Psyllid ID: psy1682
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| 193683390 | 522 | PREDICTED: tyrosine-protein kinase Src42 | 0.971 | 0.130 | 0.955 | 2e-30 | |
| 195430152 | 518 | GK21551 [Drosophila willistoni] gi|19415 | 0.971 | 0.131 | 0.926 | 6e-30 | |
| 91086687 | 507 | PREDICTED: similar to AGAP006270-PA [Tri | 0.971 | 0.134 | 0.926 | 6e-30 | |
| 195119910 | 523 | GI19952 [Drosophila mojavensis] gi|19540 | 0.971 | 0.130 | 0.926 | 7e-30 | |
| 195027551 | 524 | GH21475 [Drosophila grimshawi] gi|193902 | 0.971 | 0.129 | 0.926 | 7e-30 | |
| 156549780 | 505 | PREDICTED: tyrosine-protein kinase Src42 | 0.971 | 0.134 | 0.926 | 7e-30 | |
| 158295650 | 508 | AGAP006270-PA [Anopheles gambiae str. PE | 0.971 | 0.133 | 0.926 | 8e-30 | |
| 340716501 | 527 | PREDICTED: tyrosine-protein kinase Src42 | 0.971 | 0.129 | 0.926 | 8e-30 | |
| 383860313 | 505 | PREDICTED: tyrosine-protein kinase Src42 | 0.971 | 0.134 | 0.926 | 8e-30 | |
| 350404530 | 518 | PREDICTED: tyrosine-protein kinase Src42 | 0.971 | 0.131 | 0.926 | 8e-30 |
| >gi|193683390|ref|XP_001944820.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 136 bits (342), Expect = 2e-30, Method: Compositional matrix adjust.
Identities = 65/68 (95%), Positives = 66/68 (97%)
Query: 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE 60
IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE
Sbjct: 75 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE 134
Query: 61 AEPYDFKK 68
AEP+ F K
Sbjct: 135 AEPWYFGK 142
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195430152|ref|XP_002063120.1| GK21551 [Drosophila willistoni] gi|194159205|gb|EDW74106.1| GK21551 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|91086687|ref|XP_969129.1| PREDICTED: similar to AGAP006270-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195119910|ref|XP_002004472.1| GI19952 [Drosophila mojavensis] gi|195401471|ref|XP_002059336.1| GJ17854 [Drosophila virilis] gi|193909540|gb|EDW08407.1| GI19952 [Drosophila mojavensis] gi|194142342|gb|EDW58748.1| GJ17854 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195027551|ref|XP_001986646.1| GH21475 [Drosophila grimshawi] gi|193902646|gb|EDW01513.1| GH21475 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|156549780|ref|XP_001606320.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 1 [Nasonia vitripennis] gi|345487773|ref|XP_003425754.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 2 [Nasonia vitripennis] gi|345487775|ref|XP_003425755.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|158295650|ref|XP_316335.3| AGAP006270-PA [Anopheles gambiae str. PEST] gi|157016138|gb|EAA10750.4| AGAP006270-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|340716501|ref|XP_003396736.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383860313|ref|XP_003705635.1| PREDICTED: tyrosine-protein kinase Src42A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350404530|ref|XP_003487134.1| PREDICTED: tyrosine-protein kinase Src42A-like isoform 3 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| FB|FBgn0264959 | 517 | Src42A "Src oncogene at 42A" [ | 0.971 | 0.131 | 0.911 | 9.6e-30 | |
| WB|WBGene00005078 | 507 | src-2 [Caenorhabditis elegans | 0.957 | 0.132 | 0.716 | 1.6e-21 | |
| UNIPROTKB|F1LM92 | 489 | Yes1 "Tyrosine-protein kinase | 0.971 | 0.139 | 0.676 | 6.3e-20 | |
| UNIPROTKB|A7MB57 | 541 | YES1 "Uncharacterized protein" | 0.971 | 0.125 | 0.676 | 8.3e-20 | |
| UNIPROTKB|F1PSB7 | 541 | YES1 "Tyrosine-protein kinase | 0.971 | 0.125 | 0.676 | 8.3e-20 | |
| RGD|3977 | 541 | Yes1 "Yamaguchi sarcoma viral | 0.971 | 0.125 | 0.676 | 8.3e-20 | |
| UNIPROTKB|P07947 | 543 | YES1 "Tyrosine-protein kinase | 0.971 | 0.125 | 0.676 | 8.4e-20 | |
| UNIPROTKB|J3QRU1 | 548 | YES1 "Tyrosine-protein kinase | 0.971 | 0.124 | 0.676 | 8.6e-20 | |
| UNIPROTKB|E5RFS5 | 232 | FYN "Tyrosine-protein kinase F | 0.971 | 0.293 | 0.632 | 1.2e-19 | |
| UNIPROTKB|E5RGT0 | 153 | FYN "Tyrosine-protein kinase F | 0.971 | 0.444 | 0.632 | 1.2e-19 |
| FB|FBgn0264959 Src42A "Src oncogene at 42A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 332 (121.9 bits), Expect = 9.6e-30, P = 9.6e-30
Identities = 62/68 (91%), Positives = 65/68 (95%)
Query: 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE 60
IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSK T+ EGYIPSNYVAKLKSIE
Sbjct: 67 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKKTRSEGYIPSNYVAKLKSIE 126
Query: 61 AEPYDFKK 68
AEP+ F+K
Sbjct: 127 AEPWYFRK 134
|
|
| WB|WBGene00005078 src-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LM92 Yes1 "Tyrosine-protein kinase Yes" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB57 YES1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PSB7 YES1 "Tyrosine-protein kinase Yes" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|3977 Yes1 "Yamaguchi sarcoma viral (v-yes) oncogene homolog 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07947 YES1 "Tyrosine-protein kinase Yes" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QRU1 YES1 "Tyrosine-protein kinase Yes" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RFS5 FYN "Tyrosine-protein kinase Fyn" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RGT0 FYN "Tyrosine-protein kinase Fyn" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 9e-32 | |
| cd12008 | 56 | cd12008, SH3_Src, Src homology 3 domain of Src Pro | 1e-23 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 1e-23 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 4e-22 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 2e-19 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 8e-19 | |
| cd12011 | 55 | cd12011, SH3_SLAP2, Src homology 3 domain of Src-L | 2e-18 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 2e-17 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 4e-17 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 8e-17 | |
| cd12005 | 54 | cd12005, SH3_Lck, Src homology 3 domain of Lck Pro | 9e-17 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 2e-16 | |
| cd11848 | 55 | cd11848, SH3_SLAP-like, Src homology 3 domain of S | 4e-16 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 1e-13 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 5e-13 | |
| cd11850 | 56 | cd11850, SH3_Abl, Src homology 3 domain of the Pro | 6e-13 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 1e-12 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 2e-12 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 6e-12 | |
| cd11885 | 55 | cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d | 8e-12 | |
| cd11847 | 58 | cd11847, SH3_Brk, Src homology 3 domain of Brk (Br | 9e-12 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 1e-11 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 1e-11 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 2e-11 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 7e-11 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 7e-11 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 1e-10 | |
| cd12010 | 55 | cd12010, SH3_SLAP, Src homology 3 domain of Src-Li | 2e-10 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 2e-10 | |
| cd11846 | 55 | cd11846, SH3_Srms, Src homology 3 domain of Srms P | 3e-10 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 4e-10 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 5e-10 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 5e-10 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 6e-10 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 6e-10 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 6e-10 | |
| cd12141 | 57 | cd12141, SH3_DNMBP_C2, Second C-terminal Src homol | 1e-09 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 1e-09 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 2e-09 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 2e-09 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 2e-09 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 3e-09 | |
| cd11757 | 52 | cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 | 3e-09 | |
| cd11889 | 53 | cd11889, SH3_Cyk3p-like, Src Homology 3 domain of | 3e-09 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 4e-09 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 4e-09 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 5e-09 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 7e-09 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 8e-09 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 8e-09 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 8e-09 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 8e-09 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 1e-08 | |
| cd11876 | 58 | cd11876, SH3_MLK, Src Homology 3 domain of Mixed L | 1e-08 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 1e-08 | |
| cd11784 | 55 | cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain | 1e-08 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 1e-08 | |
| cd11924 | 56 | cd11924, SH3_Vinexin_2, Second Src Homology 3 doma | 1e-08 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 1e-08 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 2e-08 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 2e-08 | |
| cd11761 | 57 | cd11761, SH3_FCHSD_1, First Src Homology 3 domain | 2e-08 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 3e-08 | |
| cd11899 | 58 | cd11899, SH3_Nck2_1, First Src Homology 3 domain o | 3e-08 | |
| cd11926 | 55 | cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain | 3e-08 | |
| cd12012 | 62 | cd12012, SH3_RIM-BP_2, Second Src homology 3 domai | 4e-08 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 5e-08 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 6e-08 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 7e-08 | |
| cd11862 | 61 | cd11862, SH3_MPP, Src Homology 3 domain of Membran | 8e-08 | |
| cd11864 | 58 | cd11864, SH3_PEX13_eumet, Src Homology 3 domain of | 8e-08 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 1e-07 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 1e-07 | |
| cd11900 | 59 | cd11900, SH3_Nck1_1, First Src Homology 3 domain o | 1e-07 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 2e-07 | |
| cd11904 | 57 | cd11904, SH3_Nck1_3, Third Src Homology 3 domain o | 2e-07 | |
| cd12047 | 53 | cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do | 2e-07 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 2e-07 | |
| cd11917 | 61 | cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H | 2e-07 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 3e-07 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 3e-07 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 3e-07 | |
| cd11941 | 57 | cd11941, SH3_ARHGEF37_C2, Second C-terminal Src ho | 4e-07 | |
| cd12072 | 57 | cd12072, SH3_FNBP1L, Src Homology 3 domain of Form | 4e-07 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 4e-07 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 4e-07 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 4e-07 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 5e-07 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 5e-07 | |
| cd11888 | 54 | cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o | 5e-07 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 6e-07 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 6e-07 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 6e-07 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 6e-07 | |
| cd11903 | 59 | cd11903, SH3_Nck2_3, Third Src Homology 3 domain o | 7e-07 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 7e-07 | |
| cd11852 | 62 | cd11852, SH3_Kalirin_1, First Src homology 3 domai | 9e-07 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 9e-07 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 1e-06 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 1e-06 | |
| cd12003 | 62 | cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr | 1e-06 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 1e-06 | |
| cd11925 | 57 | cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain | 1e-06 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 2e-06 | |
| cd11916 | 59 | cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H | 2e-06 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 2e-06 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 2e-06 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 3e-06 | |
| cd12018 | 56 | cd12018, SH3_Tks4_4, Fourth (C-terminal) Src homol | 3e-06 | |
| cd12071 | 57 | cd12071, SH3_FBP17, Src Homology 3 domain of Formi | 3e-06 | |
| cd11922 | 58 | cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai | 4e-06 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 4e-06 | |
| cd11918 | 58 | cd11918, SH3_Vinexin_3, Third (or C-terminal) Src | 4e-06 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 4e-06 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 4e-06 | |
| cd11777 | 55 | cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain | 5e-06 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 5e-06 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 6e-06 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 7e-06 | |
| cd11998 | 56 | cd11998, SH3_PACSIN1-2, Src homology 3 domain of P | 1e-05 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 1e-05 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 1e-05 | |
| cd12035 | 62 | cd12035, SH3_MPP1-like, Src Homology 3 domain of M | 1e-05 | |
| cd11973 | 73 | cd11973, SH3_ASEF, Src homology 3 domain of APC-St | 2e-05 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 2e-05 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 2e-05 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 2e-05 | |
| cd11886 | 55 | cd11886, SH3_BOI, Src Homology 3 domain of fungal | 2e-05 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 2e-05 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 2e-05 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 2e-05 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 2e-05 | |
| cd11935 | 58 | cd11935, SH3_Nebulette_C, C-terminal Src Homology | 3e-05 | |
| cd11865 | 55 | cd11865, SH3_Nbp2-like, Src Homology 3 domain of S | 3e-05 | |
| cd11962 | 54 | cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h | 3e-05 | |
| cd11896 | 55 | cd11896, SH3_SNX33, Src Homology 3 domain of Sorti | 3e-05 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 3e-05 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 3e-05 | |
| cd11958 | 51 | cd11958, SH3_RUSC1, Src homology 3 domain of RUN a | 3e-05 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 4e-05 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 5e-05 | |
| cd11780 | 55 | cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho | 5e-05 | |
| cd11991 | 52 | cd11991, SH3_Intersectin1_3, Third Src homology 3 | 5e-05 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 6e-05 | |
| cd11970 | 60 | cd11970, SH3_PLCgamma1, Src homology 3 domain of P | 6e-05 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 7e-05 | |
| cd11997 | 56 | cd11997, SH3_PACSIN3, Src homology 3 domain of Pro | 7e-05 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 7e-05 | |
| cd12024 | 53 | cd12024, SH3_NoxO1_2, Second or C-terminal Src hom | 8e-05 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 8e-05 | |
| cd11861 | 61 | cd11861, SH3_DLG-like, Src Homology 3 domain of Di | 9e-05 | |
| cd12034 | 61 | cd12034, SH3_MPP4, Src Homology 3 domain of Membra | 1e-04 | |
| cd11974 | 54 | cd11974, SH3_ASEF2, Src homology 3 domain of APC-S | 1e-04 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 1e-04 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 1e-04 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 1e-04 | |
| cd12002 | 57 | cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( | 1e-04 | |
| cd11933 | 58 | cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 | 1e-04 | |
| cd11788 | 59 | cd11788, SH3_RasGAP, Src Homology 3 domain of Ras | 2e-04 | |
| cd12030 | 66 | cd12030, SH3_DLG4, Src Homology 3 domain of Disks | 2e-04 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 2e-04 | |
| cd11857 | 55 | cd11857, SH3_DBS, Src homology 3 domain of DBL's B | 2e-04 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 2e-04 | |
| cd12033 | 61 | cd12033, SH3_MPP7, Src Homology 3 domain of Membra | 3e-04 | |
| cd11894 | 56 | cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai | 3e-04 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 3e-04 | |
| cd11980 | 60 | cd11980, SH3_VAV2_1, First Src homology 3 domain o | 3e-04 | |
| cd11821 | 53 | cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP | 4e-04 | |
| cd11831 | 62 | cd11831, SH3_VAV_1, First Src homology 3 domain of | 4e-04 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 4e-04 | |
| cd12025 | 63 | cd12025, SH3_Obscurin_like, Src homology 3 domain | 4e-04 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 4e-04 | |
| cd11832 | 50 | cd11832, SH3_Shank, Src homology 3 domain of SH3 a | 5e-04 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 5e-04 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 5e-04 | |
| cd12029 | 67 | cd12029, SH3_DLG3, Src Homology 3 domain of Disks | 5e-04 | |
| cd11881 | 64 | cd11881, SH3_MYO7A, Src Homology 3 domain of Myosi | 5e-04 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 5e-04 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 5e-04 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 5e-04 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 6e-04 | |
| cd12020 | 57 | cd12020, SH3_Tks5_5, Fifth (C-terminal) Src homolo | 6e-04 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 8e-04 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 8e-04 | |
| cd12051 | 56 | cd12051, SH3_DOCK1_5_A, Src Homology 3 domain of C | 8e-04 | |
| cd12143 | 57 | cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho | 9e-04 | |
| cd11898 | 57 | cd11898, SH3_SNX9, Src Homology 3 domain of Sortin | 0.001 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 0.001 | |
| cd12080 | 62 | cd12080, SH3_MPP1, Src Homology 3 domain of Membra | 0.001 | |
| cd11902 | 55 | cd11902, SH3_Nck2_2, Second Src Homology 3 domain | 0.001 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 0.001 | |
| cd12022 | 53 | cd12022, SH3_p47phox_2, Second or C-terminal Src h | 0.001 | |
| cd11982 | 52 | cd11982, SH3_Shank1, Src homology 3 domain of SH3 | 0.001 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 0.001 | |
| cd12032 | 74 | cd12032, SH3_DLG2, Src Homology 3 domain of Disks | 0.001 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 0.001 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 0.001 | |
| cd12031 | 67 | cd12031, SH3_DLG1, Src Homology 3 domain of Disks | 0.002 | |
| cd12037 | 59 | cd12037, SH3_MPP2, Src Homology 3 domain of Membra | 0.002 | |
| cd12074 | 53 | cd12074, SH3_Tks5_1, First Src homology 3 domain o | 0.002 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 0.002 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 0.002 | |
| cd12053 | 56 | cd12053, SH3_CD2AP_1, First Src Homology 3 domain | 0.002 | |
| cd12036 | 63 | cd12036, SH3_MPP5, Src Homology 3 domain of Membra | 0.003 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 0.003 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 0.003 | |
| cd11860 | 63 | cd11860, SH3_DLG5, Src homology 3 domain of Disks | 0.003 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 0.003 | |
| cd11994 | 59 | cd11994, SH3_Intersectin2_4, Fourth Src homology 3 | 0.003 |
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
Score = 103 bits (260), Expect = 9e-32
Identities = 37/52 (71%), Positives = 47/52 (90%)
Query: 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNY 52
I+VALYDY+ARTD+DLSF+KG+ L+IL+D+ GDWWLAR +T +EGYIPSNY
Sbjct: 1 IYVALYDYEARTDDDLSFKKGDRLQILDDSDGDWWLARHLSTGKEGYIPSNY 52
|
Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes, and Brk. Src (or c-Src) proteins are cytoplasmic (or non-receptor) PTKs which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). However, Brk lacks the N-terminal myristoylation sites. Src proteins are involved in signaling pathways that regulate cytokine and growth factor responses, cytoskeleton dynamics, cell proliferation, survival, and differentiation. They were identified as the first proto-oncogene products, and they regulate cell adhesion, invasion, and motility in cancer cells, and tumor vasculature, contributing to cancer progression and metastasis. Src kinases are overexpressed in a variety of human cancers, making them attractive targets for therapy. They are also implicated in acute inflammatory responses and osteoclast function. Src, Fyn, Yes, and Yrk are widely expressed, while Blk, Lck, Hck, Fgr, Lyn, and Brk show a limited expression pattern. This subfamily also includes Drosophila Src42A, Src oncogene at 42A (also known as Dsrc41) which accumulates at sites of cell-cell or cell-matrix adhesion, and participates in Drosphila development and wound healing. It has been shown to promote tube elongation in the tracheal system, is essential for proper cell-cell matching during dorsal closure, and regulates cell-cell contacts in developing Drosophila eyes. The SH3 domain of Src kinases contributes to substrate recruitment by binding adaptor proteins/substrates, and regulation of kinase activity through an intramolecular interaction. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 52 |
| >gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor Protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212943 cd12010, SH3_SLAP, Src homology 3 domain of Src-Like Adaptor Protein | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212780 cd11846, SH3_Srms, Src homology 3 domain of Srms Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212874 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37 | Back alignment and domain information |
|---|
| >gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212786 cd11852, SH3_Kalirin_1, First Src homology 3 domain of the RhoGEF kinase, Kalirin | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212951 cd12018, SH3_Tks4_4, Fourth (C-terminal) Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of Cdc42-Interacting Protein 4, Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) | Back alignment and domain information |
|---|
| >gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces cerevisiae Nap1-binding protein 2 and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33 | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) | Back alignment and domain information |
|---|
| >gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 | Back alignment and domain information |
|---|
| >gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin | Back alignment and domain information |
|---|
| >gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212791 cd11857, SH3_DBS, Src homology 3 domain of DBL's Big Sister (DBS), a guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) | Back alignment and domain information |
|---|
| >gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212913 cd11980, SH3_VAV2_1, First Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212765 cd11831, SH3_VAV_1, First Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212958 cd12025, SH3_Obscurin_like, Src homology 3 domain of Obscurin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212766 cd11832, SH3_Shank, Src homology 3 domain of SH3 and multiple ankyrin repeat domains (Shank) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212814 cd11881, SH3_MYO7A, Src Homology 3 domain of Myosin VIIa and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212953 cd12020, SH3_Tks5_5, Fifth (C-terminal) Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212984 cd12051, SH3_DOCK1_5_A, Src Homology 3 domain of Class A Dedicator of Cytokinesis proteins 1 and 5 | Back alignment and domain information |
|---|
| >gnl|CDD|213019 cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212831 cd11898, SH3_SNX9, Src Homology 3 domain of Sorting nexin 9 | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) | Back alignment and domain information |
|---|
| >gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212915 cd11982, SH3_Shank1, Src homology 3 domain of SH3 and multiple ankyrin repeat domains protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212965 cd12032, SH3_DLG2, Src Homology 3 domain of Disks Large homolog 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) | Back alignment and domain information |
|---|
| >gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212794 cd11860, SH3_DLG5, Src homology 3 domain of Disks Large homolog 5 | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212927 cd11994, SH3_Intersectin2_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.7 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.62 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.62 | |
| KOG2070|consensus | 661 | 99.48 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 99.43 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 99.42 | |
| KOG2199|consensus | 462 | 99.36 | ||
| KOG1029|consensus | 1118 | 99.32 | ||
| KOG1118|consensus | 366 | 99.29 | ||
| KOG4226|consensus | 379 | 99.23 | ||
| KOG4225|consensus | 489 | 99.2 | ||
| KOG0162|consensus | 1106 | 99.18 | ||
| KOG4278|consensus | 1157 | 99.18 | ||
| KOG4225|consensus | 489 | 99.14 | ||
| KOG4226|consensus | 379 | 99.09 | ||
| KOG4348|consensus | 627 | 99.0 | ||
| KOG2996|consensus | 865 | 98.96 | ||
| KOG2856|consensus | 472 | 98.89 | ||
| KOG1264|consensus | 1267 | 98.88 | ||
| KOG2546|consensus | 483 | 98.87 | ||
| KOG1702|consensus | 264 | 98.82 | ||
| KOG3875|consensus | 362 | 98.78 | ||
| KOG4348|consensus | 627 | 98.77 | ||
| KOG0197|consensus | 468 | 98.77 | ||
| KOG4792|consensus | 293 | 98.75 | ||
| KOG1029|consensus | 1118 | 98.66 | ||
| KOG0515|consensus | 752 | 98.66 | ||
| KOG3655|consensus | 484 | 98.54 | ||
| KOG3523|consensus | 695 | 98.46 | ||
| KOG3601|consensus | 222 | 98.43 | ||
| KOG1843|consensus | 473 | 98.4 | ||
| KOG3775|consensus | 482 | 98.21 | ||
| KOG4575|consensus | 874 | 98.07 | ||
| KOG4773|consensus | 386 | 97.94 | ||
| KOG3557|consensus | 721 | 97.9 | ||
| KOG0609|consensus | 542 | 97.82 | ||
| KOG2996|consensus | 865 | 97.62 | ||
| KOG2222|consensus | 848 | 97.58 | ||
| KOG3632|consensus | 1335 | 97.57 | ||
| KOG2528|consensus | 490 | 97.48 | ||
| KOG0199|consensus | 1039 | 97.41 | ||
| KOG4792|consensus | 293 | 97.24 | ||
| KOG3771|consensus | 460 | 96.95 | ||
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 96.76 | |
| KOG1451|consensus | 812 | 96.54 | ||
| KOG4429|consensus | 421 | 96.32 | ||
| KOG3812|consensus | 475 | 96.27 | ||
| KOG3725|consensus | 375 | 96.22 | ||
| KOG3601|consensus | 222 | 96.2 | ||
| KOG3705|consensus | 580 | 95.87 | ||
| KOG3565|consensus | 640 | 95.78 | ||
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 95.01 | |
| KOG3632|consensus | 1335 | 93.73 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.61 | |
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 91.03 | |
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 89.51 | |
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 87.11 | |
| smart00743 | 61 | Agenet Tudor-like domain present in plant sequence | 84.84 | |
| KOG0040|consensus | 2399 | 83.14 |
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
Probab=99.70 E-value=1.3e-16 Score=67.12 Aligned_cols=49 Identities=43% Similarity=0.998 Sum_probs=43.4
Q ss_pred EeeccCCCCCCCceecCCCEEEEEEcCCCCeEEEEeCCCCcEEEEecCCee
Q psy1682 4 ALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVA 54 (70)
Q Consensus 4 ~~~~~~~~~~~~l~~~~~~~i~v~~~~~~~~~~~~~~~~~~~g~~p~~~~~ 54 (70)
|+|+|.+..+++|+|++|+.|.++...+++||.++. +++.|+||++|++
T Consensus 1 Al~~y~~~~~dELs~~~Gd~i~v~~~~~~~W~~g~~--~g~~G~~P~~yV~ 49 (49)
T PF14604_consen 1 ALYDYEAQDPDELSFKKGDVITVLEKSDDGWWYGRN--TGRTGLFPANYVE 49 (49)
T ss_dssp ESSCBCSSSTTB-EB-TTEEEEEEEESSTSEEEEEE--TTEEEEEEGGGEE
T ss_pred CCccCCCCCcCEeeEcCCCEEEEEEeCCCCEEEEEE--CCEEEEECHHhCC
Confidence 689999999999999999999999888899999997 6899999999974
|
... |
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >smart00743 Agenet Tudor-like domain present in plant sequences | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 70 | ||||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 3e-21 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 3e-21 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 3e-21 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 3e-21 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 4e-21 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 4e-21 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 3e-20 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 4e-20 | ||
| 1a0n_B | 69 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 1e-19 | ||
| 1azg_B | 67 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 1e-19 | ||
| 2hda_A | 64 | Yes Sh3 Domain Length = 64 | 3e-19 | ||
| 1qwe_A | 64 | C-Src Sh3 Domain Complexed With Ligand App12 Length | 1e-18 | ||
| 1prl_C | 64 | Two Binding Orientations For Peptides To Src Sh3 Do | 1e-18 | ||
| 4hxj_A | 60 | Crystal Structure Of Sh3:rgt Complex Length = 60 | 1e-18 | ||
| 1m27_C | 61 | Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX | 2e-18 | ||
| 3fj5_A | 57 | Crystal Structure Of The C-Src-Sh3 Domain Length = | 6e-18 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 7e-18 | ||
| 1avz_C | 57 | V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D | 2e-17 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 2e-17 | ||
| 1shf_A | 59 | Crystal Structure Of The Sh3 Domain In Human Fyn; C | 2e-17 | ||
| 1efn_A | 59 | Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S | 7e-17 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 1e-16 | ||
| 3h0h_A | 73 | Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le | 1e-16 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 1e-16 | ||
| 3h0f_A | 73 | Crystal Structure Of The Human Fyn Sh3 R96w Mutant | 2e-16 | ||
| 3nhn_A | 193 | Crystal Structure Of The Src-Family Kinase Hck Sh3- | 2e-16 | ||
| 4d8d_A | 58 | Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant | 2e-16 | ||
| 4hck_A | 72 | Human Hck Sh3 Domain, Nmr, 25 Structures Length = 7 | 8e-16 | ||
| 4ag2_C | 84 | Human Chymase - Fynomer Complex Length = 84 | 2e-15 | ||
| 2oi3_A | 86 | Nmr Structure Analysis Of The Hematopoetic Cell Kin | 2e-15 | ||
| 3cqt_A | 79 | N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | 3e-15 | ||
| 4afz_C | 84 | Human Chymase - Fynomer Complex Length = 84 | 5e-15 | ||
| 2l2p_A | 66 | Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FR | 6e-15 | ||
| 1bu1_A | 57 | Src Family Kinase Hck Sh3 Domain Length = 57 | 3e-14 | ||
| 4afq_C | 85 | Human Chymase - Fynomer Complex Length = 85 | 6e-14 | ||
| 1lck_A | 175 | Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K | 7e-14 | ||
| 1x27_A | 167 | Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S | 8e-14 | ||
| 4d8k_A | 175 | Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc | 9e-14 | ||
| 3reb_B | 90 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 1e-13 | ||
| 3rea_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 2e-13 | ||
| 1wa7_A | 65 | Sh3 Domain Of Human Lyn Tyrosine Kinase Length = 65 | 3e-13 | ||
| 3rbb_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck Sh | 1e-12 | ||
| 2d8j_A | 77 | Solution Structure Of The Sh3 Domain Of Fyn-Related | 4e-12 | ||
| 2iim_A | 62 | Sh3 Domain Of Human Lck Length = 62 | 2e-10 | ||
| 1h92_A | 63 | Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 | 2e-10 | ||
| 1kik_A | 57 | Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Leng | 2e-10 | ||
| 1aww_A | 67 | Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 S | 3e-08 | ||
| 1qly_A | 58 | Nmr Study Of The Sh3 Domain From Bruton's Tyrosine | 3e-08 | ||
| 2abl_A | 163 | Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K | 5e-08 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 7e-08 | ||
| 2rmo_A | 70 | Solution Structure Of Alpha-Spectrin_sh3-Bergerac F | 7e-08 | ||
| 2kr3_A | 70 | Solution Structure Of Sha-D Length = 70 | 8e-08 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 1e-07 | ||
| 1gl5_A | 67 | Nmr Structure Of The Sh3 Domain From The Tec Protei | 1e-07 | ||
| 3i9q_A | 57 | Crystal Structure Of The Triple Mutant S19g-P20d-R2 | 1e-07 | ||
| 1neg_A | 83 | Crystal Structure Analysis Of N-And C-Terminal Labe | 1e-07 | ||
| 1hd3_A | 62 | A-Spectrin Sh3 Domain F52y Mutant Length = 62 | 2e-07 | ||
| 1uue_A | 62 | A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = | 2e-07 | ||
| 2cdt_A | 62 | Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | 2e-07 | ||
| 2oaw_A | 65 | Structure Of Shh Variant Of "bergerac" Chimera Of S | 2e-07 | ||
| 2f2v_A | 62 | Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | 3e-07 | ||
| 2rot_A | 70 | Structure Of Chimeric Variant Of Sh3 Domain- Shh Le | 3e-07 | ||
| 3m0s_A | 57 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 3e-07 | ||
| 1bbz_A | 58 | Crystal Structure Of The Abl-Sh3 Domain Complexed W | 3e-07 | ||
| 3m0p_A | 62 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 3e-07 | ||
| 1abo_A | 62 | Crystal Structure Of The Complex Of The Abl Tyrosin | 3e-07 | ||
| 1bk2_A | 57 | A-Spectrin Sh3 Domain D48g Mutant Length = 57 | 3e-07 | ||
| 1ju5_C | 61 | Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P | 3e-07 | ||
| 3thk_A | 73 | Structure Of Sh3 Chimera With A Type Ii Ligand Link | 4e-07 | ||
| 1pwt_A | 61 | Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw | 4e-07 | ||
| 2lj3_A | 63 | Pfbd: High-Throughput Strategy Of Backbone Fold Det | 4e-07 | ||
| 1m8m_A | 62 | Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 | 4e-07 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 4e-07 | ||
| 2f2w_A | 62 | Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | 4e-07 | ||
| 1qkx_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47a Mutant I | 5e-07 | ||
| 1x2p_A | 68 | Solution Structure Of The Sh3 Domain Of The Protein | 5e-07 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 5e-07 | ||
| 3qwx_X | 174 | Ced-2 1-174 Length = 174 | 5e-07 | ||
| 2b86_A | 67 | Solution Structure Of The First Src Homology 3 Doma | 6e-07 | ||
| 2f2x_A | 62 | Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | 6e-07 | ||
| 2jxb_A | 86 | Structure Of Cd3epsilon-Nck2 First Sh3 Domain Compl | 6e-07 | ||
| 1awo_A | 62 | The Solution Nmr Structure Of Abl Sh3 And Its Relat | 7e-07 | ||
| 1qkw_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47g Mutant I | 7e-07 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 8e-07 | ||
| 1e6g_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l | 8e-07 | ||
| 3qwy_A | 308 | Ced-2 Length = 308 | 1e-06 | ||
| 3eg0_A | 63 | Crystal Structure Of The N114t Mutant Of Abl-Sh3 Do | 1e-06 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 2e-06 | ||
| 3ngp_A | 62 | High Resolution Structure Of Alpha-Spectrin Sh3 Dom | 2e-06 | ||
| 1x2q_A | 88 | Solution Structure Of The Sh3 Domain Of The Signal | 2e-06 | ||
| 3eg1_A | 63 | Crystal Structure Of The N114q Mutant Of Abl-Sh3 Do | 2e-06 | ||
| 1e7o_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l | 2e-06 | ||
| 1oeb_A | 62 | MonaGADS SH3C DOMAIN Length = 62 | 2e-06 | ||
| 2d0n_A | 59 | Crystal Structure Of The C-Terminal Sh3 Domain Of T | 2e-06 | ||
| 1uti_A | 58 | MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L | 2e-06 | ||
| 3eg3_A | 63 | Crystal Structure Of The N114a Mutant Of Abl-sh3 Do | 2e-06 | ||
| 2o88_A | 58 | Crystal Structure Of The N114a Mutant Of Abl-Sh3 Do | 2e-06 | ||
| 1h3h_A | 60 | Structural Basis For Specific Recognition Of An Rxx | 3e-06 | ||
| 2jw4_A | 72 | Nmr Solution Structure Of The N-Terminal Sh3 Domain | 3e-06 | ||
| 2kgt_A | 72 | Solution Structure Of Sh3 Domain Of Ptk6 Length = 7 | 3e-06 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 3e-06 | ||
| 1e6h_A | 62 | A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutant | 3e-06 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 4e-06 | ||
| 1h8k_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l | 4e-06 | ||
| 2vge_A | 229 | Crystal Structure Of The C-Terminal Region Of Human | 4e-06 | ||
| 2a37_A | 59 | Solution Structure Of The T22g Mutant Of N-Terminal | 4e-06 | ||
| 2lqw_A | 303 | Solution Structure Of Phosphorylated Crkl Length = | 5e-06 | ||
| 2vvk_A | 56 | Grb2 Sh3c (1) Length = 56 | 5e-06 | ||
| 2js2_A | 63 | Solution Structure Of First Sh3 Domain Of Adaptor N | 6e-06 | ||
| 1wxt_A | 68 | Solution Structure Of The Sh3 Domain Of Human Hypot | 6e-06 | ||
| 1gcq_A | 61 | Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt | 6e-06 | ||
| 2lqn_A | 303 | Solution Structure Of Crkl Length = 303 | 6e-06 | ||
| 1io6_A | 59 | Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter | 7e-06 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 7e-06 | ||
| 2dl4_A | 68 | Solution Structure Of The First Sh3 Domain Of Stac | 7e-06 | ||
| 2fry_A | 61 | Solution Structure Of The Third Sh3 Domain Of Human | 8e-06 | ||
| 1x2k_A | 68 | Solution Structure Of The Sh3 Domain Of Human Osteo | 8e-06 | ||
| 1zlm_A | 58 | Crystal Structure Of The Sh3 Domain Of Human Osteoc | 8e-06 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 8e-06 | ||
| 1wx6_A | 91 | Solution Structure Of The Sh3 Domain Of The Human C | 9e-06 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 9e-06 | ||
| 1u5s_A | 71 | Nmr Structure Of The Complex Between Nck-2 Sh3 Doma | 1e-05 | ||
| 2l3s_A | 163 | Structure Of The Autoinhibited Crk Length = 163 | 1e-05 | ||
| 1uhc_A | 79 | Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of | 1e-05 | ||
| 4esr_A | 69 | Molecular And Structural Characterization Of The Sh | 2e-05 | ||
| 2lj1_A | 64 | The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Len | 2e-05 | ||
| 2cuc_A | 70 | Solution Structure Of The Sh3 Domain Of The Mouse H | 2e-05 | ||
| 2yuq_A | 85 | Solution Structure Of The Sh3 Domain Of Human Tyros | 2e-05 | ||
| 2lj0_A | 65 | The Third Sh3 Domain Of R85fl Length = 65 | 2e-05 | ||
| 2yup_A | 90 | Solution Structure Of The Second Sh3 Domain Of Huma | 2e-05 | ||
| 2l0a_A | 72 | Solution Nmr Structure Of Signal Transducing Adapte | 3e-05 | ||
| 2rf0_A | 89 | Crystal Structure Of Human Mixed Lineage Kinase Map | 3e-05 | ||
| 2lmj_A | 66 | Itk-Sh3 Length = 66 | 3e-05 | ||
| 2a36_A | 59 | Solution Structure Of The N-Terminal Sh3 Domain Of | 4e-05 | ||
| 1wxb_A | 68 | Solution Structure Of The Sh3 Domain From Human Epi | 4e-05 | ||
| 2cud_A | 79 | Solution Structure Of The Sh3 Domain Of The Human S | 4e-05 | ||
| 2o2w_A | 67 | Extending Powder Diffraction To Proteins: Structure | 4e-05 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 4e-05 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 4e-05 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 4e-05 | ||
| 2eyw_A | 78 | N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Leng | 5e-05 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 5e-05 | ||
| 2epd_A | 76 | Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti | 5e-05 | ||
| 2eyz_A | 304 | Ct10-Regulated Kinase Isoform Ii Length = 304 | 6e-05 | ||
| 1jeg_A | 83 | Solution Structure Of The Sh3 Domain From C-Termina | 6e-05 | ||
| 2xmf_A | 60 | Myosin 1e Sh3 Length = 60 | 6e-05 | ||
| 3nmz_D | 116 | Crytal Structure Of Apc Complexed With Asef Length | 6e-05 | ||
| 2eyy_A | 204 | Ct10-Regulated Kinase Isoform I Length = 204 | 8e-05 | ||
| 2dvj_A | 230 | Phosphorylated Crk-Ii Length = 230 | 8e-05 | ||
| 2ct3_A | 70 | Solution Structure Of The Sh3 Domain Of The Vinexin | 9e-05 | ||
| 2ecz_A | 70 | Solution Structure Of The Sh3 Domain Of Sorbin And | 9e-05 | ||
| 1cka_A | 57 | Structural Basis For The Specific Interaction Of Ly | 1e-04 | ||
| 1b07_A | 65 | Crk Sh3 Domain Complexed With Peptoid Inhibitor Len | 1e-04 | ||
| 1m30_A | 58 | Solution Structure Of N-Terminal Sh3 Domain From On | 1e-04 | ||
| 1m3a_A | 57 | Solution Structure Of A Circular Form Of The Trunca | 1e-04 | ||
| 1m3c_A | 60 | Solution Structure Of A Circular Form Of The N-Term | 1e-04 | ||
| 1m3b_A | 58 | Solution Structure Of A Circular Form Of The N-Term | 1e-04 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 1e-04 | ||
| 2pz1_A | 466 | Crystal Structure Of Auto-Inhibited Asef Length = 4 | 1e-04 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 2e-04 | ||
| 1csk_A | 71 | The Crystal Structure Of Human Csksh3: Structural D | 2e-04 | ||
| 2csq_A | 97 | Solution Structure Of The Second Sh3 Domain Of Huma | 2e-04 | ||
| 1aze_A | 56 | Nmr Structure Of The Complex Between The C32s-Y7v M | 2e-04 | ||
| 2ct4_A | 70 | Solution Strutcure Of The Sh3 Domain Of The Cdc42- | 2e-04 | ||
| 2dil_A | 69 | Solution Structure Of The Sh3 Domain Of The Human P | 2e-04 | ||
| 1s1n_A | 68 | Sh3 Domain Of Human Nephrocystin Length = 68 | 3e-04 | ||
| 2k2m_A | 68 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 3e-04 | ||
| 2rol_A | 64 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 3e-04 | ||
| 2rpn_A | 59 | A Crucial Role For High Intrinsic Specificity In Th | 3e-04 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 3e-04 | ||
| 1wyx_A | 69 | The Crystal Structure Of The P130cas Sh3 Domain At | 3e-04 | ||
| 1jo8_A | 58 | Structural Analysis Of The Yeast Actin Binding Prot | 3e-04 | ||
| 2k3b_A | 62 | Seeing The Invisible: Structures Of Excited Protein | 4e-04 | ||
| 2dx1_A | 482 | Crystal Structure Of Rhogef Protein Asef Length = 4 | 4e-04 | ||
| 2eqi_A | 69 | Solution Structure Of The Sh3 Domain From Phospholi | 4e-04 | ||
| 2k79_A | 63 | Solution Structure Of The Binary Complex Between Th | 4e-04 | ||
| 1awj_A | 77 | Intramolecular Itk-Proline Complex, Nmr, Minimized | 5e-04 | ||
| 2rn8_A | 64 | Nmr Structure Note: Murine Itk Sh3 Domain Length = | 5e-04 | ||
| 2dl8_A | 72 | Solution Structure Of The Sh3 Domain Of Human Slit- | 5e-04 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 6e-04 | ||
| 1g2b_A | 62 | Alpha-Spectrin Src Homology 3 Domain, Circular Perm | 6e-04 | ||
| 1tuc_A | 63 | Alpha-Spectrin Src Homology 3 Domain, Circular Perm | 7e-04 | ||
| 2jmc_A | 77 | Chimer Between Spc-Sh3 And P41 Length = 77 | 7e-04 | ||
| 2kxd_A | 73 | The Structure Of Sh3-F2 Length = 73 | 7e-04 | ||
| 4f14_A | 64 | Structure Of The Sh3 Domain Of Human Nebulette In C | 8e-04 |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
|
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 | Back alignment and structure |
| >pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 | Back alignment and structure |
| >pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1QWE|A Chain A, C-Src Sh3 Domain Complexed With Ligand App12 Length = 64 | Back alignment and structure |
| >pdb|1PRL|C Chain C, Two Binding Orientations For Peptides To Src Sh3 Domain: Development Of A General Model For Sh3-Ligand Interactions Length = 64 | Back alignment and structure |
| >pdb|4HXJ|A Chain A, Crystal Structure Of Sh3:rgt Complex Length = 60 | Back alignment and structure |
| >pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 | Back alignment and structure |
| >pdb|3FJ5|A Chain A, Crystal Structure Of The C-Src-Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 | Back alignment and structure |
| >pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 | Back alignment and structure |
| >pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 | Back alignment and structure |
| >pdb|4D8D|A Chain A, Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant Length = 58 | Back alignment and structure |
| >pdb|4HCK|A Chain A, Human Hck Sh3 Domain, Nmr, 25 Structures Length = 72 | Back alignment and structure |
| >pdb|4AG2|C Chain C, Human Chymase - Fynomer Complex Length = 84 | Back alignment and structure |
| >pdb|2OI3|A Chain A, Nmr Structure Analysis Of The Hematopoetic Cell Kinase Sh3 Domain Complexed With An Artificial High Affinity Ligand (Pd1) Length = 86 | Back alignment and structure |
| >pdb|3CQT|A Chain A, N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | Back alignment and structure |
| >pdb|4AFZ|C Chain C, Human Chymase - Fynomer Complex Length = 84 | Back alignment and structure |
| >pdb|2L2P|A Chain A, Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FROM NMR RELAXATION Dispersion Experiments Length = 66 | Back alignment and structure |
| >pdb|1BU1|A Chain A, Src Family Kinase Hck Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|4AFQ|C Chain C, Human Chymase - Fynomer Complex Length = 85 | Back alignment and structure |
| >pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 | Back alignment and structure |
| >pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 | Back alignment and structure |
| >pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 | Back alignment and structure |
| >pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 | Back alignment and structure |
| >pdb|3REA|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|3RBB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|2D8J|A Chain A, Solution Structure Of The Sh3 Domain Of Fyn-Related Kinase Length = 77 | Back alignment and structure |
| >pdb|2IIM|A Chain A, Sh3 Domain Of Human Lck Length = 62 | Back alignment and structure |
| >pdb|1H92|A Chain A, Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 | Back alignment and structure |
| >pdb|1KIK|A Chain A, Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Length = 57 | Back alignment and structure |
| >pdb|1AWW|A Chain A, Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 Structures Length = 67 | Back alignment and structure |
| >pdb|1QLY|A Chain A, Nmr Study Of The Sh3 Domain From Bruton's Tyrosine Kinase, 20 Structures Length = 58 | Back alignment and structure |
| >pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|2RMO|A Chain A, Solution Structure Of Alpha-Spectrin_sh3-Bergerac From Chicken Length = 70 | Back alignment and structure |
| >pdb|2KR3|A Chain A, Solution Structure Of Sha-D Length = 70 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|1GL5|A Chain A, Nmr Structure Of The Sh3 Domain From The Tec Protein Tyrosine Kinase Length = 67 | Back alignment and structure |
| >pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 | Back alignment and structure |
| >pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 | Back alignment and structure |
| >pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 | Back alignment and structure |
| >pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | Back alignment and structure |
| >pdb|2OAW|A Chain A, Structure Of Shh Variant Of "bergerac" Chimera Of Spectrin Sh3 Length = 65 | Back alignment and structure |
| >pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | Back alignment and structure |
| >pdb|2ROT|A Chain A, Structure Of Chimeric Variant Of Sh3 Domain- Shh Length = 70 | Back alignment and structure |
| >pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 | Back alignment and structure |
| >pdb|1BBZ|A Chain A, Crystal Structure Of The Abl-Sh3 Domain Complexed With A Designed High-Affinity Peptide Ligand: Implications For Sh3-Ligand Interactions Length = 58 | Back alignment and structure |
| >pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 | Back alignment and structure |
| >pdb|1ABO|A Chain A, Crystal Structure Of The Complex Of The Abl Tyrosine Kinase Sh3 Domain With 3bp-1 Synthetic Peptide Length = 62 | Back alignment and structure |
| >pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 | Back alignment and structure |
| >pdb|1JU5|C Chain C, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 61 | Back alignment and structure |
| >pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 | Back alignment and structure |
| >pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 | Back alignment and structure |
| >pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 | Back alignment and structure |
| >pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | Back alignment and structure |
| >pdb|1QKX|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47a Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|1X2P|A Chain A, Solution Structure Of The Sh3 Domain Of The Protein Arginine N-Methyltransferase 2 Length = 68 | Back alignment and structure |
| >pdb|3QWX|X Chain X, Ced-2 1-174 Length = 174 | Back alignment and structure |
| >pdb|2B86|A Chain A, Solution Structure Of The First Src Homology 3 Domain Of Nck2 Length = 67 | Back alignment and structure |
| >pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | Back alignment and structure |
| >pdb|2JXB|A Chain A, Structure Of Cd3epsilon-Nck2 First Sh3 Domain Complex Length = 86 | Back alignment and structure |
| >pdb|1AWO|A Chain A, The Solution Nmr Structure Of Abl Sh3 And Its Relationship To Sh2 In The Sh(32) Construct, 20 Structures Length = 62 | Back alignment and structure |
| >pdb|1QKW|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47g Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|1E6G|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|3QWY|A Chain A, Ced-2 Length = 308 | Back alignment and structure |
| >pdb|3EG0|A Chain A, Crystal Structure Of The N114t Mutant Of Abl-Sh3 Domain Length = 63 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|3NGP|A Chain A, High Resolution Structure Of Alpha-Spectrin Sh3 Domain Mutant With A Redesigned Core Length = 62 | Back alignment and structure |
| >pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 | Back alignment and structure |
| >pdb|3EG1|A Chain A, Crystal Structure Of The N114q Mutant Of Abl-Sh3 Domain Complexed With A Designed High-Affinity Peptide Ligand: Implications For Sh3-Ligand Interactions Length = 63 | Back alignment and structure |
| >pdb|1E7O|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l Mutations Length = 62 | Back alignment and structure |
| >pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 | Back alignment and structure |
| >pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 | Back alignment and structure |
| >pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 | Back alignment and structure |
| >pdb|3EG3|A Chain A, Crystal Structure Of The N114a Mutant Of Abl-sh3 Domain Length = 63 | Back alignment and structure |
| >pdb|2O88|A Chain A, Crystal Structure Of The N114a Mutant Of Abl-Sh3 Domain Complexed With A Designed High-Affinity Peptide Ligand: Implications For Sh3-Ligand Interactions Length = 58 | Back alignment and structure |
| >pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|2JW4|A Chain A, Nmr Solution Structure Of The N-Terminal Sh3 Domain Of Human Nckalpha Length = 72 | Back alignment and structure |
| >pdb|2KGT|A Chain A, Solution Structure Of Sh3 Domain Of Ptk6 Length = 72 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|1E6H|A Chain A, A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutants Length = 62 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|1H8K|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 | Back alignment and structure |
| >pdb|2A37|A Chain A, Solution Structure Of The T22g Mutant Of N-Terminal Sh3 Domain Of Drk (Drkn Sh3 Domain) Length = 59 | Back alignment and structure |
| >pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 | Back alignment and structure |
| >pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 | Back alignment and structure |
| >pdb|2JS2|A Chain A, Solution Structure Of First Sh3 Domain Of Adaptor Nck Length = 63 | Back alignment and structure |
| >pdb|1WXT|A Chain A, Solution Structure Of The Sh3 Domain Of Human Hypothetical Protein Flj21522 Length = 68 | Back alignment and structure |
| >pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 | Back alignment and structure |
| >pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 | Back alignment and structure |
| >pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
| >pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 | Back alignment and structure |
| >pdb|2FRY|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Nck2 Adaptor Protein Length = 61 | Back alignment and structure |
| >pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 | Back alignment and structure |
| >pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|1WX6|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck2 Length = 91 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|1U5S|A Chain A, Nmr Structure Of The Complex Between Nck-2 Sh3 Domain And Pinch-1 Lim4 Domain Length = 71 | Back alignment and structure |
| >pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 | Back alignment and structure |
| >pdb|1UHC|A Chain A, Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of Kiaa1010 Protein [homo Sapiens] Length = 79 | Back alignment and structure |
| >pdb|4ESR|A Chain A, Molecular And Structural Characterization Of The Sh3 Domain Of Ahi-1 In Regulation Of Cellular Resistance Of Bcr-Abl+ Chronic Myeloid Leukemia Cells To Tyrosine Kinase Inhibitors Length = 69 | Back alignment and structure |
| >pdb|2LJ1|A Chain A, The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Length = 64 | Back alignment and structure |
| >pdb|2CUC|A Chain A, Solution Structure Of The Sh3 Domain Of The Mouse Hypothetical Protein Sh3rf2 Length = 70 | Back alignment and structure |
| >pdb|2YUQ|A Chain A, Solution Structure Of The Sh3 Domain Of Human Tyrosine- Protein Kinase ItkTSK Length = 85 | Back alignment and structure |
| >pdb|2LJ0|A Chain A, The Third Sh3 Domain Of R85fl Length = 65 | Back alignment and structure |
| >pdb|2YUP|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Vinexin Length = 90 | Back alignment and structure |
| >pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 | Back alignment and structure |
| >pdb|2RF0|A Chain A, Crystal Structure Of Human Mixed Lineage Kinase Map3k10 Sh3 Domain Length = 89 | Back alignment and structure |
| >pdb|2LMJ|A Chain A, Itk-Sh3 Length = 66 | Back alignment and structure |
| >pdb|2A36|A Chain A, Solution Structure Of The N-Terminal Sh3 Domain Of Drk Length = 59 | Back alignment and structure |
| >pdb|1WXB|A Chain A, Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein Length = 68 | Back alignment and structure |
| >pdb|2CUD|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Src-Like Adopter Protein (Slap) Length = 79 | Back alignment and structure |
| >pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|2EYW|A Chain A, N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Length = 78 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 | Back alignment and structure |
| >pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 | Back alignment and structure |
| >pdb|1JEG|A Chain A, Solution Structure Of The Sh3 Domain From C-Terminal Src Kinase Complexed With A Peptide From The Tyrosine Phosphatase Pep Length = 83 | Back alignment and structure |
| >pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 | Back alignment and structure |
| >pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 | Back alignment and structure |
| >pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 | Back alignment and structure |
| >pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 | Back alignment and structure |
| >pdb|2CT3|A Chain A, Solution Structure Of The Sh3 Domain Of The Vinexin Protein Length = 70 | Back alignment and structure |
| >pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 | Back alignment and structure |
| >pdb|1CKA|A Chain A, Structural Basis For The Specific Interaction Of Lysine- Containing Proline-Rich Peptides With The N-Terminal Sh3 Domain Of C-Crk Length = 57 | Back alignment and structure |
| >pdb|1B07|A Chain A, Crk Sh3 Domain Complexed With Peptoid Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1M30|A Chain A, Solution Structure Of N-Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 58 | Back alignment and structure |
| >pdb|1M3A|A Chain A, Solution Structure Of A Circular Form Of The Truncated N- Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 57 | Back alignment and structure |
| >pdb|1M3C|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (E132c, E133g, R191g Mutant) From Oncogene Protein C-Crk Length = 60 | Back alignment and structure |
| >pdb|1M3B|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (A134c, E135g, R191g Mutant) From Oncogene Protein C-Crk Length = 58 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|1CSK|A Chain A, The Crystal Structure Of Human Csksh3: Structural Diversity Near The Rt-Src And N-Src Loop Length = 71 | Back alignment and structure |
| >pdb|2CSQ|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Rim- Binding Protein 2 Length = 97 | Back alignment and structure |
| >pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 | Back alignment and structure |
| >pdb|2CT4|A Chain A, Solution Strutcure Of The Sh3 Domain Of The Cdc42- Interacting Protein 4 Length = 70 | Back alignment and structure |
| >pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 | Back alignment and structure |
| >pdb|1S1N|A Chain A, Sh3 Domain Of Human Nephrocystin Length = 68 | Back alignment and structure |
| >pdb|2K2M|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 68 | Back alignment and structure |
| >pdb|2ROL|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 64 | Back alignment and structure |
| >pdb|2RPN|A Chain A, A Crucial Role For High Intrinsic Specificity In The Function Of Yeast Sh3 Domains Length = 59 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 | Back alignment and structure |
| >pdb|1JO8|A Chain A, Structural Analysis Of The Yeast Actin Binding Protein Abp1 Sh3 Domain Length = 58 | Back alignment and structure |
| >pdb|2K3B|A Chain A, Seeing The Invisible: Structures Of Excited Protein States By Relaxation Dispersion Nmr Length = 62 | Back alignment and structure |
| >pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 | Back alignment and structure |
| >pdb|2EQI|A Chain A, Solution Structure Of The Sh3 Domain From Phospholipase C, Gamma 2 Length = 69 | Back alignment and structure |
| >pdb|2K79|A Chain A, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 63 | Back alignment and structure |
| >pdb|1AWJ|A Chain A, Intramolecular Itk-Proline Complex, Nmr, Minimized Average Structure Length = 77 | Back alignment and structure |
| >pdb|2RN8|A Chain A, Nmr Structure Note: Murine Itk Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|2DL8|A Chain A, Solution Structure Of The Sh3 Domain Of Human Slit-Robo Rho Gtpase-Activating Protein 2 Length = 72 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|1G2B|A Chain A, Alpha-Spectrin Src Homology 3 Domain, Circular Permutant, Cut At N47-D48 Length = 62 | Back alignment and structure |
| >pdb|1TUC|A Chain A, Alpha-Spectrin Src Homology 3 Domain, Circular Permutant, Cut At S19-P20 Length = 63 | Back alignment and structure |
| >pdb|2JMC|A Chain A, Chimer Between Spc-Sh3 And P41 Length = 77 | Back alignment and structure |
| >pdb|2KXD|A Chain A, The Structure Of Sh3-F2 Length = 73 | Back alignment and structure |
| >pdb|4F14|A Chain A, Structure Of The Sh3 Domain Of Human Nebulette In Complex With A Peptide Of Xirp2 Length = 64 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 9e-33 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 8e-32 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 8e-32 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 2e-31 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 4e-31 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 7e-31 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 1e-30 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 8e-30 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 2e-29 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 2e-29 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 7e-29 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 2e-28 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 4e-28 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 5e-28 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 6e-28 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 7e-28 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 1e-27 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 5e-27 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 6e-27 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 8e-27 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 1e-26 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 2e-26 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 6e-26 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 6e-26 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 1e-25 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 1e-25 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 2e-25 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 2e-25 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 2e-25 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 6e-25 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 1e-24 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 1e-24 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 1e-24 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 2e-24 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 6e-24 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 1e-23 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 2e-23 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 3e-23 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 7e-23 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 9e-23 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 9e-23 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 2e-22 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 2e-22 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 3e-22 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 3e-22 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-21 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 2e-21 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 2e-21 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 4e-21 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 4e-21 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 5e-21 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 6e-21 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 2e-20 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 2e-20 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 1e-19 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 4e-08 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 1e-19 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 1e-19 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 3e-19 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 3e-19 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 5e-19 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 6e-19 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 1e-18 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 2e-18 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 3e-18 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 4e-18 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 5e-18 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 5e-18 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 8e-18 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 3e-15 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 8e-18 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 8e-18 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 2e-17 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 2e-17 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 1e-16 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-16 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 2e-16 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 2e-16 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 3e-16 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 3e-16 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 3e-16 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 3e-16 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 3e-16 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 3e-16 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 6e-16 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 8e-16 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 9e-16 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 1e-15 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 1e-15 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 2e-15 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 3e-15 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 4e-15 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 5e-15 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 5e-15 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 6e-15 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 6e-15 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 7e-15 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 8e-15 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 7e-12 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 9e-15 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 1e-14 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 2e-14 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 2e-14 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-14 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-14 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 2e-14 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 2e-14 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 3e-14 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 3e-14 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 4e-14 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 5e-14 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 5e-14 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 5e-14 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 1e-12 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 5e-14 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 5e-14 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 5e-14 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 6e-14 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 6e-14 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 9e-14 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-13 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 1e-13 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 1e-13 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 1e-13 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 1e-13 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 1e-13 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 1e-13 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 2e-13 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 2e-13 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 2e-13 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 2e-13 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 2e-13 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 2e-13 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 2e-13 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 2e-13 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 3e-13 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 3e-13 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 3e-13 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 3e-13 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 4e-13 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 4e-13 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 4e-13 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 4e-13 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 5e-13 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 5e-13 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 5e-13 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 6e-13 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 6e-13 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 7e-13 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 9e-13 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 1e-12 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 1e-12 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 1e-12 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 1e-12 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 1e-12 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-12 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-12 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 3e-12 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 8e-10 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 3e-12 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 3e-12 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 3e-12 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 3e-12 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 4e-12 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 5e-12 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 6e-12 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 6e-12 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 8e-12 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 8e-12 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 9e-12 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 1e-11 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 2e-11 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 2e-11 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 2e-11 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 3e-11 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 5e-11 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 5e-11 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 1e-10 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 1e-10 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 1e-10 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 2e-10 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 7e-10 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 8e-10 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 1e-09 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 2e-09 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 3e-09 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 4e-09 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 7e-09 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 9e-09 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 2e-08 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 2e-08 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 3e-08 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 8e-08 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 1e-07 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 4e-07 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 2e-06 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 3e-06 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 1e-05 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 1e-05 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 4e-05 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 5e-05 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 5e-05 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-05 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 8e-05 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 1e-04 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 7e-04 |
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
Score = 107 bits (269), Expect = 9e-33
Identities = 45/68 (66%), Positives = 54/68 (79%)
Query: 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE 60
IFVALYDY+ART EDLSF+KGE +I+N+T+GDWW ARS AT + GYIPSNYV SI+
Sbjct: 29 IFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVPADSIQ 88
Query: 61 AEPYDFKK 68
AE + F K
Sbjct: 89 AEEWYFGK 96
|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Length = 96 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.81 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.8 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.79 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.78 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.78 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.77 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.76 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.75 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.75 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.74 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.74 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.74 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.74 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.73 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.73 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.73 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.72 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.72 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.72 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.72 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.72 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.72 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.72 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.72 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.72 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.72 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.71 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.71 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.71 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.71 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.71 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.71 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.71 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.71 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.71 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.71 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.71 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.71 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.71 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.71 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.71 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.7 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.7 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.7 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.7 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.7 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.7 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.7 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.7 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.7 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.7 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.7 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.7 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.7 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.7 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.7 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.7 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.7 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.7 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.7 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.7 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.7 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.7 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.7 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.69 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.69 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.69 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.69 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.69 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.69 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.69 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.69 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.69 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.69 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.69 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.69 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.69 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.69 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.69 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.69 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.68 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.68 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.68 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.68 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.68 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.68 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.68 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.68 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.68 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.68 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.68 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.68 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.68 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.68 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.68 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.68 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.67 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.67 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.67 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.67 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.67 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.67 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.67 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.67 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.67 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.67 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.67 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.67 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.67 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.67 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.67 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.67 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.66 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.66 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.66 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.66 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.66 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.66 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.66 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.66 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.66 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.66 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.66 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.66 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.66 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.66 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.65 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.65 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.65 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.65 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.65 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.65 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.65 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.65 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.65 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.65 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.65 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.65 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.64 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.64 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.64 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.64 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.64 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.64 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.63 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.63 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.63 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.63 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.63 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.63 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.63 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.62 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.62 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.62 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 99.62 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.62 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.61 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.61 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.61 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.6 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.6 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.6 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.6 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.59 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.59 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.58 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.57 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.56 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.56 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.56 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.56 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.55 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.54 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.54 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.52 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.51 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.51 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.5 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.49 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.49 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.49 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.47 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.43 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.43 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.43 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.41 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 99.4 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 99.39 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.38 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.35 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.35 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 99.34 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 99.29 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.89 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.21 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.83 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 99.19 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.18 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 99.13 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.13 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 99.11 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 98.98 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.81 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 98.79 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.79 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.75 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 98.74 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.73 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.71 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 98.68 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 98.48 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 98.25 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.95 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 97.45 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 95.58 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 94.72 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 94.71 | |
| 2kq8_A | 70 | Cell WALL hydrolase; GFT protein structure, NESG, | 94.08 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 94.0 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 92.98 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 89.85 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 87.38 | |
| 2hbw_A | 235 | NLP/P60 protein; NLP/P60 family protein, structura | 87.08 | |
| 3npf_A | 306 | Putative dipeptidyl-peptidase VI; structural genom | 83.47 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 82.09 |
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
Probab=99.81 E-value=2.4e-19 Score=78.77 Aligned_cols=55 Identities=35% Similarity=0.764 Sum_probs=51.4
Q ss_pred EEEeeccCCCCCCCceecCCCEEEEEEcCCCCeEEEEeCCCCcEEEEecCCeeec
Q psy1682 2 FVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKL 56 (70)
Q Consensus 2 ~~~~~~~~~~~~~~l~~~~~~~i~v~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~ 56 (70)
++|+|+|.+..+++|+|++|++|.++...+++||.++...+++.|+||++|++++
T Consensus 9 ~~Alydy~a~~~~ELs~~~Gd~i~v~~~~~~gWw~g~~~~~g~~G~~P~nyVe~l 63 (65)
T 2lj0_A 9 YQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPL 63 (65)
T ss_dssp EEESSCBCCSSTTBCCBCTTCEEEEEEECTTSEEEEEETTTCCEEEEETTSEEEC
T ss_pred EEEceeECCCCcCCcCCCCCCEEEEeEeCCCCEEEEEECCCCCEEEEehhHeEEE
Confidence 6899999999999999999999999998888999999877789999999999876
|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >2hbw_A NLP/P60 protein; NLP/P60 family protein, structural genomics, joint center FO structural genomics, JCSG, protein structure initiative; HET: UNL; 1.05A {Anabaena variabilis} PDB: 2evr_A 2fg0_A | Back alignment and structure |
|---|
| >3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 70 | ||||
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 1e-23 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 3e-22 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 6e-22 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 2e-21 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 1e-19 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 2e-19 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 7e-19 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-18 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 3e-18 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 5e-18 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 7e-18 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-17 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 2e-17 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 4e-17 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 4e-17 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 5e-17 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-17 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-17 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 9e-17 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 9e-17 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-16 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 1e-16 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-16 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-16 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 3e-16 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 4e-16 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 4e-16 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 4e-16 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 5e-16 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 7e-16 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 1e-15 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 3e-15 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 3e-15 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 3e-14 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 8e-14 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 3e-13 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 3e-13 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 5e-13 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 5e-13 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 7e-13 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 1e-12 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 1e-12 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 1e-12 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 2e-12 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 4e-12 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 5e-12 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 3e-11 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 7e-11 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 1e-09 | |
| d1ri9a_ | 77 | b.34.2.1 (A:) Fyn-binding protein (T-cell adapter | 3e-04 |
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: c-src protein tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 82.1 bits (203), Expect = 1e-23
Identities = 41/61 (67%), Positives = 51/61 (83%)
Query: 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKLKSIE 60
FVALYDY++RT+ DLSF+KGE L+I+N+T+GDWWLA S +T Q GYIPSNYVA SI+
Sbjct: 4 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQ 63
Query: 61 A 61
A
Sbjct: 64 A 64
|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.79 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.79 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.78 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.78 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.78 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.77 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.77 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.77 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.76 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.75 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.75 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.74 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.74 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.73 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.73 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.72 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.72 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.71 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.71 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.71 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.7 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.7 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.7 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.7 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.69 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.69 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.69 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.67 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.67 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.66 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.66 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.66 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.65 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.65 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.65 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.64 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.64 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.64 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.61 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.59 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.58 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.57 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.56 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.55 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 99.46 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 99.26 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 97.23 |
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Fyn proto-oncogene tyrosine kinase, SH3 domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=4.1e-19 Score=75.27 Aligned_cols=56 Identities=64% Similarity=1.169 Sum_probs=51.5
Q ss_pred CEEEeeccCCCCCCCceecCCCEEEEEEcCCCCeEEEEeCCCCcEEEEecCCeeec
Q psy1682 1 IFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKATKQEGYIPSNYVAKL 56 (70)
Q Consensus 1 ~~~~~~~~~~~~~~~l~~~~~~~i~v~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~ 56 (70)
+++|+|+|.++.+++|+|++|+.+.++.+..++||.++...+++.|+||.+|++++
T Consensus 2 l~vAl~dy~a~~~~eLs~~~Gd~i~v~~~~~~~Ww~~~~~~~g~~G~vP~~yv~pv 57 (57)
T d1efna_ 2 LFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV 57 (57)
T ss_dssp EEEESSCBCCSSTTBCCBCTTCEEEEEECSSCSEEEEEETTTTEEEEEEGGGEEEC
T ss_pred EEEECCCCCCCCcCCcCCCCCCEEEEEEecCCCCEEEEECCCCCEEEEeHHHeEEC
Confidence 36899999999999999999999999998888999999877899999999999864
|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|