Psyllid ID: psy16978

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MCFPLEIRFTHQLVIVLNVHFAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARREREEQDRLKQEKHAKMDHHSHHQSMMGGLDKNSDLLKAVVTKVQS
cccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHccccccccc
mcfpleirFTHQLVIVLNVHFAKMLCQLkqsgpngcprrrgrqtytrFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARREREEQDRLKQEkhakmdhhshhqsmmggldkNSDLLKAVVTKVQS
MCFPLEIRFTHQLVIVLNVHFAKMLCQLkqsgpngcprrrgRQTYTrfqtlelekefhfnhyltrRRRIEIAHALclterqikiwfqnRRMKLKKELRAVKEineqarrereeqdrlkqekhakmdhhshhqsmmggldknSDLLKAVVTKVQS
MCFPLEIRFTHQLVIVLNVHFAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINeqarrereeqdrLKQEKHAKMDHHSHHQSMMGGLDKNSDLLKAVVTKVQS
**********************************************RFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKL*************************************************************
********************************************YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR****************************************************************
MCFPLEIRFTHQLVIVLNVHFAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ******************************GLDKNSDLLKAVVTKVQS
*C***************************************RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR********************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCFPLEIRFTHQLVIVLNVHFAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMDHHSHHQSMMGGLDKNSDLLKAVVTKVQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
O76762308 Homeobox protein abdomina yes N/A 0.727 0.363 0.807 1e-47
P29552239 Homeobox protein abdomina N/A N/A 0.720 0.464 0.807 9e-47
P29555590 Homeobox protein abdomina yes N/A 0.701 0.183 0.788 7e-46
B0W1V2216 Homeobox protein abdomina N/A N/A 0.642 0.458 0.868 3e-45
P29556157 Homeobox protein abdomina N/A N/A 0.753 0.738 0.649 2e-44
Q2643097 Homeobox protein abdomina N/A N/A 0.551 0.876 0.976 2e-42
Q05007139 Homeobox protein abdomina N/A N/A 0.538 0.597 0.951 6e-42
Q07961343 Homeobox protein abdomina yes N/A 0.792 0.355 0.659 4e-41
P1585674 Homeobox protein abdomina no N/A 0.480 1.0 0.972 6e-37
Q8T940253 Homeotic protein ultrabit N/A N/A 0.487 0.296 0.855 3e-32
>sp|O76762|ABDA_ANOGA Homeobox protein abdominal-A homolog OS=Anopheles gambiae GN=abd-A PE=2 SV=1 Back     alignment and function desciption
 Score =  188 bits (478), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/114 (80%), Positives = 100/114 (87%), Gaps = 2/114 (1%)

Query: 21  FAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 80
           F +++C    +GPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER
Sbjct: 122 FDRVVCG-DFAGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 180

Query: 81  QIKIWFQNRRMKLKKELRAVKEINEQARREREEQDRLKQEK-HAKMDHHSHHQS 133
           QIKIWFQNRRMKLKKELRAVKEINEQARREREEQD++K E   +   HHS  Q+
Sbjct: 181 QIKIWFQNRRMKLKKELRAVKEINEQARREREEQDKMKNESLKSAQQHHSQKQA 234
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Anopheles gambiae (taxid: 7165)
>sp|P29552|ABDA_AEDAE Homeobox protein abdominal-A homolog OS=Aedes aegypti GN=abd-A PE=3 SV=2 Back     alignment and function description
>sp|P29555|ABDA_DROME Homeobox protein abdominal-A OS=Drosophila melanogaster GN=abd-A PE=2 SV=2 Back     alignment and function description
>sp|B0W1V2|ABDA_CULQU Homeobox protein abdominal-A homolog OS=Culex quinquefasciatus GN=abd-A PE=3 SV=1 Back     alignment and function description
>sp|P29556|ABDA_SCHGR Homeobox protein abdominal-A homolog (Fragment) OS=Schistocerca gregaria GN=ABD-A PE=3 SV=1 Back     alignment and function description
>sp|Q26430|ABDA_MANSE Homeobox protein abdominal-A homolog (Fragment) OS=Manduca sexta GN=ABD-A PE=3 SV=1 Back     alignment and function description
>sp|Q05007|ABDA_ARTSF Homeobox protein abdominal-A homolog (Fragment) OS=Artemia franciscana GN=ABDA PE=3 SV=1 Back     alignment and function description
>sp|Q07961|ABDA_TRICA Homeobox protein abdominal-A homolog OS=Tribolium castaneum GN=ABD-A PE=2 SV=2 Back     alignment and function description
>sp|P15856|ABDA_APIME Homeobox protein abdominal-A homolog (Fragment) OS=Apis mellifera GN=ABD-A PE=3 SV=1 Back     alignment and function description
>sp|Q8T940|UBX_JUNCO Homeotic protein ultrabithorax OS=Junonia coenia GN=Ubx PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
383849762 293 PREDICTED: homeobox protein abdominal-A 0.798 0.419 0.741 4e-49
340727727 395 PREDICTED: homeobox protein abdominal-A 0.798 0.311 0.733 9e-49
340727729 399 PREDICTED: homeobox protein abdominal-A 0.824 0.318 0.733 2e-48
340727731 399 PREDICTED: homeobox protein abdominal-A 0.759 0.293 0.781 3e-48
328778463 396 PREDICTED: homeobox protein abdominal-A 0.798 0.310 0.721 4e-48
17922001 394 abdominal-A protein [Myrmica rubra] 0.785 0.307 0.709 8e-48
380014418 395 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.798 0.311 0.719 1e-47
345489557 413 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.798 0.297 0.700 1e-46
307178544189 Homeobox protein abdominal-A-like protei 0.759 0.619 0.773 1e-46
347972377 370 AGAP004662-PB [Anopheles gambiae str. PE 0.727 0.302 0.807 2e-46
>gi|383849762|ref|XP_003700506.1| PREDICTED: homeobox protein abdominal-A homolog [Megachile rotundata] Back     alignment and taxonomy information
 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 112/139 (80%), Gaps = 16/139 (11%)

Query: 21  FAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 80
           F +++C     GPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER
Sbjct: 155 FDRVVC-----GPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 209

Query: 81  QIKIWFQNRRMKLKKELRAVKEINEQARREREEQDRLKQ---EKHAKMDHHSHHQSM--- 134
           QIKIWFQNRRMKLKKELRAVKEINEQARREREEQD +K+   EK AKM     + ++   
Sbjct: 210 QIKIWFQNRRMKLKKELRAVKEINEQARREREEQDMMKKQQAEKQAKMQQEQQNAALQHQ 269

Query: 135 ----MGGLDKN-SDLLKAV 148
               + GLDK  SDLLKAV
Sbjct: 270 QQHHVSGLDKTQSDLLKAV 288

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340727727|ref|XP_003402189.1| PREDICTED: homeobox protein abdominal-A homolog isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340727729|ref|XP_003402190.1| PREDICTED: homeobox protein abdominal-A homolog isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340727731|ref|XP_003402191.1| PREDICTED: homeobox protein abdominal-A homolog isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328778463|ref|XP_394120.4| PREDICTED: homeobox protein abdominal-A homolog isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|17922001|gb|AAK06846.2| abdominal-A protein [Myrmica rubra] Back     alignment and taxonomy information
>gi|380014418|ref|XP_003691229.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein abdominal-A homolog [Apis florea] Back     alignment and taxonomy information
>gi|345489557|ref|XP_003426162.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein abdominal-A homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307178544|gb|EFN67233.1| Homeobox protein abdominal-A-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|347972377|ref|XP_003436886.1| AGAP004662-PB [Anopheles gambiae str. PEST] gi|333467596|gb|EGK96614.1| AGAP004662-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0000014590 abd-A "abdominal A" [Drosophil 0.538 0.140 0.892 2.6e-42
UNIPROTKB|P29552239 abd-A "Homeobox protein abdomi 0.720 0.464 0.710 1.2e-41
UNIPROTKB|B0W1V2216 abd-A "Homeobox protein abdomi 0.707 0.504 0.720 1.2e-41
UNIPROTKB|O76762308 abd-A "Homeobox protein abdomi 0.727 0.363 0.710 2.6e-38
UNIPROTKB|Q8T940253 Ubx "Homeotic protein ultrabit 0.474 0.288 0.851 2.3e-30
FB|FBgn0003944389 Ubx "Ultrabithorax" [Drosophil 0.467 0.185 0.863 3e-30
UNIPROTKB|P20822385 Ubx "Homeotic protein ultrabit 0.467 0.187 0.863 3e-30
UNIPROTKB|P83950389 Ubx "Homeotic protein ultrabit 0.467 0.185 0.863 3e-30
UNIPROTKB|Q6VPU7387 Ubx "Ultrabithorax" [Drosophil 0.467 0.186 0.863 3e-30
ZFIN|ZDB-GENE-000823-7224 hoxb6b "homeo box B6b" [Danio 0.454 0.312 0.842 5.7e-27
FB|FBgn0000014 abd-A "abdominal A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 2.6e-42, Sum P(3) = 2.6e-42
 Identities = 75/84 (89%), Positives = 79/84 (94%)

Query:    21 FAKMLCQLKQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 80
             F +++C    +GPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER
Sbjct:   382 FERVVCG-DFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 440

Query:    81 QIKIWFQNRRMKLKKELRAVKEIN 104
             QIKIWFQNRRMKLKKELRAVKEIN
Sbjct:   441 QIKIWFQNRRMKLKKELRAVKEIN 464
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0009952 "anterior/posterior pattern specification" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;IMP
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0008406 "gonad development" evidence=NAS;TAS
GO:0007422 "peripheral nervous system development" evidence=TAS
GO:0035224 "genital disc anterior/posterior pattern formation" evidence=IEP
GO:0007506 "gonadal mesoderm development" evidence=IMP
GO:0008354 "germ cell migration" evidence=IMP;TAS
GO:0007280 "pole cell migration" evidence=TAS
GO:0007494 "midgut development" evidence=TAS
GO:0007385 "specification of segmental identity, abdomen" evidence=NAS
GO:0007438 "oenocyte development" evidence=IMP
GO:0035053 "dorsal vessel heart proper cell fate commitment" evidence=IEP;IMP;TAS
GO:0007507 "heart development" evidence=IMP
GO:0007501 "mesodermal cell fate specification" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0006915 "apoptotic process" evidence=IMP
GO:0009987 "cellular process" evidence=IMP
GO:0007400 "neuroblast fate determination" evidence=IMP
GO:0035225 "determination of genital disc primordium" evidence=IMP
GO:0048806 "genitalia development" evidence=IMP
GO:0010002 "cardioblast differentiation" evidence=IMP
GO:0048738 "cardiac muscle tissue development" evidence=IMP
GO:0005667 "transcription factor complex" evidence=IPI
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0014019 "neuroblast development" evidence=IMP
GO:0048636 "positive regulation of muscle organ development" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0042694 "muscle cell fate specification" evidence=IMP
UNIPROTKB|P29552 abd-A "Homeobox protein abdominal-A homolog" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B0W1V2 abd-A "Homeobox protein abdominal-A homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|O76762 abd-A "Homeobox protein abdominal-A homolog" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|Q8T940 Ubx "Homeotic protein ultrabithorax" [Junonia coenia (taxid:39708)] Back     alignment and assigned GO terms
FB|FBgn0003944 Ubx "Ultrabithorax" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P20822 Ubx "Homeotic protein ultrabithorax" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|P83950 Ubx "Homeotic protein ultrabithorax" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VPU7 Ubx "Ultrabithorax" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000823-7 hoxb6b "homeo box B6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P15856ABDA_APIMENo assigned EC number0.97290.48051.0noN/A
A2T7F3HXA7_PANTRNo assigned EC number0.84050.42850.2869yesN/A
P02830HXA7_MOUSENo assigned EC number0.84050.42850.2882yesN/A
O76762ABDA_ANOGANo assigned EC number0.80700.72720.3636yesN/A
Q26430ABDA_MANSENo assigned EC number0.97640.55190.8762N/AN/A
Q05007ABDA_ARTSFNo assigned EC number0.95180.53890.5971N/AN/A
Q07961ABDA_TRICANo assigned EC number0.65950.79220.3556yesN/A
Q9YGT4HXB6B_DANRENo assigned EC number0.83090.46100.3169yesN/A
Q90VZ9HXA7_CHICKNo assigned EC number0.84050.42850.3013yesN/A
P31268HXA7_HUMANNo assigned EC number0.84050.42850.2869yesN/A
P29555ABDA_DROMENo assigned EC number0.78890.70120.1830yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam0004657 pfam00046, Homeobox, Homeobox domain 7e-23
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-19
smart0038957 smart00389, HOX, Homeodomain 1e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-09
pfam1240724 pfam12407, Abdominal-A, Homeobox protein 0.001
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 84.8 bits (211), Expect = 7e-23
 Identities = 32/57 (56%), Positives = 38/57 (66%)

Query: 39 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 95
          RR R T+T  Q  ELEKEF  N Y +   R E+A  L LTERQ+K+WFQNRR K K+
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|221563 pfam12407, Abdominal-A, Homeobox protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG0488|consensus309 99.77
KOG0843|consensus197 99.76
KOG3802|consensus398 99.75
KOG0489|consensus261 99.74
KOG0842|consensus307 99.74
KOG0484|consensus125 99.73
KOG0850|consensus245 99.73
KOG0487|consensus308 99.71
KOG2251|consensus228 99.7
KOG0485|consensus268 99.7
KOG0492|consensus246 99.69
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.69
KOG1168|consensus385 99.67
KOG0494|consensus332 99.62
KOG0483|consensus198 99.61
KOG0848|consensus317 99.61
KOG4577|consensus383 99.6
COG5576156 Homeodomain-containing transcription factor [Trans 99.6
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.58
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.57
KOG0493|consensus342 99.57
KOG0491|consensus194 99.57
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.56
KOG0486|consensus 351 99.48
KOG0844|consensus 408 99.47
KOG0847|consensus288 99.4
KOG0490|consensus235 99.23
KOG0775|consensus304 99.08
KOG0849|consensus354 99.05
KOG0774|consensus334 99.05
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.6
KOG2252|consensus558 98.43
KOG0490|consensus235 98.12
KOG1146|consensus 1406 97.48
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.11
KOG0773|consensus342 97.04
KOG3623|consensus 1007 95.49
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.83
>KOG0488|consensus Back     alignment and domain information 
Probab=99.77  E-value=1.9e-19  Score=145.64  Aligned_cols=70  Identities=41%  Similarity=0.636  Sum_probs=63.5

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHhCCCcccceeeeccchhhHHHhHHHHHHHH
Q psy16978         35 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN  104 (154)
Q Consensus        35 ~~~~rr~R~~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrRak~kr~~~~~~~~~  104 (154)
                      ..++|+.||.||..|+..||+.|++.+|.+..+|.+||..|||+..||++||||||+||||......+..
T Consensus       169 pkK~RksRTaFT~~Ql~~LEkrF~~QKYLS~~DR~~LA~~LgLTdaQVKtWfQNRRtKWKrq~a~g~~~~  238 (309)
T KOG0488|consen  169 PKKRRKSRTAFSDHQLFELEKRFEKQKYLSVADRIELAASLGLTDAQVKTWFQNRRTKWKRQTAEGGELL  238 (309)
T ss_pred             CcccccchhhhhHHHHHHHHHHHHHhhcccHHHHHHHHHHcCCchhhHHHHHhhhhHHHHHHHHhhhccc
Confidence            3567788999999999999999999999999999999999999999999999999999999776644333

>KOG0843|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-28
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-26
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 8e-26
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 8e-26
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-23
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 8e-23
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 9e-23
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 2e-17
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-16
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 6e-16
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-14
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 2e-13
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 2e-11
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 1e-10
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 9e-10
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 1e-09
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 2e-09
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 3e-09
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-09
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 3e-09
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 3e-09
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 5e-09
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 7e-09
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 8e-09
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 2e-08
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 2e-08
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 4e-08
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 4e-08
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 5e-08
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 5e-08
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 8e-08
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 1e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 1e-07
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 2e-07
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-07
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 5e-07
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-07
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 8e-07
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-06
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 2e-06
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-06
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 4e-06
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 8e-06
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 1e-05
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 1e-05
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 1e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 1e-04
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 8e-04
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 9e-04
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/69 (85%), Positives = 64/69 (92%), Gaps = 1/69 (1%)
Query: 31 SGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 90
          +G NG  RRRGRQTYTR+QTLELEKEFH NHYLTRRRRIE+AHAL LTERQIKIWFQNRR
Sbjct: 14 AGTNGL-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRR 72
Query: 91 MKLKKELRA 99
          MKLKKE++A
Sbjct: 73 MKLKKEIQA 81
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 7e-39
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-38
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 9e-38
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-35
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-35
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 5e-35
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-34
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-34
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-33
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-33
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-32
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 6e-32
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 8e-32
3a01_A93 Homeodomain-containing protein; homeodomain, prote 5e-31
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 5e-28
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 8e-25
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-24
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-24
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-24
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-23
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-23
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-22
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-22
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-20
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-20
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-17
2xsd_C164 POU domain, class 3, transcription factor 1; trans 8e-17
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-16
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-15
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-14
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-13
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-13
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-13
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 9e-13
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-12
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-12
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-12
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-12
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 8e-12
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-11
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-11
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 5e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 6e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 7e-10
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-08
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-05
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-05
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 6e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-04
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
 Score =  126 bits (318), Expect = 7e-39
 Identities = 40/71 (56%), Positives = 44/71 (61%)

Query: 29 KQSGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQN 88
          K S P        R  +T  Q  ELEKEFHFN YL+R RR+EIA  L L E Q+KIWFQN
Sbjct: 25 KVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQN 84

Query: 89 RRMKLKKELRA 99
          RRMK KK  R 
Sbjct: 85 RRMKQKKRERE 95
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.83
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.82
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.82
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.82
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.82
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.82
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.82
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.82
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.81
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.81
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.81
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.81
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.81
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.81
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.81
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.81
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.8
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.8
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.8
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.8
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.8
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.8
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.8
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.8
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.8
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.79
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.79
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.79
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.79
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.79
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.79
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.79
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.79
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.79
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.78
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.78
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.78
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.78
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.78
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.77
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.77
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.77
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.77
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.77
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.77
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.77
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.77
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.77
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.77
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.76
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.76
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.75
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.75
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.74
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.74
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.74
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.74
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.73
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.73
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.72
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.72
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.71
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.71
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.71
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.68
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.68
2e19_A64 Transcription factor 8; homeobox domain, structura 99.67
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.67
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.66
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.6
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.51
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.47
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.46
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.43
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.31
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.84
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.57
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.83  E-value=5.2e-21  Score=125.47  Aligned_cols=66  Identities=36%  Similarity=0.588  Sum_probs=61.3

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHhCCCcccceeeeccchhhHHHhHHH
Q psy16978         34 NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA   99 (154)
Q Consensus        34 ~~~~~rr~R~~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrRak~kr~~~~   99 (154)
                      .+...++.|+.|+..|+..|+..|..++||+..++..||..+||++.+|++||||||+|+|+..+.
T Consensus         3 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~   68 (80)
T 2cue_A            3 SGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKL   68 (80)
T ss_dssp             SCCSSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhh
Confidence            456778999999999999999999999999999999999999999999999999999999986543
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 9e-21
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-20
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-20
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-19
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 9e-19
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-18
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-17
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-16
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 9e-16
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 1e-15
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-15
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-15
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 7e-15
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-14
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-14
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-14
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-14
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 5e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-12
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 4e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 9e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-08
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 78.7 bits (194), Expect = 9e-21
 Identities = 41/68 (60%), Positives = 49/68 (72%)

Query: 31 SGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 90
          +  +    R+ R  YT+ QTLELEKEF FN YLTR RR E+A  L LTERQ+KIWFQNRR
Sbjct: 6  NWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRR 65

Query: 91 MKLKKELR 98
          MK+KK  +
Sbjct: 66 MKMKKINK 73
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.85
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.85
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.85
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.85
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.84
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.84
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.84
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.84
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.83
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.83
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.83
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.82
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.82
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.81
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.81
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.8
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.79
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.79
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.79
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.79
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.78
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.77
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.73
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.72
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.7
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.68
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.67
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.65
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.62
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.6
d1hlva166 DNA-binding domain of centromere binding protein B 91.75
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=8.3e-23  Score=124.72  Aligned_cols=57  Identities=49%  Similarity=0.782  Sum_probs=55.0

Q ss_pred             CCCCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHhCCCcccceeeeccchhhHHH
Q psy16978         39 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK   95 (154)
Q Consensus        39 rr~R~~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrRak~kr   95 (154)
                      |+.|+.||..|+.+|+..|..++||+..++.+||..+||++.+|++||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            677899999999999999999999999999999999999999999999999999875
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure