Psyllid ID: psy16938


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---
MSFGSVVDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKKHTQVSSTKKKN
cccccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEccccccccccccccEEEccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEcccccHHHHHHHHHHHHccccEEEEEEEcccccccccccccccEEEEccccccccccccccEEEEEccccHHHHHHHHccccEEcccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHEEHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEEccccccccccccEEEEEcccccccccHHHHHHHcccccccccccccccccccccccHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccccEEEEEcccEccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEEccccccccccccEEEEEccccccHHHHHHccccEEcccccccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
msfgsvvdptklseetKLGFLEVFKQLklpifwkiditndpvlnaktlpdnvfiqkwypqtdilahpnlrlfithggisslmnwnrygtggalpnlctmnHFSFIILLSFsflgtlscdkilvflplpiwshqMQYEKVWTALAErghevtiytkftpksnstnlkhvpirlpkidarmidptklseeTKLGFLEVFKQLklpifwkiditndpvlnaktlpdnvfiqkwypqtdilahpnlrlfITHGGisslmeasslgvpvlgvpffgdqyRNMVLLRHRGYaliepiqtlTKQSFLKNAQTmlndpsfkQNAKKWASIAndeivspleRVVYWTEYVLRhkgaphlsassRQLTWYQMYCIDIILVILGILYAVVKLLSMcccrsskkhtqvsstkkkn
msfgsvvdptklseetklGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIytkftpksnstnlkhvpirlpkidarmidPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCcrsskkhtqvsstkkkn
MSFGSVVDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHfsfiillsfsflgtlsCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKKHTQVSSTKKKN
***************TKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCR***************
MSFGSV*DPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTN***************IDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCR*SK************
MSFGSVVDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCR***************
********PTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKKHTQV*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFGSVVDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYGTGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGHEVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKKHTQVSSTKKKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query403 2.2.26 [Sep-21-2011]
O77649530 UDP-glucuronosyltransfera N/A N/A 0.493 0.375 0.362 5e-39
P36512531 UDP-glucuronosyltransfera yes N/A 0.531 0.403 0.354 2e-38
P36514502 UDP-glucuronosyltransfera no N/A 0.439 0.352 0.380 2e-38
Q5RFJ3527 UDP-glucuronosyltransfera yes N/A 0.456 0.349 0.385 2e-38
O75795530 UDP-glucuronosyltransfera yes N/A 0.493 0.375 0.348 4e-38
Q6K1J1530 UDP-glucuronosyltransfera no N/A 0.521 0.396 0.348 6e-38
Q6UWM9527 UDP-glucuronosyltransfera no N/A 0.456 0.349 0.385 7e-38
P16662529 UDP-glucuronosyltransfera no N/A 0.493 0.376 0.362 1e-37
Q9XT55528 UDP-glucuronosyltransfera N/A N/A 0.491 0.375 0.369 4e-37
P54855530 UDP-glucuronosyltransfera no N/A 0.493 0.375 0.343 6e-37
>sp|O77649|UDB20_MACFA UDP-glucuronosyltransferase 2B20 OS=Macaca fascicularis GN=UGT2B20 PE=1 SV=1 Back     alignment and function desciption
 Score =  162 bits (410), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 122/204 (59%), Gaps = 5/204 (2%)

Query: 183 TKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNL 242
           + +SEE          Q+   + WK D          TL  N  + KW PQ D+L HP  
Sbjct: 315 SNMSEERANMIASALAQIPQKVLWKFDGKK-----PNTLGSNTRLYKWLPQNDLLGHPKT 369

Query: 243 RLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKN 302
           + FITHGG + + EA   G+P++G+P F DQ+ N+V ++ +G AL   I+T++ +  L  
Sbjct: 370 KAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIVHMKVKGAALSVDIRTMSSRDLLNA 429

Query: 303 AQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQM 362
            ++++N+P +K+NA K + I +D+ + PL+R V+W E+V+RHKGA HL  ++  LTW Q 
Sbjct: 430 LKSVINEPIYKENAMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQY 489

Query: 363 YCIDIILVILGILYAVVKLLSMCC 386
           + +D+I  +L  + AV+ +++ CC
Sbjct: 490 HSLDVIAFLLACVAAVIFIITKCC 513




UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme has glucuronidating capacity with androgens, such as testosterone, dihydrotestosterone (DHT) and 3-alpha-diol. It is also active on catecholoestrogens including 1,3,5,10-oestratriene-3,4-diol-17-one.
Macaca fascicularis (taxid: 9541)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|P36512|UDB13_RABIT UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus GN=UGT2B13 PE=2 SV=1 Back     alignment and function description
>sp|P36514|UD2C1_RABIT UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus GN=UGT2C1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFJ3|UD2A3_PONAB UDP-glucuronosyltransferase 2A3 OS=Pongo abelii GN=UGT2A3 PE=2 SV=1 Back     alignment and function description
>sp|O75795|UDB17_HUMAN UDP-glucuronosyltransferase 2B17 OS=Homo sapiens GN=UGT2B17 PE=2 SV=1 Back     alignment and function description
>sp|Q6K1J1|UDB31_CANFA UDP-glucuronosyltransferase 2B31 OS=Canis familiaris GN=UGT2B31 PE=1 SV=1 Back     alignment and function description
>sp|Q6UWM9|UD2A3_HUMAN UDP-glucuronosyltransferase 2A3 OS=Homo sapiens GN=UGT2A3 PE=2 SV=2 Back     alignment and function description
>sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo sapiens GN=UGT2B7 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT55|UDB19_MACFA UDP-glucuronosyltransferase 2B19 OS=Macaca fascicularis GN=UGT2B19 PE=1 SV=1 Back     alignment and function description
>sp|P54855|UDB15_HUMAN UDP-glucuronosyltransferase 2B15 OS=Homo sapiens GN=UGT2B15 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
157126027 523 glucosyl/glucuronosyl transferases [Aede 0.523 0.403 0.403 6e-42
193648129 521 PREDICTED: UDP-glucuronosyltransferase 2 0.473 0.366 0.456 1e-41
328701160 518 PREDICTED: UDP-glucuronosyltransferase 2 0.545 0.424 0.402 2e-41
189240670410 PREDICTED: similar to glucosyl/glucurono 0.468 0.460 0.415 4e-41
328702147 522 PREDICTED: UDP-glucuronosyltransferase 2 0.506 0.390 0.410 3e-40
118778599 522 AGAP007029-PA [Anopheles gambiae str. PE 0.543 0.419 0.384 3e-40
312373543425 hypothetical protein AND_17307 [Anophele 0.533 0.505 0.391 6e-40
328697561 521 PREDICTED: UDP-glucuronosyltransferase 2 0.506 0.391 0.417 7e-40
193615605 524 PREDICTED: UDP-glucuronosyltransferase 2 0.511 0.393 0.403 1e-39
242013333 522 UDP-glucuronosyltransferase 1-8 precurso 0.528 0.408 0.384 1e-39
>gi|157126027|ref|XP_001654500.1| glucosyl/glucuronosyl transferases [Aedes aegypti] gi|108873426|gb|EAT37651.1| AAEL010386-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 131/218 (60%), Gaps = 7/218 (3%)

Query: 188 ETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFIT 247
           E +  FL+VF +LK  + WK +  N P       PDNVF+Q W+PQ DILAHPN++LFIT
Sbjct: 311 EKRDAFLKVFSKLKQKVLWKWEDDNLP-----GKPDNVFVQSWWPQDDILAHPNVKLFIT 365

Query: 248 HGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTML 307
           HGG+ S  E+   GVPV+G+P FGDQY NM      GY L      +++       + +L
Sbjct: 366 HGGLLSTTESLYHGVPVIGIPVFGDQYLNMAKAERGGYGLSVAYAEISETKLSNAIEAIL 425

Query: 308 NDPSFKQNAKKWASIANDEIVSPLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDI 367
           NDP FK NA   +    D+ ++PLE   +W EYV+R KGAPH+  ++  L++ Q + +D+
Sbjct: 426 NDPQFKVNALAISQRYRDQPLTPLELATFWVEYVIRQKGAPHIRTAAMDLSFVQYHNLDV 485

Query: 368 ILVILGILYAVVKLLSMCCCR--SSKKHTQVSSTKKKN 403
           + +++G+   ++ LL    CR  SSK   +++  KK+N
Sbjct: 486 LGLLIGLPIVILHLLVRRVCRKKSSKPSNKINERKKRN 523




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193648129|ref|XP_001950151.1| PREDICTED: UDP-glucuronosyltransferase 2B18-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701160|ref|XP_001949845.2| PREDICTED: UDP-glucuronosyltransferase 2C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189240670|ref|XP_972291.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328702147|ref|XP_001949466.2| PREDICTED: UDP-glucuronosyltransferase 2C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|118778599|ref|XP_308743.3| AGAP007029-PA [Anopheles gambiae str. PEST] gi|116132462|gb|EAA03993.4| AGAP007029-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312373543|gb|EFR21259.1| hypothetical protein AND_17307 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328697561|ref|XP_001948228.2| PREDICTED: UDP-glucuronosyltransferase 2C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193615605|ref|XP_001951323.1| PREDICTED: UDP-glucuronosyltransferase 2C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242013333|ref|XP_002427365.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] gi|212511724|gb|EEB14627.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
UNIPROTKB|F1RUQ6542 UGT2A3 "Uncharacterized protei 0.451 0.335 0.401 1.3e-47
FB|FBgn0038886537 CG6475 [Drosophila melanogaste 0.501 0.376 0.396 1.2e-43
UNIPROTKB|F1P7A1531 UGT2B31 "UDP-glucuronosyltrans 0.521 0.395 0.362 4.1e-43
UNIPROTKB|F1MW47530 UGT2A3 "Uncharacterized protei 0.528 0.401 0.366 5.2e-43
FB|FBgn0040256517 Ugt86Dd "Ugt86Dd" [Drosophila 0.528 0.411 0.386 8.5e-43
RGD|1309989532 Ugt2b10 "UDP glucuronosyltrans 0.528 0.400 0.371 1.1e-42
UNIPROTKB|F1RUR0532 UGT2B4 "Uncharacterized protei 0.501 0.379 0.364 1.8e-42
UNIPROTKB|H9GW51546 UGT2B31 "UDP-glucuronosyltrans 0.521 0.384 0.353 1.8e-42
UNIPROTKB|L7N0P3530 UGT2B31 "UDP-glucuronosyltrans 0.521 0.396 0.353 1.8e-42
UNIPROTKB|Q6K1J1530 UGT2B31 "UDP-glucuronosyltrans 0.521 0.396 0.353 1.8e-42
UNIPROTKB|F1RUQ6 UGT2A3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 1.3e-47, Sum P(3) = 1.3e-47
 Identities = 73/182 (40%), Positives = 115/182 (63%)

Query:   220 TLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVL 279
             TL  N  +  W PQ D+L HP  + FITHGG + + EA   GVP++GVP F DQ  N+  
Sbjct:   354 TLGANTRLYDWIPQNDLLGHPKAKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAH 413

Query:   280 LRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTE 339
             ++ +G A+   I T+T +  L   +T++N+PS+K+NA + + I +D+ V PL+R ++W E
Sbjct:   414 MKAKGAAVEVNINTMTSEDLLNALKTVINEPSYKENAMRLSRIHHDQPVKPLDRAIFWIE 473

Query:   340 YVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKKHTQVSST 399
             +V+RHKGA HL  ++  LTWYQ + +D+I  ++  +  V+ L++MCC  S +K  +    
Sbjct:   474 FVMRHKGAKHLRPAAHDLTWYQYHSLDVIGFLMACVATVIFLVTMCCLFSYRKFGKTGKK 533

Query:   400 KK 401
             KK
Sbjct:   534 KK 535


GO:0052695 "cellular glucuronidation" evidence=IEA
GO:0015020 "glucuronosyltransferase activity" evidence=IEA
FB|FBgn0038886 CG6475 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7A1 UGT2B31 "UDP-glucuronosyltransferase 2B31" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MW47 UGT2A3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0040256 Ugt86Dd "Ugt86Dd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1309989 Ugt2b10 "UDP glucuronosyltransferase 2 family, polypeptide B10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUR0 UGT2B4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H9GW51 UGT2B31 "UDP-glucuronosyltransferase 2B31" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|L7N0P3 UGT2B31 "UDP-glucuronosyltransferase 2B31" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K1J1 UGT2B31 "UDP-glucuronosyltransferase 2B31" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 2e-43
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 1e-34
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 5e-19
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 3e-17
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 3e-14
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 4e-10
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 3e-09
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 1e-08
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 1e-07
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 3e-07
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 4e-07
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 5e-07
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 5e-07
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 7e-07
PHA03392 507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 4e-06
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 4e-06
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 4e-06
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 5e-06
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 2e-05
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 3e-05
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 4e-05
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 6e-05
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 1e-04
pfam04101167 pfam04101, Glyco_tran_28_C, Glycosyltransferase fa 1e-04
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 4e-04
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 5e-04
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 0.002
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 0.002
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 0.003
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 0.003
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
 Score =  157 bits (400), Expect = 2e-43
 Identities = 69/167 (41%), Positives = 104/167 (62%)

Query: 220 TLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVL 279
           TL  N  + KW PQ D+L HP  R F+TH G + + EA   GVP++G+P FGDQ  N   
Sbjct: 320 TLGRNTRLVKWLPQNDLLGHPKTRAFVTHAGSNGVYEAICHGVPMVGMPLFGDQMDNAKH 379

Query: 280 LRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVSPLERVVYWTE 339
           +  +G A+   + T+T +  L   +T++NDPS+K+N  + +SI +D+ V PL+R V+W E
Sbjct: 380 MEAKGAAVTLNVLTMTSEDLLNALKTVINDPSYKENIMRLSSIHHDQPVKPLDRAVFWIE 439

Query: 340 YVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCC 386
           +V+RHKGA HL  ++  LTWYQ + +D+I  +L  +  V  +   CC
Sbjct: 440 FVMRHKGAKHLRPAAHDLTWYQYHSLDVIGFLLACVATVAFITFKCC 486


Length = 500

>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|217893 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 403
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
KOG1192|consensus496 100.0
PLN02670472 transferase, transferring glycosyl groups 99.97
PLN02554481 UDP-glycosyltransferase family protein 99.96
PLN02207468 UDP-glycosyltransferase 99.96
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.95
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.95
PLN03004451 UDP-glycosyltransferase 99.95
PLN02208442 glycosyltransferase family protein 99.95
PLN02562448 UDP-glycosyltransferase 99.95
PLN02992481 coniferyl-alcohol glucosyltransferase 99.95
PLN02764453 glycosyltransferase family protein 99.95
PLN02555480 limonoid glucosyltransferase 99.95
PLN00414446 glycosyltransferase family protein 99.94
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.94
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.94
PLN02210456 UDP-glucosyl transferase 99.94
PLN02167475 UDP-glycosyltransferase family protein 99.94
PLN02448459 UDP-glycosyltransferase family protein 99.94
PLN03007482 UDP-glucosyltransferase family protein 99.94
PLN03015470 UDP-glucosyl transferase 99.94
PLN00164480 glucosyltransferase; Provisional 99.93
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.93
PLN02173449 UDP-glucosyl transferase family protein 99.93
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.92
PLN02534491 UDP-glycosyltransferase 99.92
PLN02670472 transferase, transferring glycosyl groups 99.78
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.76
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.76
PLN02555480 limonoid glucosyltransferase 99.74
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.74
PLN02207468 UDP-glycosyltransferase 99.74
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.74
PLN03004451 UDP-glycosyltransferase 99.72
PLN02554481 UDP-glycosyltransferase family protein 99.71
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.71
PLN02208442 glycosyltransferase family protein 99.7
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.7
PLN02992481 coniferyl-alcohol glucosyltransferase 99.7
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.69
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.68
PLN02562448 UDP-glycosyltransferase 99.68
PLN03015470 UDP-glucosyl transferase 99.68
PLN02764453 glycosyltransferase family protein 99.67
PLN02173449 UDP-glucosyl transferase family protein 99.67
PLN02210456 UDP-glucosyl transferase 99.66
PLN03007482 UDP-glucosyltransferase family protein 99.65
PLN00164480 glucosyltransferase; Provisional 99.64
PLN00414446 glycosyltransferase family protein 99.63
PLN02167475 UDP-glycosyltransferase family protein 99.62
PLN02534491 UDP-glycosyltransferase 99.58
KOG1192|consensus496 99.58
PLN02448459 UDP-glycosyltransferase family protein 99.58
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.53
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.51
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.44
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.42
PLN02605382 monogalactosyldiacylglycerol synthase 99.31
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.3
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.23
TIGR03492396 conserved hypothetical protein. This protein famil 99.14
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.11
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.09
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 98.95
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.87
COG4671400 Predicted glycosyl transferase [General function p 98.83
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.77
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 98.76
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.68
KOG3349|consensus170 98.64
cd03814364 GT1_like_2 This family is most closely related to 98.38
PRK14089347 ipid-A-disaccharide synthase; Provisional 98.24
COG5017161 Uncharacterized conserved protein [Function unknow 98.19
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 98.18
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.16
cd03823359 GT1_ExpE7_like This family is most closely related 98.15
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.08
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.02
cd03795357 GT1_like_4 This family is most closely related to 97.91
cd03794394 GT1_wbuB_like This family is most closely related 97.87
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.83
cd03808359 GT1_cap1E_like This family is most closely related 97.83
cd03804351 GT1_wbaZ_like This family is most closely related 97.8
cd03818396 GT1_ExpC_like This family is most closely related 97.79
cd03800398 GT1_Sucrose_synthase This family is most closely r 97.79
cd03801374 GT1_YqgM_like This family is most closely related 97.75
cd03821375 GT1_Bme6_like This family is most closely related 97.71
cd04962371 GT1_like_5 This family is most closely related to 97.68
cd03817374 GT1_UGDG_like This family is most closely related 97.67
cd03798377 GT1_wlbH_like This family is most closely related 97.63
cd03822366 GT1_ecORF704_like This family is most closely rela 97.63
cd03820348 GT1_amsD_like This family is most closely related 97.61
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 97.6
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 97.59
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.58
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 97.57
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 97.57
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 97.49
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.49
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 97.47
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.46
cd04946407 GT1_AmsK_like This family is most closely related 97.43
cd03825365 GT1_wcfI_like This family is most closely related 97.43
cd04951360 GT1_WbdM_like This family is most closely related 97.42
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 97.41
cd03807365 GT1_WbnK_like This family is most closely related 97.38
cd03819355 GT1_WavL_like This family is most closely related 97.24
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 97.24
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 97.22
cd04949372 GT1_gtfA_like This family is most closely related 97.19
cd03811353 GT1_WabH_like This family is most closely related 97.19
cd03809365 GT1_mtfB_like This family is most closely related 97.11
TIGR00661321 MJ1255 conserved hypothetical protein. This model 97.07
PRK10307412 putative glycosyl transferase; Provisional 97.06
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 97.02
cd03816415 GT1_ALG1_like This family is most closely related 97.0
cd03812358 GT1_CapH_like This family is most closely related 96.98
cd03805392 GT1_ALG2_like This family is most closely related 96.93
cd03813475 GT1_like_3 This family is most closely related to 96.89
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 96.87
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.74
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 96.64
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 96.5
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 96.49
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 96.46
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 96.45
cd04955363 GT1_like_6 This family is most closely related to 96.41
cd03796398 GT1_PIG-A_like This family is most closely related 96.33
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 96.27
PHA01633335 putative glycosyl transferase group 1 96.18
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 96.16
cd03802335 GT1_AviGT4_like This family is most closely relate 95.82
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.81
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 95.77
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 95.64
PLN02275371 transferase, transferring glycosyl groups 95.42
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 95.35
PHA01630331 putative group 1 glycosyl transferase 95.34
PRK10125405 putative glycosyl transferase; Provisional 94.98
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 94.96
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 94.7
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 94.66
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 94.45
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 94.34
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 94.26
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 94.2
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 93.76
KOG4626|consensus966 93.32
PLN02949463 transferase, transferring glycosyl groups 92.98
PRK14098489 glycogen synthase; Provisional 92.86
PRK00654466 glgA glycogen synthase; Provisional 92.59
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 92.06
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 91.98
PLN02501794 digalactosyldiacylglycerol synthase 91.97
PLN02846462 digalactosyldiacylglycerol synthase 91.61
PRK14099485 glycogen synthase; Provisional 91.58
COG4370412 Uncharacterized protein conserved in bacteria [Fun 90.93
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 90.72
cd03806419 GT1_ALG11_like This family is most closely related 90.46
PLN02939977 transferase, transferring glycosyl groups 88.58
PRK10017426 colanic acid biosynthesis protein; Provisional 88.13
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 86.24
TIGR02470784 sucr_synth sucrose synthase. This model represents 85.44
PLN00142815 sucrose synthase 85.25
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 85.05
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 82.49
PLN023161036 synthase/transferase 82.38
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 81.87
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 81.8
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 80.19
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
Probab=100.00  E-value=1.3e-50  Score=415.73  Aligned_cols=217  Identities=38%  Similarity=0.699  Sum_probs=130.3

Q ss_pred             CCCeEEEEeCCCCC-CCHHHHHHHHHHHhcCCCCEEEEEcCCCCcccccCCCCCCEEEeeccCccccccCcccceeeccc
Q psy16938        171 RLPKIDARMIDPTK-LSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHG  249 (403)
Q Consensus       171 ~~~~v~vs~GS~~~-~~~~~~~~~~~al~~~~~~vi~~~~~~~~~~~~~~~~~~nv~i~~~~pq~~lL~h~~~~~~Ithg  249 (403)
                      +.++|||||||... .+++..++++++|++++++|||++++ .    ....+|+|+++.+|+||.++|+||++++|||||
T Consensus       275 ~~~vv~vsfGs~~~~~~~~~~~~~~~~~~~~~~~~iW~~~~-~----~~~~l~~n~~~~~W~PQ~~lL~hp~v~~fitHg  349 (500)
T PF00201_consen  275 KKGVVYVSFGSIVSSMPEEKLKEIAEAFENLPQRFIWKYEG-E----PPENLPKNVLIVKWLPQNDLLAHPRVKLFITHG  349 (500)
T ss_dssp             TTEEEEEE-TSSSTT-HHHHHHHHHHHHHCSTTEEEEEETC-S----HGCHHHTTEEEESS--HHHHHTSTTEEEEEES-
T ss_pred             CCCEEEEecCcccchhHHHHHHHHHHHHhhCCCcccccccc-c----ccccccceEEEeccccchhhhhcccceeeeecc
Confidence            35689999999874 34556889999999999999999987 4    456678999999999999999999999999999


Q ss_pred             chHHHHHHHHcCCCeeccccccchHHHHHHHHHhCceeEecCCCCCHHHHHHHHHHHhcCchHHHHHHHHHHHhcccCCC
Q psy16938        250 GISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQNAKKWASIANDEIVS  329 (403)
Q Consensus       250 G~~s~~Eal~~GvP~i~iP~~~DQ~~na~~~~~~G~G~~l~~~~~~~~~l~~ai~~ll~~~~~~~~a~~~~~~~~~~p~~  329 (403)
                      |+||+.||+++|||+|++|+++||+.||+++++.|+|+.++..+++.++|.++|+++|+|++|++||++++++++++|.+
T Consensus       350 G~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~vl~~~~y~~~a~~ls~~~~~~p~~  429 (500)
T PF00201_consen  350 GLNSTQEALYHGVPMLGIPLFGDQPRNAARVEEKGVGVVLDKNDLTEEELRAAIREVLENPSYKENAKRLSSLFRDRPIS  429 (500)
T ss_dssp             -HHHHHHHHHCT--EEE-GCSTTHHHHHHHHHHTTSEEEEGGGC-SHHHHHHHHHHHHHSHHHHHHHHHHHHTTT-----
T ss_pred             ccchhhhhhhccCCccCCCCcccCCccceEEEEEeeEEEEEecCCcHHHHHHHHHHHHhhhHHHHHHHHHHHHHhcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHhcCCCCCCcccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Q psy16938        330 PLERVVYWTEYVLRHKGAPHLSASSRQLTWYQMYCIDIILVILGILYAVVKLLSMCCCRSSKK  392 (403)
Q Consensus       330 ~~~~a~~~ie~~~~~~~~~~l~~~~~~~~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~  392 (403)
                      |.|+|++|||+++|++|++|||+.+.+|||||||+|||+++++++++++++++.++|++++++
T Consensus       430 p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~  492 (500)
T PF00201_consen  430 PLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRK  492 (500)
T ss_dssp             ---------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999888766666666666665555544



This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-19
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 9e-08
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 1e-07
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 4e-07
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 5e-07
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 1e-06
2vce_A480 Characterization And Engineering Of The Bifunctiona 2e-06
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 1e-04
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 1e-04
4g2t_A397 Crystal Structure Of Streptomyces Sp. Sf2575 Glycos 2e-04
4fzr_A398 Crystal Structure Of Ssfs6, Streptomyces Sp. Sf2575 2e-04
3otg_A412 Crystal Structure Of Calg1, Calicheamicin Glycostyl 4e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure

Iteration: 1

Score = 93.2 bits (230), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/143 (34%), Positives = 72/143 (50%), Gaps = 5/143 (3%) Query: 183 TKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNL 242 + +EE Q+ + W+ D N P TL N + KW PQ D+L HP Sbjct: 33 SNXTEERANVIASALAQIPQKVLWRFD-GNKP----DTLGLNTRLYKWIPQNDLLGHPKT 87 Query: 243 RLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKN 302 R FITHGG + + EA G+P +G+P F DQ N+ + RG A+ T + L Sbjct: 88 RAFITHGGANGIYEAIYHGIPXVGIPLFADQPDNIAHXKARGAAVRVDFNTXSSTDLLNA 147 Query: 303 AQTMLNDPSFKQNAKKWASIAND 325 + ++NDPS+K+N K + I +D Sbjct: 148 LKRVINDPSYKENVXKLSRIQHD 170
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|4G2T|A Chain A, Crystal Structure Of Streptomyces Sp. Sf2575 Glycosyltransferase Ssfs6, Complexed With Thymidine Diphosphate Length = 397 Back     alignment and structure
>pdb|4FZR|A Chain A, Crystal Structure Of Ssfs6, Streptomyces Sp. Sf2575 Glycosyltransferase Length = 398 Back     alignment and structure
>pdb|3OTG|A Chain A, Crystal Structure Of Calg1, Calicheamicin Glycostyltransferase, Tdp Bound Form Length = 412 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 3e-50
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 3e-24
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 3e-31
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 7e-08
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 6e-04
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 5e-31
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 6e-09
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 1e-04
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 3e-24
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 1e-06
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 9e-22
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 4e-05
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 2e-20
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 1e-04
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 9e-20
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 8e-04
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 6e-19
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 8e-04
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 1e-18
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 4e-04
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 3e-17
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 9e-17
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 5e-04
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 1e-15
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 1e-14
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 7e-14
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 4e-11
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 5e-11
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 6e-11
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-09
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 4e-05
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  166 bits (422), Expect = 3e-50
 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 5/141 (3%)

Query: 185 LSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRL 244
           ++EE          Q+   + W+ D          TL  N  + KW PQ D+L HP  R 
Sbjct: 35  MTEERANVIASALAQIPQKVLWRFDGNKPD-----TLGLNTRLYKWIPQNDLLGHPKTRA 89

Query: 245 FITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRHRGYALIEPIQTLTKQSFLKNAQ 304
           FITHGG + + EA   G+P++G+P F DQ  N+  ++ RG A+     T++    L   +
Sbjct: 90  FITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALK 149

Query: 305 TMLNDPSFKQNAKKWASIAND 325
            ++NDPS+K+N  K + I +D
Sbjct: 150 RVINDPSYKENVMKLSRIQHD 170


>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Length = 224 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.96
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.96
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.96
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.95
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.95
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.95
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.94
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.94
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.94
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.94
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.93
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.92
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.92
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.92
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.91
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.88
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.88
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.87
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.87
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.84
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.81
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.66
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.61
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.61
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.55
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.52
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.49
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.35
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.23
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.23
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.22
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 98.93
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 98.92
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 98.92
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 98.81
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 98.67
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 98.63
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.58
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 98.55
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 98.55
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.53
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.49
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 98.45
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.42
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 98.37
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.36
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 98.3
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 98.19
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.11
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.06
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 98.03
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 97.97
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.81
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 97.74
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.69
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 97.68
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 97.67
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 97.66
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.64
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.52
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 97.46
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 97.45
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.41
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.24
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 97.23
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 97.19
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 97.16
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 97.13
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 96.63
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 96.43
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 96.3
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 95.89
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 95.75
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 95.29
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 95.06
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 82.69
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 80.37
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
Probab=99.96  E-value=4e-29  Score=253.77  Aligned_cols=179  Identities=18%  Similarity=0.244  Sum_probs=147.0

Q ss_pred             CCCeEEEEeCCCCCCCHHHHHHHHHHHhcCCCCEEEEEcCCCCc-----------cccc-CCCCCCE--------EEe-e
Q psy16938        171 RLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDP-----------VLNA-KTLPDNV--------FIQ-K  229 (403)
Q Consensus       171 ~~~~v~vs~GS~~~~~~~~~~~~~~al~~~~~~vi~~~~~~~~~-----------~~~~-~~~~~nv--------~i~-~  229 (403)
                      .+|+|||+|||....+.+.+.+++++|++.+++|||+++. ...           .... ..+|+|+        .++ +
T Consensus       267 ~~~vvyvs~GS~~~~~~~~~~~~~~al~~~~~~~lw~~~~-~~~~~~~~~~~~~~~~~~~~~lp~~~~~~~~~~g~~v~~  345 (480)
T 2vch_A          267 LGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRS-PSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPF  345 (480)
T ss_dssp             TTCEEEEECTTTCCCCHHHHHHHHHHHHHTTCEEEEEECC-CCSSTTTTTTCC--CSCGGGGSCTTHHHHTTTTEEEEES
T ss_pred             CCceEEEecccccCCCHHHHHHHHHHHHhcCCcEEEEECC-ccccccccccccccccchhhhcCHHHHHHhCCCeEEEeC
Confidence            5789999999999888888999999999999999999986 321           0011 2477775        444 5


Q ss_pred             ccCccccccCcccceeecccchHHHHHHHHcCCCeeccccccchHHHHHHH-HHhCceeEecCC---CCCHHHHHHHHHH
Q psy16938        230 WYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLL-RHRGYALIEPIQ---TLTKQSFLKNAQT  305 (403)
Q Consensus       230 ~~pq~~lL~h~~~~~~IthgG~~s~~Eal~~GvP~i~iP~~~DQ~~na~~~-~~~G~G~~l~~~---~~~~~~l~~ai~~  305 (403)
                      |+||.++|.|+++++||||||+||++||+++|||||++|+++||+.||+++ ++.|+|+.++..   .+++++|.++|++
T Consensus       346 w~Pq~~vL~h~~v~~fvtHgG~~S~~Eal~~GvP~i~~P~~~DQ~~na~~l~~~~G~g~~l~~~~~~~~~~~~l~~av~~  425 (480)
T 2vch_A          346 WAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKG  425 (480)
T ss_dssp             CCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTTSCCCHHHHHHHHHH
T ss_pred             ccCHHHHhCCCCcCeEEecccchhHHHHHHcCCCEEeccccccchHHHHHHHHHhCeEEEeecccCCccCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999997 789999999865   7899999999999


Q ss_pred             Hhc---CchHHHHHHHHHHHhcc---cCCChHHHHHHHHHHHHhcCCCCCCcc
Q psy16938        306 MLN---DPSFKQNAKKWASIAND---EIVSPLERVVYWTEYVLRHKGAPHLSA  352 (403)
Q Consensus       306 ll~---~~~~~~~a~~~~~~~~~---~p~~~~~~a~~~ie~~~~~~~~~~l~~  352 (403)
                      +|+   +++|+++|+++++.+++   ..-.....+...++.+.+  ++++++.
T Consensus       426 vl~~~~~~~~r~~a~~l~~~~~~a~~~gGss~~~~~~~v~~~~~--~~~~~~~  476 (480)
T 2vch_A          426 LMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKA--HKKELEQ  476 (480)
T ss_dssp             HHTSTHHHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHH--HHHHHHC
T ss_pred             HhcCcchHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHH--hHHHhhh
Confidence            998   78999999999999887   411123444455555533  4444443



>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 403
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 6e-23
d2c1xa1 450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 1e-04
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 2e-19
d1iira_ 401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 4e-04
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 3e-19
d1rrva_ 401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 0.001
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 1e-16
d2pq6a1 473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 0.004
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 4e-16
d2acva1 461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 0.003
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 4e-16
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 1e-14
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 0.003
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
 Score = 97.9 bits (242), Expect = 6e-23
 Identities = 57/327 (17%), Positives = 105/327 (32%), Gaps = 29/327 (8%)

Query: 29  LPIFWKIDITNDPVLNAKTLPDNVFIQKWYPQTDILAHPNLRLFITHGGISSLMNWNRYG 88
           L     ID   + +  +        +  + P    +   +L+  I  G ++SL +   + 
Sbjct: 141 LSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHR 200

Query: 89  TGGALPNLCTMNHFSFIILLSFSFLGTLSCDKILVFLPLPIWSHQMQYEKVWTALAERGH 148
            G  LP    +   SF  L         S  K          +           +     
Sbjct: 201 MGQVLPKATAVFINSFEELDDSLTNDLKSKLK-------TYLNIGPFNLITPPPVVPNTT 253

Query: 149 EVTIYTKFTPKSNSTNLKHVPIRLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKI 208
               + K    ++   +    +           P ++         E  +  ++P  W +
Sbjct: 254 GCLQWLKERKPTSVVYISFGTVT-------TPPPAEVVA-----LSEALEASRVPFIWSL 301

Query: 209 DITNDPVLNAKTLP---DNVFIQKWYPQTDILAHPNLRLFITHGGISSLMEASSLGVPVL 265
                  L    L        +  W PQ ++LAH  +  F+TH G +SL E+ + GVP++
Sbjct: 302 RDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLI 361

Query: 266 GVPFFGDQYRNMVLL-RHRGYALIEPIQTLTKQSFLKNAQTMLNDPSFK---QNAKKWAS 321
             PFFGDQ  N  ++       +       TK   +     +L+    K   +N +    
Sbjct: 362 CRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRE 421

Query: 322 IAN---DEIVSPLERVVYWTEYVLRHK 345
            A+       S  E  +   + V + K
Sbjct: 422 TADRAVGPKGSSTENFITLVDLVSKPK 448


>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.97
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.96
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.95
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.94
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.94
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.93
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.92
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.74
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.53
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.51
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.44
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.24
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.17
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.13
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 98.78
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 97.98
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.68
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.53
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 96.03
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 95.82
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 95.14
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 94.89
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.8
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 92.24
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
Probab=99.97  E-value=8.9e-32  Score=266.50  Aligned_cols=173  Identities=22%  Similarity=0.327  Sum_probs=149.8

Q ss_pred             CCCeEEEEeCCCCCCCHHHHHHHHHHHhcCCCCEEEEEcCCCCccccc-----CCCCCCEEEeeccCccccccCccccee
Q psy16938        171 RLPKIDARMIDPTKLSEETKLGFLEVFKQLKLPIFWKIDITNDPVLNA-----KTLPDNVFIQKWYPQTDILAHPNLRLF  245 (403)
Q Consensus       171 ~~~~v~vs~GS~~~~~~~~~~~~~~al~~~~~~vi~~~~~~~~~~~~~-----~~~~~nv~i~~~~pq~~lL~h~~~~~~  245 (403)
                      ..+.+|+++||......+.+.+++.++++.+++|||++.. .... .+     ...+.|+.+.+|+||.++|.||++++|
T Consensus       264 ~~~~v~~s~gs~~~~~~~~~~~~~~~~~~~~~~vl~~~~~-~~~~-~l~~~~~~~~~~nv~~~~~~pq~~lL~hp~~~~f  341 (450)
T d2c1xa1         264 PTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRD-KARV-HLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAF  341 (450)
T ss_dssp             TTCEEEEECCSSCCCCHHHHHHHHHHHHHHTCCEEEECCG-GGGG-GSCTTHHHHHTTTEEEESCCCHHHHHTSTTEEEE
T ss_pred             ccceeeecccccccCCHHHHHHHHHHHHhcCCeEEEEECC-Cccc-cCChhhhhhccccccccccCChHhhhccCceeEE
Confidence            5678999999999999999999999999999999999876 3211 11     134679999999999999999999999


Q ss_pred             ecccchHHHHHHHHcCCCeeccccccchHHHHHHHHH-hCceeEecCCCCCHHHHHHHHHHHhcCchHHHH---HHHHHH
Q psy16938        246 ITHGGISSLMEASSLGVPVLGVPFFGDQYRNMVLLRH-RGYALIEPIQTLTKQSFLKNAQTMLNDPSFKQN---AKKWAS  321 (403)
Q Consensus       246 IthgG~~s~~Eal~~GvP~i~iP~~~DQ~~na~~~~~-~G~G~~l~~~~~~~~~l~~ai~~ll~~~~~~~~---a~~~~~  321 (403)
                      |||||+||++||+++|||||++|+++||+.||+++++ .|+|+.++..++|+++|.++|+++|+|++|+++   ++++++
T Consensus       342 ItHGG~~s~~eal~~GvP~v~~P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d~~y~~~~~r~~~l~~  421 (450)
T d2c1xa1         342 VTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRE  421 (450)
T ss_dssp             EECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHHHHHHHHHHHHHHH
T ss_pred             EccCCccHHHHHHHcCCCEEecccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcCcHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999976 699999999999999999999999999988764   444444


Q ss_pred             HhcccCCC----hHHHHHHHHHHHHhcCC
Q psy16938        322 IANDEIVS----PLERVVYWTEYVLRHKG  346 (403)
Q Consensus       322 ~~~~~p~~----~~~~a~~~ie~~~~~~~  346 (403)
                      .. ++|..    +.+.+++|||+++||++
T Consensus       422 ~~-~~a~~~~gss~~~~~~~~e~v~r~~~  449 (450)
T d2c1xa1         422 TA-DRAVGPKGSSTENFITLVDLVSKPKD  449 (450)
T ss_dssp             HH-HHHTSTTCHHHHHHHHHHHHHTSCCC
T ss_pred             HH-HHhccCCCCHHHHHHHHHHHHhhhcC
Confidence            33 34433    38999999999999975



>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure