Psyllid ID: psy16862
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 303 | ||||||
| 242022774 | 350 | class A rhodopsin-like G-protein coupled | 0.709 | 0.614 | 0.633 | 1e-78 | |
| 270014322 | 398 | hypothetical protein TcasGA2_TC012598, p | 0.927 | 0.706 | 0.513 | 5e-77 | |
| 328705267 | 454 | PREDICTED: octopamine receptor beta-3R-l | 0.811 | 0.541 | 0.547 | 3e-76 | |
| 189241144 | 376 | PREDICTED: similar to Octopamine recepto | 0.679 | 0.547 | 0.666 | 9e-74 | |
| 157111761 | 384 | beta adrenergic receptor [Aedes aegypti] | 0.673 | 0.531 | 0.627 | 1e-70 | |
| 332025956 | 418 | Octopamine receptor beta-1R [Acromyrmex | 0.838 | 0.607 | 0.482 | 1e-70 | |
| 347968755 | 1230 | AGAP002888-PC [Anopheles gambiae str. PE | 0.782 | 0.192 | 0.583 | 2e-70 | |
| 383862143 | 428 | PREDICTED: octopamine receptor beta-1R-l | 0.838 | 0.593 | 0.490 | 4e-70 | |
| 195450841 | 1230 | GK13570 [Drosophila willistoni] gi|19416 | 0.739 | 0.182 | 0.586 | 5e-70 | |
| 350413453 | 427 | PREDICTED: octopamine receptor beta-1R-l | 0.838 | 0.594 | 0.490 | 6e-70 |
| >gi|242022774|ref|XP_002431813.1| class A rhodopsin-like G-protein coupled receptor GPRoar4, putative [Pediculus humanus corporis] gi|212517145|gb|EEB19075.1| class A rhodopsin-like G-protein coupled receptor GPRoar4, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 299 bits (765), Expect = 1e-78, Method: Compositional matrix adjust.
Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 9/224 (4%)
Query: 36 IHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVM 95
+ + P I+KG +M II+TA+LGN+LVIISVI+HRKLR+ITNY+VVSLA ADLLVALC M
Sbjct: 77 VPVVPAIVKGFIMGTIIVTAVLGNILVIISVIRHRKLRVITNYYVVSLAMADLLVALCAM 136
Query: 96 PFNAIVSLTDE-WYFGYFMCDVWNSFDVYFSTASILHLCCISVDRYYAIVKPLQYPIIMN 154
FNA V LT+ W FGYFMCDV+NS DVYFSTASILHLCCISVDRYYAIV+PLQYPI M
Sbjct: 137 TFNASVELTNGMWLFGYFMCDVYNSLDVYFSTASILHLCCISVDRYYAIVRPLQYPITMT 196
Query: 155 QNTVLLMLSNVWILPGIISFTPIMLGWYTTPDHKQYRKHHPNVCIFVVNVYYALISSSIS 214
TV ML+NVWILP +ISFTPI LGWYTT +H+++R+ +P VCIFVVN YYALISS +S
Sbjct: 197 HRTVTFMLANVWILPALISFTPIFLGWYTTEEHQEFRRTNPKVCIFVVNKYYALISSGVS 256
Query: 215 FWIPGFVM--------KKKKKRKKKKKKKKKKKRKKKKNQHHRD 250
FWIPG VM K+ +++K + +QH R
Sbjct: 257 FWIPGVVMIIMYYKIYKEAVRQRKALSRTSSNIVLNSIHQHRRQ 300
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270014322|gb|EFA10770.1| hypothetical protein TcasGA2_TC012598, partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328705267|ref|XP_001948521.2| PREDICTED: octopamine receptor beta-3R-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189241144|ref|XP_974238.2| PREDICTED: similar to Octopamine receptor beta-3R (DmOct-beta-3R) [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157111761|ref|XP_001651715.1| beta adrenergic receptor [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332025956|gb|EGI66112.1| Octopamine receptor beta-1R [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|347968755|ref|XP_003436282.1| AGAP002888-PC [Anopheles gambiae str. PEST] gi|333467858|gb|EGK96732.1| AGAP002888-PC [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|383862143|ref|XP_003706543.1| PREDICTED: octopamine receptor beta-1R-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195450841|ref|XP_002072656.1| GK13570 [Drosophila willistoni] gi|194168741|gb|EDW83642.1| GK13570 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|350413453|ref|XP_003489997.1| PREDICTED: octopamine receptor beta-1R-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 303 | ||||||
| FB|FBgn0038980 | 508 | oa2 "octopamine receptor 2" [D | 0.613 | 0.366 | 0.634 | 7.6e-64 | |
| FB|FBgn0250910 | 1256 | Octbeta3R "Octbeta3R" [Drosoph | 0.597 | 0.144 | 0.681 | 5.2e-63 | |
| FB|FBgn0038063 | 536 | Octbeta2R "Octbeta2R" [Drosoph | 0.600 | 0.339 | 0.642 | 2.1e-61 | |
| UNIPROTKB|F1LM90 | 398 | Htr4 "5-hydroxytryptamine rece | 0.607 | 0.462 | 0.487 | 2.9e-39 | |
| UNIPROTKB|F1LM98 | 379 | Htr4 "5-hydroxytryptamine rece | 0.607 | 0.485 | 0.487 | 2.9e-39 | |
| MGI|MGI:109246 | 388 | Htr4 "5 hydroxytryptamine (ser | 0.607 | 0.474 | 0.492 | 7.8e-39 | |
| UNIPROTKB|F1NJL4 | 371 | HTR4 "Uncharacterized protein" | 0.590 | 0.482 | 0.484 | 1.3e-38 | |
| UNIPROTKB|E2RK32 | 360 | HTR4 "Uncharacterized protein" | 0.607 | 0.511 | 0.487 | 2.1e-38 | |
| UNIPROTKB|C4WYH4 | 411 | HTR4 "5-hydroxytryptamine (Ser | 0.607 | 0.447 | 0.482 | 4.3e-38 | |
| UNIPROTKB|E5RK45 | 371 | HTR4 "5-hydroxytryptamine rece | 0.607 | 0.495 | 0.482 | 4.3e-38 |
| FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 651 (234.2 bits), Expect = 7.6e-64, P = 7.6e-64
Identities = 118/186 (63%), Positives = 148/186 (79%)
Query: 37 HIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMP 96
H+ +K ++ FII+ AILGN+LVI+SV++HRKLRIITNYFVVSLA AD+LVALC M
Sbjct: 103 HLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMT 162
Query: 97 FNAIVSLTDEWYFGYFMCDVWNSFDVYFSTASILHLCCISVDRYYAIVKPLQYPIIMNQN 156
FNA V ++ +W FG MCD+WNSFDVYFSTASI+HLCCISVDRYYAIV+PL YP+IM Q
Sbjct: 163 FNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQR 222
Query: 157 TVLLMLSNVWILPGIISFTPIMLGWYTTPDHKQYRKHHPNVCIFVVNVYYALISSSISFW 216
V +ML VW+ P ++SF PI GWYTT ++ +Y K +P++C F VN YA++SSS+SFW
Sbjct: 223 RVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFW 282
Query: 217 IPGFVM 222
IPG VM
Sbjct: 283 IPGIVM 288
|
|
| FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LM90 Htr4 "5-hydroxytryptamine receptor 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LM98 Htr4 "5-hydroxytryptamine receptor 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109246 Htr4 "5 hydroxytryptamine (serotonin) receptor 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJL4 HTR4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RK32 HTR4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C4WYH4 HTR4 "5-hydroxytryptamine (Serotonin) receptor 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RK45 HTR4 "5-hydroxytryptamine receptor 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 303 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 4e-42 | |
| PHA03087 | 335 | PHA03087, PHA03087, G protein-coupled chemokine re | 3e-14 | |
| PHA02638 | 417 | PHA02638, PHA02638, CC chemokine receptor-like pro | 1e-12 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-07 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 1e-07 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-07 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 5e-07 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 5e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-07 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 9e-07 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-06 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 1e-06 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 1e-06 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 2e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 4e-06 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 5e-06 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 6e-06 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 8e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| pfam10328 | 275 | pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR | 1e-05 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 3e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 3e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 4e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 5e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 5e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-05 | |
| PRK05244 | 177 | PRK05244, PRK05244, Der GTPase activator; Provisio | 8e-05 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 8e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| pfam10147 | 217 | pfam10147, CR6_interact, Growth arrest and DNA-dam | 1e-04 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 1e-04 | |
| pfam05890 | 270 | pfam05890, Ebp2, Eukaryotic rRNA processing protei | 1e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 2e-04 | |
| pfam10320 | 257 | pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-04 | |
| PRK05244 | 177 | PRK05244, PRK05244, Der GTPase activator; Provisio | 3e-04 | |
| pfam07741 | 95 | pfam07741, BRF1, Brf1-like TBP-binding domain | 3e-04 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 3e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 3e-04 | |
| cd12932 | 118 | cd12932, RRP7_like, RRP7 domain ribosomal RNA-proc | 3e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 4e-04 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 5e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 5e-04 | |
| pfam10147 | 217 | pfam10147, CR6_interact, Growth arrest and DNA-dam | 5e-04 | |
| PHA02834 | 323 | PHA02834, PHA02834, chemokine receptor-like protei | 5e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 5e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-04 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 7e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.001 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.001 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 0.001 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.001 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.001 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.001 | |
| pfam12923 | 131 | pfam12923, RRP7, Ribosomal RNA-processing protein | 0.001 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.001 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.001 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 0.002 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.003 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.003 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.003 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.003 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 0.003 | |
| pfam09494 | 627 | pfam09494, Slx4, Slx4 endonuclease | 0.003 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.003 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.003 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 0.003 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.004 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.004 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.004 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.004 | |
| pfam07780 | 212 | pfam07780, Spb1_C, Spb1 C-terminal domain | 0.004 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 0.004 | |
| pfam04086 | 272 | pfam04086, SRP-alpha_N, Signal recognition particl | 0.004 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 145 bits (368), Expect = 4e-42
Identities = 53/190 (27%), Positives = 91/190 (47%), Gaps = 11/190 (5%)
Query: 66 VIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFS 125
+++ +KLR TN F+++LA ADLL L + P+ + +W FG +C + V
Sbjct: 3 ILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNG 62
Query: 126 TASILHLCCISVDRYYAIVKPLQYPIIMNQNTVLLMLSNVWILPGIISFTPIMLGWYTTP 185
ASIL L IS+DRY AIV PL+Y I +++ VW+L ++S P++ W T
Sbjct: 63 YASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTV 122
Query: 186 DHKQYRKHHPNVCIFVVNVYYALISSSISFWIPGFVM-----------KKKKKRKKKKKK 234
+ + Y L+S+ + F +P V+ +K+ + + +
Sbjct: 123 EEGNVTTCLIDFPEESTKRSYTLLSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQAR 182
Query: 235 KKKKKRKKKK 244
K+ K++K
Sbjct: 183 AKRSSSKERK 192
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
| >gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220695 pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR chemoreceptor Srx | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|235370 PRK05244, PRK05244, Der GTPase activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220600 pfam10147, CR6_interact, Growth arrest and DNA-damage-inducible proteins-interacting protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218797 pfam05890, Ebp2, Eukaryotic rRNA processing protein EBP2 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|192535 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR chemoreceptor Srsx | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|235370 PRK05244, PRK05244, Der GTPase activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|240576 cd12932, RRP7_like, RRP7 domain ribosomal RNA-processing protein 7 (Rrp7p), ribosomal RNA-processing protein 7 homolog A (Rrp7A), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220600 pfam10147, CR6_interact, Growth arrest and DNA-damage-inducible proteins-interacting protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|165177 PHA02834, PHA02834, chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221857 pfam12923, RRP7, Ribosomal RNA-processing protein 7 (RRP7) | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220267 pfam09494, Slx4, Slx4 endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219572 pfam07780, Spb1_C, Spb1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| KOG4220|consensus | 503 | 99.97 | ||
| KOG4219|consensus | 423 | 99.97 | ||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.95 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 99.95 | |
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 99.95 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 99.95 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 99.95 | |
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 99.93 | |
| KOG2087|consensus | 363 | 99.74 | ||
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 99.63 | |
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 99.63 | |
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 99.47 | |
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 99.31 | |
| PF11710 | 201 | Git3: G protein-coupled glucose receptor regulatin | 99.3 | |
| PF10323 | 283 | 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept | 99.21 | |
| PF05462 | 303 | Dicty_CAR: Slime mold cyclic AMP receptor | 99.12 | |
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 98.76 | |
| PF03402 | 265 | V1R: Vomeronasal organ pheromone receptor family, | 98.43 | |
| PF10317 | 292 | 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept | 98.43 | |
| PF10316 | 273 | 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep | 98.39 | |
| PF10292 | 324 | 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c | 98.31 | |
| PF00002 | 242 | 7tm_2: 7 transmembrane receptor (Secretin family); | 98.22 | |
| PF02118 | 275 | Srg: Srg family chemoreceptor; InterPro: IPR000609 | 98.03 | |
| PF02117 | 328 | 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemorecept | 98.03 | |
| PF04789 | 305 | DUF621: Protein of unknown function (DUF621); Inte | 97.76 | |
| PF10327 | 303 | 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept | 97.66 | |
| PF10326 | 307 | 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept | 97.65 | |
| KOG4193|consensus | 610 | 97.57 | ||
| PF02101 | 405 | Ocular_alb: Ocular albinism type 1 protein; InterP | 97.32 | |
| PF10318 | 302 | 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept | 96.64 | |
| KOG4564|consensus | 473 | 96.61 | ||
| PF03383 | 153 | Serpentine_r_xa: Caenorhabditis serpentine recepto | 96.59 | |
| PF01534 | 328 | Frizzled: Frizzled/Smoothened family membrane regi | 96.42 | |
| PF10319 | 310 | 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept | 96.4 | |
| PF06681 | 226 | DUF1182: Protein of unknown function (DUF1182); In | 96.32 | |
| PF03125 | 365 | Sre: C. elegans Sre G protein-coupled chemorecepto | 95.89 | |
| PF02175 | 236 | 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemorecept | 95.87 | |
| PF10322 | 307 | 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemorecept | 95.84 | |
| PF02076 | 283 | STE3: Pheromone A receptor; InterPro: IPR001499 G- | 95.28 | |
| PF10669 | 121 | Phage_Gp23: Protein gp23 (Bacteriophage A118); Int | 91.77 | |
| PF15086 | 74 | UPF0542: Uncharacterised protein family UPF0542 | 91.74 | |
| KOG2302|consensus | 1956 | 89.26 | ||
| PF10669 | 121 | Phage_Gp23: Protein gp23 (Bacteriophage A118); Int | 87.94 | |
| KOG4349|consensus | 143 | 87.75 | ||
| PRK00247 | 429 | putative inner membrane protein translocase compon | 81.02 |
| >KOG4220|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=7.9e-33 Score=233.99 Aligned_cols=203 Identities=27% Similarity=0.486 Sum_probs=177.4
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccchhHHHHHHHHHhHHHHhhhhhHHHHHHhccccccccccchhchHH
Q psy16862 41 FIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSF 120 (303)
Q Consensus 41 ~~~~~~~~~~i~i~gl~~N~~vl~~i~~~~~~~~~~~~ll~~Lai~Dl~~~l~~~~~~~~~~~~~~~~~~~~~C~~~~~~ 120 (303)
-++++++...++++.++||++|++.+.-++++++..|+||++||+||++++++.+|.+..+.+-+.|++|..+|.++..+
T Consensus 30 ~v~i~~v~~~lsLVTv~GNlLVmiSfKvnrqLqTVnNYfLfSLAcADliIG~~SMnl~t~Y~lmg~W~LG~~~CdlWLal 109 (503)
T KOG4220|consen 30 VVFIVVVTGSLSLVTVVGNLLVMISFKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTTYTLMGYWPLGPLVCDLWLAL 109 (503)
T ss_pred EEeeehhhhHHHHHhhhccEEEEEEEEecceeeeecceeehHHHHhhhhhheeechHHHHHHHHcccccchHHHHHHHHH
Confidence 45677888899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhHHHHHHHHhhhhhhhhccccccccccCCCcccccCCCceEE-
Q psy16862 121 DVYFSTASILHLCCISVDRYYAIVKPLQYPIIMNQNTVLLMLSNVWILPGIISFTPIMLGWYTTPDHKQYRKHHPNVCI- 199 (303)
Q Consensus 121 ~~~~~~~s~~~l~~iaidRy~aI~~P~~~~~~~t~~~~~~~i~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~- 199 (303)
.++...+|++.+++|++|||..|.+|+.|+...|.+++..+|++.|++++++..|. +..|....+.. ....+.|.
T Consensus 110 DYvaSNASVmNLLiISFDRYFsVTrPLtYrakRTtkrA~~MI~~AW~iSfiLWaPa-Il~WqyivGkr---Tv~~~eC~i 185 (503)
T KOG4220|consen 110 DYVASNASVMNLLIISFDRYFSVTRPLTYRAKRTTKRAGLMIGAAWVLSFVLWAPA-ILFWQYIVGKR---TVPDGECYI 185 (503)
T ss_pred HHHhhhhhhhhhheeeeecceeecccccccccccchHHHHHHHHHHHHHHHHHHHH-HHhhHhheeee---ecCCCceEE
Confidence 99999999999999999999999999999999999999999999999999998666 45553333322 22345664
Q ss_pred -EEehhhHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhhccc
Q psy16862 200 -FVVNVYYALISSSISFWIPGFVMKKKKKRKKKKKKKKKKKRKKKKNQH 247 (303)
Q Consensus 200 -~~~~~~~~~~~~~~~~~ip~~i~~~~y~~I~~~l~~~~~~~~~~~~~~ 247 (303)
+.......+-..+..|.+|..+|+++|.+|++..+++.+.....+...
T Consensus 186 QFlsnp~iTfGTAiAAFYlPVtiM~~LY~rIyret~kR~k~~~~lq~s~ 234 (503)
T KOG4220|consen 186 QFLSNPAITFGTAIAAFYLPVTIMTILYWRIYRETRKRQKELAKLQASL 234 (503)
T ss_pred EeecCceeehhHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhhhhccccc
Confidence 334455556666788999999999999999999999999888776654
|
|
| >KOG4219|consensus | Back alignment and domain information |
|---|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
| >PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor | Back alignment and domain information |
|---|
| >PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05462 Dicty_CAR: Slime mold cyclic AMP receptor | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
| >PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF02117 7TM_GPCR_Sra: Serpentine type 7TM GPCR chemoreceptor Sra; InterPro: IPR000344 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF04789 DUF621: Protein of unknown function (DUF621); InterPro: IPR006874 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans, and is noted to have possible G-protein-coupled receptor-like activity | Back alignment and domain information |
|---|
| >PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG4193|consensus | Back alignment and domain information |
|---|
| >PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes | Back alignment and domain information |
|---|
| >PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG4564|consensus | Back alignment and domain information |
|---|
| >PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF01534 Frizzled: Frizzled/Smoothened family membrane region; InterPro: IPR000539 The frizzled (fz) locus of Drosophila coordinates the cytoskeletons of epidermal cells, producing a parallel array of cuticular hairs and bristles [, ] | Back alignment and domain information |
|---|
| >PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF06681 DUF1182: Protein of unknown function (DUF1182); InterPro: IPR010601 This family consists of several hypothetical proteins of around 360 residues in length and seems to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PF03125 Sre: C | Back alignment and domain information |
|---|
| >PF02175 7TM_GPCR_Srb: Serpentine type 7TM GPCR chemoreceptor Srb; InterPro: IPR002184 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10322 7TM_GPCR_Sru: Serpentine type 7TM GPCR chemoreceptor Sru; InterPro: IPR003839 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF02076 STE3: Pheromone A receptor; InterPro: IPR001499 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10669 Phage_Gp23: Protein gp23 (Bacteriophage A118); InterPro: IPR018926 This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli | Back alignment and domain information |
|---|
| >PF15086 UPF0542: Uncharacterised protein family UPF0542 | Back alignment and domain information |
|---|
| >KOG2302|consensus | Back alignment and domain information |
|---|
| >PF10669 Phage_Gp23: Protein gp23 (Bacteriophage A118); InterPro: IPR018926 This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli | Back alignment and domain information |
|---|
| >KOG4349|consensus | Back alignment and domain information |
|---|
| >PRK00247 putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 303 | ||||
| 3sn6_R | 514 | Crystal Structure Of The Beta2 Adrenergic Receptor- | 7e-36 | ||
| 4gbr_A | 309 | N-terminal T4 Lysozyme Fusion Facilitates Crystalli | 1e-35 | ||
| 3pds_A | 458 | Irreversible Agonist-Beta2 Adrenoceptor Complex Len | 2e-35 | ||
| 2y00_B | 315 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 7e-35 | ||
| 2vt4_A | 313 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 7e-35 | ||
| 2rh1_A | 500 | High Resolution Crystal Structure Of Human B2-Adren | 8e-35 | ||
| 3p0g_A | 501 | Structure Of A Nanobody-Stabilized Active State Of | 9e-35 | ||
| 2r4s_A | 342 | Crystal Structure Of The Human Beta2 Adrenoceptor L | 9e-35 | ||
| 3kj6_A | 366 | Crystal Structure Of A Methylated Beta2 Adrenergic | 9e-35 | ||
| 2r4r_A | 365 | Crystal Structure Of The Human Beta2 Adrenoceptor L | 1e-34 | ||
| 3d4s_A | 490 | Cholesterol Bound Form Of Human Beta2 Adrenergic Re | 1e-34 | ||
| 3pbl_A | 481 | Structure Of The Human Dopamine D3 Receptor In Comp | 4e-26 | ||
| 3uon_A | 467 | Structure Of The Human M2 Muscarinic Acetylcholine | 2e-18 | ||
| 4daj_A | 479 | Structure Of The M3 Muscarinic Acetylcholine Recept | 1e-17 | ||
| 3rze_A | 452 | Structure Of The Human Histamine H1 Receptor In Com | 1e-16 | ||
| 3pwh_A | 329 | Thermostabilised Adenosine A2a Receptor Length = 32 | 5e-15 | ||
| 3vg9_A | 326 | Crystal Structure Of Human Adenosine A2a Receptor W | 3e-14 | ||
| 2ydo_A | 325 | Thermostabilised Human A2a Receptor With Adenosine | 4e-14 | ||
| 2ks9_A | 364 | Solution Conformation Of Substance P In Water Compl | 5e-14 | ||
| 3eml_A | 488 | The 2.6 A Crystal Structure Of A Human A2a Adenosin | 7e-14 | ||
| 4eiy_A | 447 | Crystal Structure Of The Chimeric Protein Of A2aar- | 9e-14 | ||
| 4djh_A | 480 | Structure Of The Human Kappa Opioid Receptor In Com | 9e-13 | ||
| 4ej4_A | 461 | Structure Of The Delta Opioid Receptor Bound To Nal | 1e-12 | ||
| 4dkl_A | 464 | Crystal Structure Of The Mu-Opioid Receptor Bound T | 3e-12 | ||
| 4ea3_B | 434 | Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI | 1e-11 | ||
| 2ziy_A | 372 | Crystal Structure Of Squid Rhodopsin Length = 372 | 2e-08 | ||
| 2z73_A | 448 | Crystal Structure Of Squid Rhodopsin Length = 448 | 2e-08 | ||
| 3oe0_A | 499 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 1e-07 | ||
| 3odu_A | 502 | The 2.5 A Structure Of The Cxcr4 Chemokine Receptor | 1e-07 | ||
| 3oe6_A | 508 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 1e-07 | ||
| 3oax_A | 349 | Crystal Structure Of Bovine Rhodopsin With Beta-Ion | 6e-07 | ||
| 1jfp_A | 348 | Structure Of Bovine Rhodopsin (Dark Adapted) Length | 6e-07 | ||
| 2x72_A | 349 | Crystal Structure Of The Constitutively Active E113 | 7e-07 | ||
| 4a4m_A | 349 | Crystal Structure Of The Light-Activated Constituti | 7e-07 | ||
| 2j4y_A | 349 | Crystal Structure Of A Rhodopsin Stabilizing Mutant | 8e-07 | ||
| 3c9m_A | 348 | Structure Of A Mutant Bovine Rhodopsin In Hexagonal | 8e-07 |
| >pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 | Back alignment and structure |
|
| >pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 | Back alignment and structure |
| >pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 | Back alignment and structure |
| >pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 | Back alignment and structure |
| >pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 | Back alignment and structure |
| >pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 | Back alignment and structure |
| >pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 | Back alignment and structure |
| >pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 | Back alignment and structure |
| >pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 | Back alignment and structure |
| >pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 | Back alignment and structure |
| >pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 | Back alignment and structure |
| >pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 | Back alignment and structure |
| >pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 | Back alignment and structure |
| >pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 | Back alignment and structure |
| >pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 | Back alignment and structure |
| >pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 | Back alignment and structure |
| >pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 | Back alignment and structure |
| >pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 | Back alignment and structure |
| >pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 | Back alignment and structure |
| >pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 | Back alignment and structure |
| >pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 | Back alignment and structure |
| >pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 | Back alignment and structure |
| >pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 | Back alignment and structure |
| >pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 | Back alignment and structure |
| >pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 | Back alignment and structure |
| >pdb|2ZIY|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 372 | Back alignment and structure |
| >pdb|2Z73|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 448 | Back alignment and structure |
| >pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 | Back alignment and structure |
| >pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 | Back alignment and structure |
| >pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 | Back alignment and structure |
| >pdb|3OAX|A Chain A, Crystal Structure Of Bovine Rhodopsin With Beta-Ionone Length = 349 | Back alignment and structure |
| >pdb|1JFP|A Chain A, Structure Of Bovine Rhodopsin (Dark Adapted) Length = 348 | Back alignment and structure |
| >pdb|2X72|A Chain A, Crystal Structure Of The Constitutively Active E113q,N2c, D282c Rhodopsin Mutant With Bound Galphact Peptide Length = 349 | Back alignment and structure |
| >pdb|4A4M|A Chain A, Crystal Structure Of The Light-Activated Constitutively Active N2c,M257y,D282c Rhodopsin Mutant In Complex With A Peptide Resembling The C-Terminus Of The Galpha-Protein Subunit (Gact) Length = 349 | Back alignment and structure |
| >pdb|2J4Y|A Chain A, Crystal Structure Of A Rhodopsin Stabilizing Mutant Expressed In Mammalian Cells Length = 349 | Back alignment and structure |
| >pdb|3C9M|A Chain A, Structure Of A Mutant Bovine Rhodopsin In Hexagonal Crystal Form Length = 348 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 100.0 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.98 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.98 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.97 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.97 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 99.97 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.97 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.97 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 99.97 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.97 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 99.97 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.97 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.97 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 99.97 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 99.97 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.97 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 99.96 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.95 | |
| 1hll_A | 32 | Alpha-2A adrenergic receptor; helix-linker-helix, | 98.53 | |
| 2lot_A | 64 | Apelin receptor; membrane protein; NMR {Homo sapie | 95.72 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 87.33 | |
| 2rdd_B | 37 | UPF0092 membrane protein YAJC; drug resistance, mu | 81.34 |
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-34 Score=267.38 Aligned_cols=205 Identities=18% Similarity=0.308 Sum_probs=165.3
Q ss_pred ccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc---cchhHHHHHHHHHhHHHHhhhhhHHHHHHhc--ccccc
Q psy16862 35 HIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLR---IITNYFVVSLAFADLLVALCVMPFNAIVSLT--DEWYF 109 (303)
Q Consensus 35 ~~~~~~~~~~~~~~~~i~i~gl~~N~~vl~~i~~~~~~~---~~~~~ll~~Lai~Dl~~~l~~~~~~~~~~~~--~~~~~ 109 (303)
.......++..+++++++++|++||+++++++.+++++| +++|+|++|||++|++.+++.+|+.+..... +.|.+
T Consensus 26 ~~~~~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~ 105 (510)
T 4grv_A 26 NTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAF 105 (510)
T ss_dssp CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSS
T ss_pred ChhHHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEh
Confidence 344556788889999999999999999999999876544 7889999999999999999999988876654 56999
Q ss_pred ccccchhchHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhHHHHHHHHhhhhhhhhccccccccccCCCcc
Q psy16862 110 GYFMCDVWNSFDVYFSTASILHLCCISVDRYYAIVKPLQYPIIMNQNTVLLMLSNVWILPGIISFTPIMLGWYTTPDHKQ 189 (303)
Q Consensus 110 ~~~~C~~~~~~~~~~~~~s~~~l~~iaidRy~aI~~P~~~~~~~t~~~~~~~i~~~w~~~~~~~~~~~~~~~~~~~~~~~ 189 (303)
|+.+|++..++..++..+|++++++||+|||+||++|++|+...+++++..+++++|++++++++|+++.... ......
T Consensus 106 g~~~C~~~~~~~~~~~~~S~~~l~~is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~-~~~~~~ 184 (510)
T 4grv_A 106 GDAGCRGYYFLRDACTYATALNVASLSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGL-QNRSAD 184 (510)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHHHEEE-EECSSS
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHHhhcc-cccccC
Confidence 9999999999999999999999999999999999999999999999999999999999999999988543221 111111
Q ss_pred cccCCCceEEEE----ehhhHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHh
Q psy16862 190 YRKHHPNVCIFV----VNVYYALISSSISFWIPGFVMKKKKKRKKKKKKKKKKKR 240 (303)
Q Consensus 190 ~~~~~~~~c~~~----~~~~~~~~~~~~~~~ip~~i~~~~y~~I~~~l~~~~~~~ 240 (303)
........|... ....|..+..++.+++|+++|+++|.+|++.++++.+..
T Consensus 185 ~~~~~~~~c~~~~~~~~~~~~~~~~~~~~f~iP~~ii~~~Y~~I~~~l~~~~~~~ 239 (510)
T 4grv_A 185 GTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVNIF 239 (510)
T ss_dssp SCCGGGEEEEECSCHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHTSCTHH
T ss_pred CCCCCccccccccccchhhhhhhhhhhHHHhhhHHHHHHHHHHHHHHHHHHhhhh
Confidence 111222345432 234566677778899999999999999999998765543
|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A | Back alignment and structure |
|---|
| >2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >2rdd_B UPF0092 membrane protein YAJC; drug resistance, multidrug efflux, transporter, antiporter, novel transmembrane helix, ACRB, inner membrane; HET: AIC; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 303 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 5e-22 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 1e-04 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 6e-04 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 92.3 bits (228), Expect = 5e-22
Identities = 40/246 (16%), Positives = 84/246 (34%), Gaps = 3/246 (1%)
Query: 14 NINYTSTNFSNTSLFPTNSTIHIHIFP--FIIKGMLMCFIIITAILGNLLVIISVIKHRK 71
N +N + P + + P F + M +I+ N L + ++H+K
Sbjct: 8 NFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKK 67
Query: 72 LRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSTASILH 131
LR NY +++LA ADL + SL + FG C++ F ++
Sbjct: 68 LRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWS 127
Query: 132 LCCISVDRYYAIVKPLQYPIIMNQNTV-LLMLSNVWILPGIISFTPIMLGWYTTPDHKQY 190
L ++++RY + KP+ + + + + V L +
Sbjct: 128 LVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSC 187
Query: 191 RKHHPNVCIFVVNVYYALISSSISFWIPGFVMKKKKKRKKKKKKKKKKKRKKKKNQHHRD 250
+ N + + + F IP V+ + K+ ++++ +
Sbjct: 188 GIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAE 247
Query: 251 VWINRT 256
+ R
Sbjct: 248 KEVTRM 253
|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.93 | |
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 83.83 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.93 E-value=1e-25 Score=195.34 Aligned_cols=200 Identities=18% Similarity=0.231 Sum_probs=158.0
Q ss_pred cchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccchhHHHHHHHHHhHHHHhhhhhHHHHHHhccccccccccch
Q psy16862 36 IHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCD 115 (303)
Q Consensus 36 ~~~~~~~~~~~~~~~i~i~gl~~N~~vl~~i~~~~~~~~~~~~ll~~Lai~Dl~~~l~~~~~~~~~~~~~~~~~~~~~C~ 115 (303)
.+.....+.+.++.+++++|++||+++++++.+++++|++.+++++|||++|++.++..+|..+.....+.|..+...|.
T Consensus 32 ~~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~ 111 (348)
T d1u19a_ 32 AEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCN 111 (348)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHH
T ss_pred ccHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhh
Confidence 33444678888999999999999999999999999999999999999999999999988998888888888889999999
Q ss_pred hchHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhHHHHHHHHhhhhhhhhccccccccc-cCCCcccccCC
Q psy16862 116 VWNSFDVYFSTASILHLCCISVDRYYAIVKPLQYPIIMNQNTVLLMLSNVWILPGIISFTPIMLGWYT-TPDHKQYRKHH 194 (303)
Q Consensus 116 ~~~~~~~~~~~~s~~~l~~iaidRy~aI~~P~~~~~~~t~~~~~~~i~~~w~~~~~~~~~~~~~~~~~-~~~~~~~~~~~ 194 (303)
...++...+..++.++++++++|||++|++|++|... .+++....++++|.+++++..++.+..... .......|...
T Consensus 112 ~~~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 190 (348)
T d1u19a_ 112 LEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRF-GENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGID 190 (348)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCC-CHHHHHHHHHHHHHHHHHHHSGGGTTSSCCEEETTTTEEECC
T ss_pred hhhhccccceeeecchhhhhhcccceeeecccccccc-ccccccccceeeehhhhheecccccccceeccCCcccccccc
Confidence 9999999999999999999999999999999998765 666777788888888888888775432211 11111111111
Q ss_pred CceE-EEEehhhHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHH
Q psy16862 195 PNVC-IFVVNVYYALISSSISFWIPGFVMKKKKKRKKKKKKKK 236 (303)
Q Consensus 195 ~~~c-~~~~~~~~~~~~~~~~~~ip~~i~~~~y~~I~~~l~~~ 236 (303)
.... .......+.+....+.+++|+++++++|.+|.+.++++
T Consensus 191 ~~~~~~~~~~~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~ 233 (348)
T d1u19a_ 191 YYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEA 233 (348)
T ss_dssp CSCCCGGGTHHHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSC
T ss_pred cccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence 1110 11233556667777788999999999999998766543
|
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|