.282 0.340 1e-18
Q6ZN19 808 Zinc finger protein 841 O no N/A 0.695 0.209 0.331 1e-18
A6NK75572 Zinc finger protein 98 OS no N/A 0.691 0.293 0.329 2e-18
Q05481 1191 Zinc finger protein 91 OS no N/A 0.683 0.139 0.342 3e-18
Q8IYN0 542 Zinc finger protein 100 O no N/A 0.691 0.309 0.335 4e-18
Q9BUY5554 Zinc finger protein 426 O no N/A 0.679 0.297 0.321 4e-18
Q5R5U3 672 Zinc finger protein 271 O no N/A 0.695 0.251 0.310 5e-18
Q8IYB9 648 Zinc finger protein 595 O no N/A 0.728 0.273 0.342 5e-18
>sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 Back     alignment and function desciption
 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 95/175 (54%), Gaps = 9/175 (5%)

Query: 62  CVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNE 120
           C EC + FI  +    H R H     + C+ C +AF  S     H + H T +  Y+C E
Sbjct: 324 CEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIH-TGEKRYKCLE 382

Query: 121 CEFVGKRLTHLKTHKKIH--EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICH 178
           C    K+L+ L THK IH  EK+Y   C+ CG+GF++++ +T HKI      P++CE C 
Sbjct: 383 CGKAFKQLSTLTTHKIIHVGEKLYK--CEECGKGFNRSSNLTTHKIIHTGEKPYKCEECG 440

Query: 179 KIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVK-HECE 232
           K F   ST+  HK+ H  E   P++CE C K +    +  RHK++H G K ++CE
Sbjct: 441 KAFIWSSTLTKHKRIHTREK--PYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCE 493




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=2 SV=3 Back     alignment and function description
>sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 Back     alignment and function description
>sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 Back     alignment and function description
>sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 Back     alignment and function description
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 Back     alignment and function description
>sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
328715760 372 PREDICTED: zinc finger protein 502-like 0.707 0.462 0.331 1e-20
426388075 685 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.683 0.242 0.371 1e-18
397488312 699 PREDICTED: zinc finger protein 254-like, 0.683 0.237 0.371 1e-18
116256449 659 zinc finger protein 254 [Homo sapiens] g 0.683 0.251 0.371 2e-18
71051560 659 Zinc finger protein 254 [Homo sapiens] 0.683 0.251 0.371 2e-18
114679826 659 PREDICTED: zinc finger protein 254 isofo 0.683 0.251 0.371 2e-18
158256008 650 unnamed protein product [Homo sapiens] 0.683 0.255 0.371 3e-18
426343507 551 PREDICTED: zinc finger protein 595-like 0.695 0.306 0.36 3e-18
194382622 574 unnamed protein product [Homo sapiens] 0.683 0.289 0.371 3e-18
332262450 650 PREDICTED: zinc finger protein 254 isofo 0.683 0.255 0.371 3e-18
>gi|328715760|ref|XP_001948978.2| PREDICTED: zinc finger protein 502-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 93/175 (53%), Gaps = 3/175 (1%)

Query: 59  LLTCVECNEDFINVNDFVSHLR-GHDSTSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQ 117
              C +C E F   +    H    H  +++ C+ C + F +   R  H      S   Y 
Sbjct: 76  FFKCRKCEESFNTKHALKDHQNDAHPHSAYKCNCCDKTFDTMCARQKHKKEEHPS-VTYS 134

Query: 118 CNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEIC 177
           C+ C++     + ++ H+  H+KVY V+CD C  GF   +E+  H+IK H A P+QC+ C
Sbjct: 135 CDTCDYRTPYKSRMQYHENRHKKVYSVFCDTCQAGFFNKDELATHEIKNHGAEPYQCDRC 194

Query: 178 HKIFTNKSTMWSHKKAHKPE-DQIPWECEHCHKVYPNKRSYKRHKQVHLGVKHEC 231
            K+ T+K+ ++SH K H    + + ++CE C K +    SY+RH Q HLG+K+EC
Sbjct: 195 SKLCTSKTNLYSHMKVHTTSAESVSYQCETCGKAFRRIGSYRRHIQSHLGLKYEC 249




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|426388075|ref|XP_004060476.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 254 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|397488312|ref|XP_003815211.1| PREDICTED: zinc finger protein 254-like, partial [Pan paniscus] Back     alignment and taxonomy information
>gi|116256449|ref|NP_975011.3| zinc finger protein 254 [Homo sapiens] gi|215274193|sp|O75437.3|ZN254_HUMAN RecName: Full=Zinc finger protein 254; AltName: Full=Bone marrow zinc finger 5; Short=BMZF-5; AltName: Full=Hematopoietic cell-derived zinc finger protein 1; Short=HD-ZNF1; AltName: Full=Zinc finger protein 539; AltName: Full=Zinc finger protein 91-like gi|119605366|gb|EAW84960.1| hCG19985, isoform CRA_a [Homo sapiens] gi|141794888|gb|AAI39750.1| Zinc finger protein 254 [Homo sapiens] Back     alignment and taxonomy information
>gi|71051560|gb|AAH43147.2| Zinc finger protein 254 [Homo sapiens] Back     alignment and taxonomy information
>gi|114679826|ref|XP_001149923.1| PREDICTED: zinc finger protein 254 isoform 4 [Pan troglodytes] Back     alignment and taxonomy information
>gi|158256008|dbj|BAF83975.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|426343507|ref|XP_004038341.1| PREDICTED: zinc finger protein 595-like [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|194382622|dbj|BAG64481.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|332262450|ref|XP_003280274.1| PREDICTED: zinc finger protein 254 isoform 1 [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
UNIPROTKB|F5H2M4 574 ZNF254 "Zinc finger protein 25 0.683 0.289 0.371 2.7e-25
UNIPROTKB|O75437 659 ZNF254 "Zinc finger protein 25 0.683 0.251 0.371 4e-25
UNIPROTKB|A6NK75572 ZNF98 "Zinc finger protein 98" 0.683 0.290 0.342 2e-24
UNIPROTKB|Q9H8G1 570 ZNF430 "Zinc finger protein 43 0.683 0.291 0.36 3.3e-24
UNIPROTKB|Q03938601 ZNF90 "Zinc finger protein 90" 0.683 0.276 0.342 8.1e-24
UNIPROTKB|Q8TD23568 ZNF675 "Zinc finger protein 67 0.683 0.292 0.348 1.9e-23
UNIPROTKB|Q14591 655 ZNF271 "Zinc finger protein 27 0.687 0.254 0.323 2.1e-23
UNIPROTKB|Q9P255531 ZNF492 "Zinc finger protein 49 0.683 0.312 0.337 2.5e-23
UNIPROTKB|E1BKB3606 ZNF568 "Uncharacterized protei 0.666 0.267 0.329 2.9e-23
UNIPROTKB|Q05481 1191 ZNF91 "Zinc finger protein 91" 0.683 0.139 0.342 3e-23
UNIPROTKB|F5H2M4 ZNF254 "Zinc finger protein 254" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 2.7e-25, P = 2.7e-25
 Identities = 65/175 (37%), Positives = 95/175 (54%)

Query:    62 CVECNEDFINVNDFVSHLRGHDSTS-HVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNE 120
             C EC + FI  +    H R H     + C+ C +AF  S     H + H T +  Y+C E
Sbjct:   239 CEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIH-TGEKRYKCLE 297

Query:   121 CEFVGKRLTHLKTHKKIH--EKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICH 178
             C    K+L+ L THK IH  EK+Y   C+ CG+GF++++ +T HKI      P++CE C 
Sbjct:   298 CGKAFKQLSTLTTHKIIHVGEKLYK--CEECGKGFNRSSNLTTHKIIHTGEKPYKCEECG 355

Query:   179 KIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVK-HECE 232
             K F   ST+  HK+ H  E   P++CE C K +    +  RHK++H G K ++CE
Sbjct:   356 KAFIWSSTLTKHKRIHTREK--PYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCE 408


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|O75437 ZNF254 "Zinc finger protein 254" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6NK75 ZNF98 "Zinc finger protein 98" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8G1 ZNF430 "Zinc finger protein 430" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q03938 ZNF90 "Zinc finger protein 90" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TD23 ZNF675 "Zinc finger protein 675" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14591 ZNF271 "Zinc finger protein 271" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P255 ZNF492 "Zinc finger protein 492" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKB3 ZNF568 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q05481 ZNF91 "Zinc finger protein 91" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG2462|consensus279 99.96
KOG2462|consensus279 99.96
KOG1074|consensus 958 99.92
KOG3608|consensus467 99.92
KOG3608|consensus467 99.91
KOG3623|consensus1007 99.9
KOG3623|consensus1007 99.86
KOG1074|consensus 958 99.83
KOG3576|consensus267 99.74
KOG3576|consensus267 99.73
PLN03086567 PRLI-interacting factor K; Provisional 99.49
PLN03086567 PRLI-interacting factor K; Provisional 99.36
PHA00733128 hypothetical protein 99.32
PHA0276855 hypothetical protein; Provisional 99.19
PHA00733128 hypothetical protein 99.14
PHA0276855 hypothetical protein; Provisional 98.99
KOG3993|consensus500 98.91
KOG3993|consensus500 98.86
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.74
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.71
PHA0061644 hypothetical protein 98.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.6
PHA0061644 hypothetical protein 98.56
PHA0073279 hypothetical protein 98.45
PHA0073279 hypothetical protein 98.44
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.28
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.12
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.03
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.01
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.95
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.79
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.72
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.69
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.61
smart0035526 ZnF_C2H2 zinc finger. 97.59
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.37
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.35
KOG2231|consensus 669 97.28
COG5189423 SFP1 Putative transcriptional repressor regulating 97.23
KOG2231|consensus 669 97.17
COG5189423 SFP1 Putative transcriptional repressor regulating 97.12
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.07
PRK04860160 hypothetical protein; Provisional 97.03
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.0
smart0035526 ZnF_C2H2 zinc finger. 96.87
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.87
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.59
PRK04860160 hypothetical protein; Provisional 96.55
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.41
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.4
KOG1146|consensus 1406 96.37
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.26
KOG1146|consensus 1406 95.5
COG5048467 FOG: Zn-finger [General function prediction only] 95.32
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.29
KOG2482|consensus423 95.09
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.96
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 94.76
KOG2785|consensus 390 94.17
KOG2482|consensus 423 94.14
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.03
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.88
COG5048467 FOG: Zn-finger [General function prediction only] 93.41
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.35
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.29
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.12
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 91.94
KOG2893|consensus 341 91.89
KOG2893|consensus 341 91.62
KOG4173|consensus253 91.29
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.68
COG404965 Uncharacterized protein containing archaeal-type C 89.1
COG404965 Uncharacterized protein containing archaeal-type C 88.89
KOG2785|consensus390 88.55
KOG2186|consensus276 88.07
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 87.99
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 87.79
KOG4173|consensus253 87.75
COG1592166 Rubrerythrin [Energy production and conversion] 87.47
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.16
PF1371937 zinc_ribbon_5: zinc-ribbon domain 86.87
COG5236493 Uncharacterized conserved protein, contains RING Z 86.65
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.55
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.08
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 85.9
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 85.37
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.3
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 84.68
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 84.32
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 83.82
PHA0062659 hypothetical protein 83.71
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.32
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 82.72
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 82.0
PRK06266178 transcription initiation factor E subunit alpha; V 81.17
PRK06266178 transcription initiation factor E subunit alpha; V 81.1
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 80.62
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 80.58
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 80.17
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 80.1
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=1.4e-30  Score=191.95  Aligned_cols=133  Identities=24%  Similarity=0.504  Sum_probs=102.2

Q ss_pred             cccccccccccCChHHHHHHHHhhc--CCCCcccCCcccccccChHHHHHHHHhhcCCCCcccccccccccChhHHHHHH
Q psy16829         86 SHVCDICLEAFPSSDDRDLHFLSHL--TSDGLYQCNECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHK  163 (243)
Q Consensus        86 ~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  163 (243)
                      .|+|+.|++.+.+.+.|-+|.+.|-  ...+.+.|.+|++.+.....|+.|+++|.  -+++|.+||+.|+..+.|+.|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            3566666666666666666665551  23456777888888888888888888776  4678888888888888888888


Q ss_pred             HHhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHh
Q psy16829        164 IKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQ  222 (243)
Q Consensus       164 ~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~  222 (243)
                      +.|+|+|||.|+.|++.|.++++|+.|+++|.+.+  +|+|..|+++|...+-|.+|..
T Consensus       208 RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccCCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHHHHHHhhh
Confidence            88888888888888888888888888888888887  8888888888888888888864



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 71.2 bits (173), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 4/169 (2%) Query: 61 TCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCN 119 C EC + F + H R H + C C ++F D H +H T + Y+C Sbjct: 23 ACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTH-TGEKPYKCP 81 Query: 120 ECEFVGKRLTHLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHK 179 EC + +L+ H++ H C CG+ F Q + H+ P++C C K Sbjct: 82 ECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGK 141 Query: 180 IFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGVK 228 F+ + + +H++ H E P++C C K + + + H++ H G K Sbjct: 142 SFSREDNLHTHQRTHTGEK--PYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 62.8 bits (154), Expect = 2e-12
 Identities = 50/181 (27%), Positives = 81/181 (44%), Gaps = 28/181 (15%)

Query: 61  TCVECNEDFINVNDFVSHLRGHDSTS---HVCDICLEAFPSSDDRDLHFLSHLTSDGLYQ 117
            C EC + F   +    H R H  T    + C  C ++F    D   H  +H T +  Y+
Sbjct: 23  ACPECGKSFSRSDHLAEHQRTH--TGEKPYKCPECGKSFSDKKDLTRHQRTH-TGEKPYK 79

Query: 118 CNECEFVGK---RLTHLKTHKKIH--EKVYGVYCDVCGRGFHQNNEVTLHKI-----KEH 167
           C EC   GK   +  +L+ H++ H  EK Y   C  CG+ F Q   +  H+      K  
Sbjct: 80  CPEC---GKSFSQRANLRAHQRTHTGEKPYA--CPECGKSFSQLAHLRAHQRTHTGEK-- 132

Query: 168 NAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVHLGV 227
              P++C  C K F+ +  + +H++ H  E   P++C  C K +  + +   H++ H G 
Sbjct: 133 ---PYKCPECGKSFSREDNLHTHQRTHTGEK--PYKCPECGKSFSRRDALNVHQRTHTGK 187

Query: 228 K 228
           K
Sbjct: 188 K 188


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.85
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.85
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.83
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.82
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.78
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.74
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.72
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.71
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.71
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.7
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.68
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.64
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.64
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.63
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.62
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.62
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.6
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.6
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.57
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.56
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.56
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.54
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.48
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.47
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.46
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.35
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.34
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.33
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.32
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.3
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.3
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.25
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.24
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.24
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.23
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.16
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.15
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.15
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.13
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.1
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.01
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.96
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.95
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.94
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.92
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.92
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.91
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.84
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.83
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.82
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.82
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.79
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.68
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.67
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.66
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.66
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.66
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.66
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.65
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.64
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.63
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.62
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.61
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.61
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.61
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.6
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.58
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.98
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.56
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.55
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.54
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.54
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.53
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.51
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.51
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.5
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.5
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.5
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.85
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.46
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.78
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.38
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.37
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.34
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.33
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.33
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.32
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.3
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.28
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.28
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.27
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.26
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.26
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.26
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.25
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.23
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.52
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.2
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.46
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.15
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.35
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.9
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.54
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.54
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.1
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.92
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.8
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.09
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.81
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.72
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.56
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.95
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.37
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 88.37
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 87.72
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 86.6
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.07
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.97
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 85.57
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 85.47
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 83.87
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 82.95
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 82.5
2k5c_A95 Uncharacterized protein PF0385; structural genomic 82.05
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.82
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 81.56
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.71
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.5
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=5.3e-41  Score=248.19  Aligned_cols=176  Identities=25%  Similarity=0.546  Sum_probs=148.5

Q ss_pred             CCCCCCCcceeeccccchhccChhhHHhhhhccCC-CcccccccccccCChHHHHHHHHhhcCCCCcccCCcccccccCh
Q psy16829         50 YDDGEDKPLLLTCVECNEDFINVNDFVSHLRGHDS-TSHVCDICLEAFPSSDDRDLHFLSHLTSDGLYQCNECEFVGKRL  128 (243)
Q Consensus        50 ~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  128 (243)
                      +.....++++|.|+.|++.|.....|..|++.|.+ ++|.|+.|++.|.....|..|++.| .++++|.|..|++.|...
T Consensus        12 h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h-~~~~~~~C~~C~~~f~~~   90 (190)
T 2i13_A           12 QAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTH-TGEKPYKCPECGKSFSQR   90 (190)
T ss_dssp             -------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHH-HCCCCEECTTTCCEESCH
T ss_pred             hhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhc-CCCCCccCcccCCccCCH
Confidence            34455667889999999999999999999999988 8999999999999999999999999 788899999999999999


Q ss_pred             HHHHHHHHhhcCCCCcccccccccccChhHHHHHHHHhcCCCCeeccccccccCChhHHHHHHHHhCCCCCCCccccccc
Q psy16829        129 THLKTHKKIHEKVYGVYCDVCGRGFHQNNEVTLHKIKEHNAFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCH  208 (243)
Q Consensus       129 ~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~  208 (243)
                      ..|..|++.|.++++|.|+.|++.|.....|..|++.|+++++|.|++|++.|.....|..|++.|++++  ||.|+.|+
T Consensus        91 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~--~~~C~~C~  168 (190)
T 2i13_A           91 ANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEK--PYKCPECG  168 (190)
T ss_dssp             HHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCC--CEECTTTC
T ss_pred             HHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCC--CeECCCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998  99999999


Q ss_pred             CccCChHHHHHHHhhcCCCC
Q psy16829        209 KVYPNKRSYKRHKQVHLGVK  228 (243)
Q Consensus       209 ~~f~~~~~l~~H~~~H~~~~  228 (243)
                      +.|.+...|..|+++|+|++
T Consensus       169 ~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          169 KSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             CEESSHHHHHHHHTTC----
T ss_pred             CccCCHHHHHHHHHhcCCCC
Confidence            99999999999999999986



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 36.6 bits (84), Expect = 2e-04
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 3/54 (5%)

Query: 171 PFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVH 224
            + C+ C K FT+KS    H   H      P+ C  C K +  K     H ++H
Sbjct: 3   LYPCQ-CGKSFTHKSQRDRHMSMHLG--LRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.61
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.42
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.39
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.38
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.34
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.31
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.3
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.25
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.2
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.12
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.08
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.07
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.06
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.05
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.04
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.03
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.99
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.92
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.84
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.78
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.78
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.77
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.63
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.62
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.55
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.48
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.31
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.3
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.24
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.23
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.19
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.17
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.16
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.11
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.1
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.05
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 98.03
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.97
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.92
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.84
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.76
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.75
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.7
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.68
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.47
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.42
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.39
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.29
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.22
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.11
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.09
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.08
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.07
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.92
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.8
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.77
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.63
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.46
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.38
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.37
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.29
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.23
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.1
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.06
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.89
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.57
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.53
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.25
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.22
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.14
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.03
d1y0jb136 U-shaped transcription factor, different fingers { 94.99
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.59
d1y0jb136 U-shaped transcription factor, different fingers { 94.24
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.21
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.9
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.81
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.63
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.37
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.2
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.96
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.82
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.64
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.38
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.31
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.23
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.8
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 86.54
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.36
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.06
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 80.05
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=1.5e-18  Score=98.05  Aligned_cols=53  Identities=30%  Similarity=0.538  Sum_probs=50.2

Q ss_pred             CCCeeccccccccCChhHHHHHHHHhCCCCCCCcccccccCccCChHHHHHHHhhc
Q psy16829        169 AFPFQCEICHKIFTNKSTMWSHKKAHKPEDQIPWECEHCHKVYPNKRSYKRHKQVH  224 (243)
Q Consensus       169 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H  224 (243)
                      +|||.|. ||+.|.....|..|+++|++++  ||.|+.|+++|...+.|.+|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ek--py~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLR--PYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCC--SEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhcccccc--CCcCCCcCCEecCHHHHHHHHhcC
Confidence            6899994 9999999999999999999999  999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure