Psyllid ID: psy16830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710--
MAPTNTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKISGKLSHETEARTHKLNEKEESTTKKKVNTHGASKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
cccccccHHHHHHHHHHHHHEEEEEEcccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEEEEEccccccEcccccccEcccccccHHHEEEEccccccccccccccccEEccccccccccccccccccEcccccHHEHEEEccccccccccccccEEcccccHHEHEEEcccccccccccccEEccccHHHHHHHHccccccccccccccEEcccccHHEEEEEEccccccccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccHHHHHHHcccccccccccccccHHEHccccccccccccccccEccccHHHEHEHEcccccccccccccccEccccHHHHHHHHHcccccccccccccccEcccccHHEHEHHcccccccccccccccEcccccHHHHHHHccccccccccccccccccEccccHHHHHHHHccccccccccccccEEcccccHHHEEEEEcccccccccccccccEEEcccccccccccccccEcccccHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHEccccccccccccEccccccEEcccccHHEHEHEcccccccccccccccEcccccHHHEEEEEEccccccEcccccccEEEcccccccEcccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccc
MAPTNTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKISGKLSHETEARTHklnekeesttkkkvnthgaskenvalnkpfkcddcdqcflTKILLNKHKllhteghltcnlcgQTFRQKFRLLNHMishstekpfscpickkqfkrkhevskhdrivhqgkkynvyksykcslcpkaFTHLAALedhqyvhtgqkshmcnlcsarfTCKGALLGHIKVLhegykrpqescqsshesktcsvdeinkeneegatirkvkphedskeymalnkpfkcddcfqcFLSKILLNQHKKqmhfnkggftcnscglifsEKKYLRNhmishstqkpfscslcgkrfkrengvinhqrLHQTKKVYKsykcslcprvFTHLAAledhqfvhtgqktrlctMCPAIFASIGGLRSHMKIVHhglktqqscqsshesktcsvdeinkeneegatirkvkphedskeymalnkpfkcddcdqRFLTKILLNKHkllhfdkdyfscnycgktflhkYKLRRHIVIhstarpfscpvckkqfkrkqdvaghdrvvhqGKKLIVYKsykcslcpkaftylgaledhqfvhtgqkthlctmcpasyatigglRSHIKIVHHglktqqscqsshesktcsvdeinkeneegatirkvkphedskeymalnkpfkcddcdqRFLTKILLNKHkllhfdkdyfscnycgktf
MAPTNTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQllettneklnerkilvwkkisgklshetearthklnekeesttkkkvnthgaskenvalnkpfkCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMIShstekpfscpiCKKQFKrkhevskhdrivhqgkkynVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKrpqescqsshesktcsvdeinkeneegatirkvkphedSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMIShstqkpfscsLCGKRFKRengvinhqrlhqtkkvYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLktqqscqsshesktcsvdeinkeneegatirkvkphedsKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHstarpfscpvcKKQFKrkqdvaghdrvvhqgkkliVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLktqqscqsshesktcsvdeinkeneegatirkvkphedsKEYMALNKPFKCDDCDQRFLTKILLNkhkllhfdkdyfscnycgKTF
MAPTNTllvvfflfvlkhvlvevvlqvfvgvvDAQLLETTNEKLNERKILVWKKISGKLSHETEARTHKLNEKEESTTKKKVNTHGASKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
*****TLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKIS***********************************VALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGY******************************************YMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGL*****************************************YMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGL*****************************************YMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCG***
*A*TN*LLVVFFLFVLKHVLVEVVLQVFVGVV*************************************LNEKEESTTKKKVNTHGASKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
MAPTNTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKISGKL****************************SKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQ***********RIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGY******************DEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHG*****************VDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKK***********DRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHG*****************VDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
****NTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKISGKLSHETEARTHKLNEKEESTTKKKVNTHGASKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPTNTLLVVFFLFVLKHVLVEVVLQVFVGVVDAQLLETTNEKLNERKILVWKKISGKLSHETEARTHKLNEKEESTTKKKVNTHGASKENVALNKPFKCDDCDQCFLTKILLNKHKLLHTEGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query712 2.2.26 [Sep-21-2011]
A6NN14 1173 Zinc finger protein 729 O yes N/A 0.771 0.468 0.307 6e-72
A8MXY4 1036 Zinc finger protein 99 OS no N/A 0.792 0.544 0.305 9e-69
O43345 1167 Zinc finger protein 208 O no N/A 0.856 0.522 0.299 1e-67
Q6ZNA1 936 Zinc finger protein 836 O no N/A 0.748 0.569 0.285 1e-66
Q8N4W9903 Zinc finger protein 808 O no N/A 0.785 0.619 0.311 2e-66
Q96IR2970 Zinc finger protein 845 O no N/A 0.793 0.582 0.303 2e-66
Q05481 1191 Zinc finger protein 91 OS no N/A 0.793 0.474 0.295 4e-66
Q08AN1781 Zinc finger protein 616 O no N/A 0.752 0.686 0.292 2e-65
Q5R5U3672 Zinc finger protein 271 O no N/A 0.764 0.809 0.297 3e-65
Q5TYW11059 Zinc finger protein 658 O no N/A 0.689 0.463 0.313 8e-65
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function desciption
 Score =  272 bits (696), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 197/640 (30%), Positives = 293/640 (45%), Gaps = 91/640 (14%)

Query: 96   KPFKCDDCDQCFLTKILLNKHKLLHT-EGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFS 154
            KP+KC++C + F +   L KHK++HT E    C  CG+ FRQ   L  H   H+ EKP+ 
Sbjct: 430  KPYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYK 489

Query: 155  CPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKS 214
            C  C K F    ++ +H +I+H GKK      YKC  C KAF+  + L +HQ +HTG+K 
Sbjct: 490  CEECGKAFNHFSDLRRH-KIIHTGKK-----PYKCEECGKAFSQSSTLRNHQIIHTGEKP 543

Query: 215  HMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSHESKTCSVDEINKENEEGATIRK 274
            + C  C   F     L  H KV+H G              K C  +E  K  +  + +RK
Sbjct: 544  YKCEECGKAFKWSSKLTVH-KVIHTG-------------EKPCKCEECGKAFKHFSALRK 589

Query: 275  VKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGGFTCNSCGLIFSEKKY 334
                   K      K +KC++C + F +  +L +HK  +H  K  + C  CG  F +  +
Sbjct: 590  ------HKVIHTREKLYKCEECGKAFNNSSILAKHK-IIHTGKKPYKCEECGKAFRQSSH 642

Query: 335  LRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSYKCSLCPRVFTHLAAL 394
            L  H   H+ +KP+ C  CGK F   + +  H+ +H  KK    YKC  C + F+H +AL
Sbjct: 643  LTRHKAIHTGEKPYKCEECGKAFSHFSALRRHKIIHTGKK---PYKCEECGKAFSHFSAL 699

Query: 395  EDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEIN 454
              H+ +HTG+K   C  C   F     L  H K++H               K C  +E  
Sbjct: 700  RRHKIIHTGEKPYKCEECGKAFKWSSKLTVH-KVIHTA------------EKPCKCEECG 746

Query: 455  KENEEGATIRKVKP-HEDSKEYM------ALN---------------KPFKCDDCDQRFL 492
            K  +  + +RK K  H   K Y       A N               KP+KC++C + F 
Sbjct: 747  KSFKHFSALRKHKVIHTREKLYKCEECVKAFNSFSALMKHKVIHTGEKPYKCEECGKAFK 806

Query: 493  TKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQD 552
                L  HK++H  +    C  CGK F H   LR+H +IH+  +P+ C  C K F +   
Sbjct: 807  WSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKIIHTGEKPYKCEECGKAFHQSSK 866

Query: 553  VAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATI 612
            +A H ++ H G+K      YKC  C KAF  L  L  H+ +HTG+K + C  C  ++   
Sbjct: 867  LAKHKKI-HTGEK-----PYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQS 920

Query: 613  GGLRSHIKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALN 672
              L +H K +H G K  +             +E  +   + +T+         K   A  
Sbjct: 921  ANLTTH-KRIHTGEKPYK------------CEECGRAFSQSSTL------TAHKIIHAGE 961

Query: 673  KPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF 712
            KP+KC++C + F     L  HK++H  + ++ C  CGK F
Sbjct: 962  KPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAF 1001




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=2 Back     alignment and function description
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description
>sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 Back     alignment and function description
>sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 Back     alignment and function description
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query712
358416962 1156 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.783 0.482 0.313 4e-72
440911185 1148 Zinc finger protein 91, partial [Bos gru 0.785 0.486 0.312 2e-71
348559643 1451 PREDICTED: zinc finger protein 729-like 0.824 0.404 0.310 2e-71
334332901 1041 PREDICTED: zinc finger protein 208-like 0.813 0.556 0.312 5e-71
301624183 4418 PREDICTED: LOW QUALITY PROTEIN: hypothet 0.785 0.126 0.317 5e-71
395750852 1120 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.796 0.506 0.309 8e-71
395529713 1555 PREDICTED: zinc finger protein 850-like 0.814 0.372 0.315 9e-71
187671941 1173 RecName: Full=Zinc finger protein 729 0.771 0.468 0.307 4e-70
358417000 1471 PREDICTED: zinc finger protein 836-like 0.807 0.390 0.323 8e-70
440891309 955 Zinc finger protein 845, partial [Bos gr 0.789 0.588 0.317 2e-69
>gi|358416962|ref|XP_003583526.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 729 [Bos taurus] Back     alignment and taxonomy information
 Score =  279 bits (713), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 207/660 (31%), Positives = 299/660 (45%), Gaps = 102/660 (15%)

Query: 95  NKPFKCDDCDQCFLTKILLNKHKLLHT-EGHLTCNLCGQTFRQKFRLLNHMISHSTEKPF 153
            KP+KCD+C + F  K +L  H+++HT E    C+ CG+ FR K  LL+H   H+ EKP+
Sbjct: 211 EKPYKCDECGKAFRVKSILLSHQIVHTGEKPYKCDECGKAFRVKLSLLSHQTVHTGEKPY 270

Query: 154 SCPICKKQFKRKHEVSKHDRIVHQGKK-----------------------YNVYKSYKCS 190
            C  C K F  K  + +H + +H G+K                       +   K YKC 
Sbjct: 271 KCDDCGKAFHAKSSLLRH-QTIHTGQKPYKCDEYAKVFRAKSKLLSHQTIHTGQKPYKCD 329

Query: 191 LCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQ-ESCQ 249
            C KAF   +AL  HQ +HTG+K + C+ C   F  K  LL H + +H G K  + + C 
Sbjct: 330 DCCKAFHAKSALLTHQTIHTGEKPYRCDDCGKAFRVKSMLLSH-QTIHTGQKPYKCDECG 388

Query: 250 SSHESK-------TCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLS 302
            +   K       T  + E   + E G + R+       +      KP+KCDDC + F +
Sbjct: 389 KAFRLKSSLLRHQTIHIREKPYKYECGKSFREKSKLLTHQTIHTGQKPYKCDDCGKAFHA 448

Query: 303 KILLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENG 362
           K  L  H + +H  +  + C+ CG  F  K  L  H   H+ +KP+ C  CGK F+ ++ 
Sbjct: 449 KSALLTH-QTIHTGQKPYKCDECGKAFRVKSILLGHQTVHTGEKPYKCDECGKAFRVKSI 507

Query: 363 VINHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGL 422
           +++HQ +H  +   K YKC  C + FTH + L  HQ +HTGQK   C +C  +F+    L
Sbjct: 508 LLSHQTVHTGE---KPYKCDECGKTFTHSSNLRRHQKIHTGQKLFKCDICDKVFSRSEQL 564

Query: 423 RSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPF 482
             H   VH G                                               KP+
Sbjct: 565 AGHQS-VHSG----------------------------------------------EKPY 577

Query: 483 KCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPV 542
           KCD+C + F  K +L +H+ +H  +  + C+ CGK F H   LRRH  IH+  + F C +
Sbjct: 578 KCDECGKAFRVKSILLRHQTVHTGEKPYKCDECGKAFTHSSNLRRHQKIHTGQKLFKCDI 637

Query: 543 CKKQFKRKQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLC 602
           C K F R + +AGH + VH G      K YKC  C KAF     L  HQ VHTG+K + C
Sbjct: 638 CDKVFSRSEHLAGH-QSVHSGA-----KPYKCDECDKAFRVKSILLIHQTVHTGEKPYKC 691

Query: 603 TMCPASYATIGGLRSHIKIVHHGLKT----------QQSCQSSHESKTCSVDEINKENEE 652
             C  ++     LR H KI H G K            +S Q +      S  +  K NE 
Sbjct: 692 EECGKAFTHSSNLRRHQKI-HTGQKLFKCDICDKVFNRSEQLAGHQSVHSGAKPYKCNEC 750

Query: 653 GATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF 712
           G    +       K      KP+KCD+C + F  K +L +H+ +H  +  + C+ CGK F
Sbjct: 751 GKHFGQPSQFISHKRLHTAEKPYKCDECGKAFRVKSILLRHQTVHTGEKPYKCDECGKAF 810




Source: Bos taurus

Species: Bos taurus

Genus: Bos

Family: Bovidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|440911185|gb|ELR60892.1| Zinc finger protein 91, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|348559643|ref|XP_003465625.1| PREDICTED: zinc finger protein 729-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|334332901|ref|XP_001375703.2| PREDICTED: zinc finger protein 208-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|301624183|ref|XP_002941407.1| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC100216012, partial [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|395750852|ref|XP_003780371.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 729-like [Pongo abelii] Back     alignment and taxonomy information
>gi|395529713|ref|XP_003766953.1| PREDICTED: zinc finger protein 850-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|187671941|sp|A6NN14.3|ZN729_HUMAN RecName: Full=Zinc finger protein 729 Back     alignment and taxonomy information
>gi|358417000|ref|XP_003583536.1| PREDICTED: zinc finger protein 836-like [Bos taurus] Back     alignment and taxonomy information
>gi|440891309|gb|ELR45080.1| Zinc finger protein 845, partial [Bos grunniens mutus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query712
UNIPROTKB|F1N5B8932 F1N5B8 "Uncharacterized protei 0.831 0.635 0.323 3.6e-82
UNIPROTKB|F1MJE71173 F1MJE7 "Uncharacterized protei 0.837 0.508 0.315 2.2e-81
UNIPROTKB|F1MQS9842 LOC100847180 "Uncharacterized 0.837 0.707 0.313 2.5e-81
UNIPROTKB|A8MXY41036 ZNF99 "Zinc finger protein 99" 0.800 0.550 0.309 6.6e-81
UNIPROTKB|O43345 1167 ZNF208 "Zinc finger protein 20 0.917 0.559 0.302 1e-80
UNIPROTKB|I3L1B3 1173 ZNF729 "Zinc finger protein 72 0.880 0.534 0.299 6.9e-80
UNIPROTKB|A6NN14 1173 ZNF729 "Zinc finger protein 72 0.889 0.539 0.297 3.3e-79
ZFIN|ZDB-GENE-071004-104 1011 zgc:173517 "zgc:173517" [Danio 0.821 0.578 0.315 1.1e-78
UNIPROTKB|F1MV65908 Bt.90142 "Uncharacterized prot 0.884 0.693 0.301 6.2e-78
UNIPROTKB|F1MVJ7903 F1MVJ7 "Uncharacterized protei 0.891 0.703 0.305 6.2e-78
UNIPROTKB|F1N5B8 F1N5B8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 824 (295.1 bits), Expect = 3.6e-82, P = 3.6e-82
 Identities = 211/653 (32%), Positives = 313/653 (47%)

Query:    96 KPFKCDDCDQCFLTKILLNKHKLLHT-EGHLTCNLCGQTFRQKFRLLNHMISHSTEKPFS 154
             KP+KCDDC + F  K  L +H+ +HT +    C+ CG+ FR K +LL H   H+ +KP+ 
Sbjct:   240 KPYKCDDCGKAFHAKSSLLRHQTIHTGQKPYKCDECGKVFRAKSKLLTHQTIHTGQKPYK 299

Query:   155 CPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLCPKAFTHLAALEDHQYVHTGQKS 214
             C  C K F  K  +  H  I H G+K      YKC  C KAF   + L  HQ +HTGQK 
Sbjct:   300 CDECGKAFHTKSALLTHQTI-HTGEK-----PYKCDECGKAFRVKSMLLSHQTIHTGQKP 353

Query:   215 HMCNLCSARFTCKGALLGH--IKVLHEGYK--------RPQESC---QSSHES-KTCSVD 260
             + C+ C   F  K +LL H  I      YK        R +      Q+SH   K    D
Sbjct:   354 YKCDECGKAFRVKSSLLRHQTIHTGERPYKCDECGKLFRAKSKLLTHQTSHTGQKPYKCD 413

Query:   261 EINKE-NEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQMHFNKGG 319
             +  K  + + A +     H  ++E     KP+KCD+C + F +K  L  H+  +H  +  
Sbjct:   414 DCGKAFHAKSALLTHQTIH--TRE-----KPYKCDECGRAFHAKSKLLTHQT-IHTGEKP 465

Query:   320 FTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLHQTKKVYKSY 379
             + C+ CG  F  K +L +H   H+ +KP+ C  CGK F   +    HQ++H  +K++K  
Sbjct:   466 YKCDECGKAFRLKSFLLSHQTVHTGEKPYKCDECGKAFADSSYFRKHQKIHTGQKLFK-- 523

Query:   380 KCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSC 439
              C +C +VF+  A L  HQ VH+G+K   C  C   F     L SH + VH G K  +  
Sbjct:   524 -CHICDKVFSRKAYLAGHQSVHSGEKPYKCDECGKAFLVKSILLSHQR-VHTGEKPYKCG 581

Query:   440 QSSHESKTCSVDEINKENEEGATIRKVKPHED---SKEYMALN-------KPFKCDDCDQ 489
             +        S    +++   G  + K    +      E++A +       KP+KCD+C +
Sbjct:   582 ECGKAFTDRSQLRRHQKIHTGQKLFKCDICDKVFIRSEHLAGHQRVHSGEKPYKCDECGK 641

Query:   490 RFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKR 549
              F  K +L  H+ +H  +  + C+ CGK F  +  LRRH  IH+  + F C +C K F+R
Sbjct:   642 AFRVKSILLIHQTVHTGEKPYKCDECGKAFTDRSHLRRHQKIHTGQKLFKCDICDKVFRR 701

Query:   550 KQDVAGHDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASY 609
              + +AGH  V H G+K      YKC  C KAF     L  HQ VHTG+K + C  C  ++
Sbjct:   702 SKQLAGHQSV-HSGEK-----PYKCDECGKAFRVKSTLLRHQTVHTGEKPYKCDECDKAF 755

Query:   610 ATIGGLRSHIKIVHHGLKTQQ--SCQSSHESK-------TCSVDEINKENEEGATIRKVK 660
                  L SH + VH G K  +   C  +   K       T    E   + +E   + +VK
Sbjct:   756 RVKSMLLSH-QTVHTGEKPYKCDECGKAFRVKPILLRHQTVHTGEKPYKCDECGKVFRVK 814

Query:   661 PHEDSKEYMALN-KPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTF 712
                 S + +    KP+KCD+C + F  K  L +H+ +H  +  + C+ CGK F
Sbjct:   815 SFLLSHQTIHTGQKPYKCDECGKAFRVKSSLLRHQTVHTGEKPYKCDECGKAF 867


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|F1MJE7 F1MJE7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQS9 LOC100847180 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A8MXY4 ZNF99 "Zinc finger protein 99" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43345 ZNF208 "Zinc finger protein 208" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L1B3 ZNF729 "Zinc finger protein 729" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6NN14 ZNF729 "Zinc finger protein 729" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-104 zgc:173517 "zgc:173517" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV65 Bt.90142 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVJ7 F1MVJ7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 712
KOG1074|consensus958 99.97
KOG1074|consensus958 99.97
KOG2462|consensus279 99.94
KOG3608|consensus467 99.94
KOG3608|consensus467 99.93
KOG2462|consensus279 99.93
KOG3623|consensus1007 99.9
KOG3623|consensus1007 99.89
KOG3576|consensus267 99.69
KOG3576|consensus267 99.66
PLN03086567 PRLI-interacting factor K; Provisional 99.17
PLN03086567 PRLI-interacting factor K; Provisional 99.11
PHA00733128 hypothetical protein 99.0
PHA00733128 hypothetical protein 98.91
PHA0276855 hypothetical protein; Provisional 98.88
KOG3993|consensus500 98.88
PHA0276855 hypothetical protein; Provisional 98.75
KOG3993|consensus500 98.74
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.66
KOG1146|consensus 1406 98.65
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.58
PHA0061644 hypothetical protein 98.44
PHA0061644 hypothetical protein 98.33
KOG1146|consensus1406 98.22
PHA0073279 hypothetical protein 98.11
PHA0073279 hypothetical protein 98.03
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.9
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.79
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.73
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.6
COG5189423 SFP1 Putative transcriptional repressor regulating 97.55
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.31
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.26
COG5189423 SFP1 Putative transcriptional repressor regulating 97.24
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.19
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.05
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.96
smart0035526 ZnF_C2H2 zinc finger. 96.81
KOG2231|consensus669 96.74
KOG2231|consensus669 96.56
smart0035526 ZnF_C2H2 zinc finger. 96.34
PRK04860160 hypothetical protein; Provisional 96.26
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.23
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.15
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.13
COG5236493 Uncharacterized conserved protein, contains RING Z 96.08
PRK04860160 hypothetical protein; Provisional 96.05
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.97
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.96
COG5048467 FOG: Zn-finger [General function prediction only] 95.91
KOG2785|consensus390 95.74
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.69
KOG2482|consensus423 95.53
COG5236493 Uncharacterized conserved protein, contains RING Z 95.18
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.07
COG5048467 FOG: Zn-finger [General function prediction only] 95.06
KOG2785|consensus390 94.7
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.67
KOG4173|consensus253 94.4
KOG2482|consensus423 92.68
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.93
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.54
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.17
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.89
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.11
KOG4173|consensus253 88.44
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 88.33
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.16
KOG2893|consensus341 87.92
KOG2893|consensus 341 86.09
COG404965 Uncharacterized protein containing archaeal-type C 85.56
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.54
PF1526954 zf-C2H2_7: Zinc-finger 80.85
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 80.2
>KOG1074|consensus Back     alignment and domain information
Probab=99.97  E-value=1.4e-32  Score=281.72  Aligned_cols=208  Identities=26%  Similarity=0.517  Sum_probs=157.2

Q ss_pred             CceecCCChhhccChHHHHHHHhhhcCCCcccCCCCccccCChHHHHhHHHHhhcCCCCccccCCCCCCCcccccccccc
Q psy16830        377 KSYKCSLCPRVFTHLAALEDHQFVHTGQKTRLCTMCPAIFASIGGLRSHMKIVHHGLKTQQSCQSSHESKTCSVDEINKE  456 (712)
Q Consensus       377 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~~~~  456 (712)
                      .|-+|-+|.++..-.+.|+.|.++|+|++||+|++|+++|+++.+|+.|+ .+|....+.                    
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~--------------------  662 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPA--------------------  662 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-cccccCccc--------------------
Confidence            45789999999999999999999999999999999999999999999999 556432221                    


Q ss_pred             ccccccccccCCCCCchhhhccCCCCCCc---chhhhhcchhhHhhccccccCCC-------------ccccCCCCcccC
Q psy16830        457 NEEGATIRKVKPHEDSKEYMALNKPFKCD---DCDQRFLTKILLNKHKLLHFDKD-------------YFSCNYCGKTFL  520 (712)
Q Consensus       457 ~~~~~~~~~~~~~~~~~~~~~~~~~~~C~---~C~~~f~~~~~L~~H~~~h~~~~-------------~~~C~~C~k~f~  520 (712)
                                            .-++.|+   +|.+.|.+...|..|+++|.+..             .-+|..|.+.|.
T Consensus       663 ----------------------R~q~ScP~~~ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~  720 (958)
T KOG1074|consen  663 ----------------------RVQFSCPSTFICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFS  720 (958)
T ss_pred             ----------------------cccccCCchhhhcccccccccccceEEeecCCCCCCCcccccccchhcccchhhhccc
Confidence                                  2457888   88888888888888888887321             146888888887


Q ss_pred             ChHHHhhhhhhcC----------------CCC----cccCcccccccCChhhHHhhhhhc--c-----------------
Q psy16830        521 HKYKLRRHIVIHS----------------TAR----PFSCPVCKKQFKRKQDVAGHDRVV--H-----------------  561 (712)
Q Consensus       521 ~~~~L~~H~~~H~----------------~~~----p~~C~~C~~~f~~~~~l~~H~~~~--h-----------------  561 (712)
                      ....+..++..|.                ++.    +..+..|+..+.....+..+--..  +                 
T Consensus       721 ~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~  800 (958)
T KOG1074|consen  721 DARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGE  800 (958)
T ss_pred             ccccchhhhhccCCcccCCcccccccccccccccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhh
Confidence            7777777765551                222    455666777666555544442211  0                 


Q ss_pred             ---cCcc------------------------------------------------------------------ccccCCc
Q psy16830        562 ---QGKK------------------------------------------------------------------LIVYKSY  572 (712)
Q Consensus       562 ---~~~~------------------------------------------------------------------~~~~~~~  572 (712)
                         ++++                                                                  ..++...
T Consensus       801 ~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h  880 (958)
T KOG1074|consen  801 EDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAH  880 (958)
T ss_pred             hcccCCCCcccccCCCcCCccccccCchhhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchh
Confidence               0000                                                                  0011226


Q ss_pred             ccCcCCcccCCchhHHhHHhhhcCCCcccCCCCccccCCchhhhhHHhhhccCCCC
Q psy16830        573 KCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKT  628 (712)
Q Consensus       573 ~C~~C~~~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~  628 (712)
                      .|.+||+.|...++|+.|+++|+|+|||.|.+|++.|.++.+|+.||.+ |....+
T Consensus       881 ~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgt-H~w~q~  935 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGT-HMWVQP  935 (958)
T ss_pred             hhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcc-ccccCC
Confidence            7999999999999999999999999999999999999999999999997 555443



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query712
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-21
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-12
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-09
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-10
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-07
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-05
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 6e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 6e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 6e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-06
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 5e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 100 bits (248), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 67/222 (30%), Positives = 94/222 (42%), Gaps = 52/222 (23%) Query: 185 KSYKCSLCPKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRP 244 K Y C C K+F+ L +HQ HTG+K + C C F+ K L H + H G Sbjct: 20 KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRT-HTG---- 74 Query: 245 QESCQSSHESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKI 304 KP+KC +C + F + Sbjct: 75 -------------------------------------------EKPYKCPECGKSFSQRA 91 Query: 305 LLNQHKKQMHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVI 364 L H++ H + + C CG FS+ +LR H +H+ +KP+ C CGK F RE+ + Sbjct: 92 NLRAHQR-THTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLH 150 Query: 365 NHQRLHQTKKVYKSYKCSLCPRVFTHLAALEDHQFVHTGQKT 406 HQR H +K YKC C + F+ AL HQ HTG+KT Sbjct: 151 THQRTHTGEKP---YKCPECGKSFSRRDALNVHQRTHTGKKT 189
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query712
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-24
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-09
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 9e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 9e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  104 bits (261), Expect = 1e-25
 Identities = 62/238 (26%), Positives = 91/238 (38%), Gaps = 55/238 (23%)

Query: 133 TFRQKFRLLNHMISHSTEKPFSCPICKKQFKRKHEVSKHDRIVHQGKKYNVYKSYKCSLC 192
           +       +        EKP++CP C K F R   +++H R  H G+     K YKC  C
Sbjct: 2   SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRT-HTGE-----KPYKCPEC 55

Query: 193 PKAFTHLAALEDHQYVHTGQKSHMCNLCSARFTCKGALLGHIKVLHEGYKRPQESCQSSH 252
            K+F+    L  HQ  HTG+K + C  C   F+ +  L  H +  H G K          
Sbjct: 56  GKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRT-HTGEK---------- 104

Query: 253 ESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCFQCFLSKILLNQHKKQ 312
                                                P+ C +C + F     L  H++ 
Sbjct: 105 -------------------------------------PYACPECGKSFSQLAHLRAHQR- 126

Query: 313 MHFNKGGFTCNSCGLIFSEKKYLRNHMISHSTQKPFSCSLCGKRFKRENGVINHQRLH 370
            H  +  + C  CG  FS +  L  H  +H+ +KP+ C  CGK F R + +  HQR H
Sbjct: 127 THTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query712
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.68
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.67
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.66
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.6
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.52
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.49
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.4
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.38
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.38
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.38
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.35
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.34
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.33
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.32
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.32
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.29
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.28
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.26
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.26
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.18
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.18
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.03
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.03
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.0
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.99
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.98
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.97
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.96
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.96
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.95
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.92
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.91
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.91
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.9
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.89
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.86
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.83
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.81
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.79
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.77
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.76
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.75
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.73
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.72
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.72
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.71
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.7
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.68
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.67
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.66
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.65
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.55
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.55
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.54
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.53
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.52
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.43
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.42
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.42
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.38
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.34
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.32
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.22
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.2
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.19
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.16
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.16
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.15
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.14
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.14
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.42
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.11
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.39
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.1
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.1
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.1
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.09
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.09
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.08
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.08
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.08
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.07
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.04
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.03
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.03
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.03
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.02
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.02
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.0
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.24
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.23
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.98
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.97
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.94
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.93
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.93
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.87
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.09
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.84
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.83
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.82
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.92
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.69
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.65
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.52
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.5
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.26
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.85
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.78
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.47
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.43
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.92
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.6
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.67
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.02
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.98
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.76
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.43
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 80.26
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.3e-35  Score=277.88  Aligned_cols=175  Identities=33%  Similarity=0.678  Sum_probs=143.8

Q ss_pred             hccCCCCCCcchhhhhcchhhHhhccccccCCCccccCCCCcccCChHHHhhhhhhcCCCCcccCcccccccCChhhHHh
Q psy16830        476 MALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIHSTARPFSCPVCKKQFKRKQDVAG  555 (712)
Q Consensus       476 ~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~p~~C~~C~~~f~~~~~l~~  555 (712)
                      ..++++|.|+.|++.|.+...|..|++.|.++++|.|++|++.|.+...|..|+++|.+++||.|++|++.|.+...|..
T Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~   95 (190)
T 2i13_A           16 EPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRA   95 (190)
T ss_dssp             ---------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHH
T ss_pred             cCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHH
Confidence            45578999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcccCccccccCCcccCcCCcccCCchhHHhHHhhhcCCCcccCCCCccccCCchhhhhHHhhhccCCCCCccccCC
Q psy16830        556 HDRVVHQGKKLIVYKSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKIVHHGLKTQQSCQSS  635 (712)
Q Consensus       556 H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~~c~~~  635 (712)
                      |++.++ ++     ++|.|++|++.|.+...|..|+++|++++||.|++|++.|.+...|..|+++ |.           
T Consensus        96 H~~~h~-~~-----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~-H~-----------  157 (190)
T 2i13_A           96 HQRTHT-GE-----KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRT-HT-----------  157 (190)
T ss_dssp             HHHHHH-TC-----CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHH-HH-----------
T ss_pred             HHHhcC-CC-----CCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHh-cC-----------
Confidence            999844 44     3899999999999999999999999999999999999999999999999987 42           


Q ss_pred             CCCCccchhhccccccccccccccCCCccccchhccCCCccCChhhhhhhChHHHHhHHhhhcCCCcc
Q psy16830        636 HESKTCSVDEINKENEEGATIRKVKPHEDSKEYMALNKPFKCDDCDQRFLTKILLNKHKLLHFDKDYF  703 (712)
Q Consensus       636 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~  703 (712)
                                                         +++||.|++||+.|.+...|..|+++|+|++||
T Consensus       158 -----------------------------------~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          158 -----------------------------------GEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             -----------------------------------CCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             -----------------------------------CCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence                                               357899999999999999999999999999986



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 712
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 8e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.003
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.5 bits (102), Expect = 1e-06
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 480 KPFKCDDCDQRFLTKILLNKHKLLHFDKDYFSCNYCGKTFLHKYKLRRHIVIH 532
           K + C  C + F  K   ++H  +H     + C  CGK F  K+ L  H+ IH
Sbjct: 2   KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query712
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.57
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.5
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.14
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.11
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.1
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.1
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.1
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.09
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.02
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.0
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.0
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.98
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.96
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.96
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.9
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.88
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.76
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.73
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.71
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.7
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.68
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.63
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.63
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.44
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.25
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.19
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.11
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.82
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.71
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.7
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.7
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.64
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.59
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.58
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.51
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.49
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.45
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.4
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.28
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.24
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.2
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.01
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.95
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.9
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.84
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.82
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.77
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.72
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.71
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.7
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.54
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.52
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.28
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.05
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.7
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.6
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.56
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.49
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.05
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.98
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.93
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.69
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.69
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.65
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.39
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.64
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.49
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.06
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.97
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.62
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.47
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.42
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.25
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.13
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.98
d1y0jb136 U-shaped transcription factor, different fingers { 89.69
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.69
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.39
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.99
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.53
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.29
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.67
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.21
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 85.85
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 85.42
d1y0jb136 U-shaped transcription factor, different fingers { 85.34
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 85.33
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.26
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.2
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 83.42
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 81.29
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 80.95
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.57  E-value=5.8e-16  Score=106.52  Aligned_cols=51  Identities=31%  Similarity=0.578  Sum_probs=48.8

Q ss_pred             CCcccCcCCcccCCchhHHhHHhhhcCCCcccCCCCccccCCchhhhhHHhh
Q psy16830        570 KSYKCSLCPKAFTYLGALEDHQFVHTGQKTHLCTMCPASYATIGGLRSHIKI  621 (712)
Q Consensus       570 ~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~~C~~C~~~f~~~~~L~~H~~~  621 (712)
                      |||+|. ||++|.....|..|+++|+|++||.|.+||++|.+.+.|..|+++
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            689995 999999999999999999999999999999999999999999976



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure