Psyllid ID: psy17050


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MAFHKPTASAARPAASKGPPASPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHEGDGFPDTDDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccc
ccccEEEccccccccccEccccccccccccccccEccccHHHEEEcccccccccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccccccccEccccHHHHHHHHccccccccccccccccccEccccccEEccccccccccccccccccccccHccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccccccccEEEccHccEEEEEEcc
mafhkptasaarpaaskgppaspashmcedcgeEYWDRQSLLVHKARHDvirtergrifpchdcgktfnsrssQQIHQRIhtgerpyscrYCYKAfadggtlrkhervhtgekpyvcpicskaFNQRVVLREHirahhsgpeskgattfeckvcgcmlssspeLCQHLVQHsdentaknrvvptaprkykrrrkllphegdgfpdtdddeeasasksapadgtdtkpsasllqpprkptpeydREFLEWEMKVGInsmdkaaspvktktkvrfaavrppafhckmlrlldcldvv
mafhkptasaarpaaskgppaspASHMCEDCGEEYWDRQSLLVHKARHDvirtergrifpCHDCGKtfnsrssqQIHQRihtgerpyscRYCYKAFADGGTLRKHERVhtgekpyvcpicSKAFNQRVVLREHIRahhsgpeskgattFECKVCGCMLSSSPELCQHLVqhsdentaknrvvptaprkykrrrkllphegdgfpdtdddeEASASksapadgtdtkpsasllqpprkptPEYDREFLEWEMKVGInsmdkaaspvktktkvrfaavrppafhckmlrlldcldvv
MAFHKPTasaarpaaskgppaspasHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPrkykrrrkLLPHEGDGFPDTDDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
***************************CEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNS****QIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAH*******GATTFECKVCGCMLSSSPELCQHL*****************************************************************************FLEWEMKVGIN*********KTKTKVRFAAVRPPAFHCKMLRLLDCLD**
MAFHKPTASAARPAASKGPPASPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHEGDGFPDTDDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
***************************CEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTF*************TGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRA**********TTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHEGDGF************************************PEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
MAFHKPTASAARPAASKGPPASPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHEGDGFPDTDDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFHKPTASAARPAASKGPPASPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHEGDGFPDTDDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVKTKTKVRFAAVRPPAFHCKMLRLLDCLDVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q96NG8517 Zinc finger protein 582 O yes N/A 0.518 0.295 0.373 1e-25
Q05481 1191 Zinc finger protein 91 OS no N/A 0.542 0.134 0.385 2e-25
Q6ECI4717 Zinc finger protein 470 O no N/A 0.457 0.188 0.452 4e-25
P17036446 Zinc finger protein 3 OS= no N/A 0.464 0.307 0.418 5e-25
Q9Y2H8683 Zinc finger protein 510 O no N/A 0.538 0.232 0.365 5e-25
Q8IYB9648 Zinc finger protein 595 O no N/A 0.467 0.212 0.402 1e-24
Q8BLB0 497 Zinc finger protein 3 OS= no N/A 0.498 0.295 0.393 1e-24
P10076 861 Zinc finger protein 26 OS no N/A 0.461 0.157 0.428 2e-24
Q9NW07568 Zinc finger protein 358 O no N/A 0.457 0.237 0.391 2e-24
P18715337 Gastrula zinc finger prot N/A N/A 0.532 0.465 0.348 2e-24
>sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 94/174 (54%), Gaps = 21/174 (12%)

Query: 26  HMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGER 85
           + C++CG+ +  R  L+    +H  + T R +++ C +CGK FN  S+   HQRIHTGE+
Sbjct: 311 YACKECGKTFSHRSQLI----QHQTVHTGR-KLYECKECGKAFNQGSTLIRHQRIHTGEK 365

Query: 86  PYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKG 145
           PY C+ C KAF     L++H+R+HTGEKPY C +C +AF +   L  H R H       G
Sbjct: 366 PYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIH------TG 419

Query: 146 ATTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKLLPHE 199
              +ECK CG   S   +L  H V H+++           P +YK   K L H+
Sbjct: 420 EKPYECKECGKAFSHCSQLIHHQVIHTEKK----------PYEYKECEKTLSHD 463




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 Back     alignment and function description
>sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 Back     alignment and function description
>sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 Back     alignment and function description
>sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
328717225 1011 PREDICTED: zinc finger protein 569-like 0.572 0.167 0.681 7e-65
195444404 1328 GK11348 [Drosophila willistoni] gi|19416 0.664 0.147 0.616 1e-62
195390775 1308 GJ23014 [Drosophila virilis] gi|19415212 0.637 0.143 0.638 6e-62
195060921 1320 GH14127 [Drosophila grimshawi] gi|193891 0.583 0.130 0.668 3e-61
195501570 1282 GE26438 [Drosophila yakuba] gi|194183951 0.583 0.134 0.662 3e-61
195113295 1303 GI10657 [Drosophila mojavensis] gi|19391 0.583 0.132 0.662 3e-61
194900800 1281 GG21197 [Drosophila erecta] gi|190651646 0.583 0.134 0.657 3e-60
194740894 1290 GF17472 [Drosophila ananassae] gi|190625 0.583 0.133 0.657 3e-60
24646860 1283 CG7987, isoform A [Drosophila melanogast 0.789 0.181 0.511 5e-60
20151899 897 SD01232p [Drosophila melanogaster] 0.783 0.257 0.511 7e-60
>gi|328717225|ref|XP_001945030.2| PREDICTED: zinc finger protein 569-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  253 bits (646), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 137/176 (77%), Gaps = 7/176 (3%)

Query: 27  MCEDCGEEYWDRQSLLVHKARH-DVIRTERG----RIFPCHDCGKTFNSRSSQQIHQRIH 81
           +C+ CGEE  D+++L+ HKA H + +   R     +IFPC  CGK F SRSSQQIH RIH
Sbjct: 555 VCDICGEELADKRALINHKASHSNTVSISRNSLTEKIFPCTSCGKVFGSRSSQQIHIRIH 614

Query: 82  TGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGP 141
           TGERPY CRYC KAFADGGTLRKHER+HTGEKPY CP+C KAFNQRVVLREHIRAHH+G 
Sbjct: 615 TGERPYGCRYCNKAFADGGTLRKHERIHTGEKPYACPVCPKAFNQRVVLREHIRAHHAGT 674

Query: 142 ESKGATT--FECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPRKYKRRRKL 195
           E+KG     +ECKVCG +  SS ELC HLVQHSDENT ++RVVP  PRKYKRR KL
Sbjct: 675 EAKGGQVNFYECKVCGYLFRSSMELCSHLVQHSDENTKRSRVVPVGPRKYKRRSKL 730




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195444404|ref|XP_002069851.1| GK11348 [Drosophila willistoni] gi|194165936|gb|EDW80837.1| GK11348 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195390775|ref|XP_002054043.1| GJ23014 [Drosophila virilis] gi|194152129|gb|EDW67563.1| GJ23014 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195060921|ref|XP_001995887.1| GH14127 [Drosophila grimshawi] gi|193891679|gb|EDV90545.1| GH14127 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195501570|ref|XP_002097850.1| GE26438 [Drosophila yakuba] gi|194183951|gb|EDW97562.1| GE26438 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195113295|ref|XP_002001203.1| GI10657 [Drosophila mojavensis] gi|193917797|gb|EDW16664.1| GI10657 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194900800|ref|XP_001979943.1| GG21197 [Drosophila erecta] gi|190651646|gb|EDV48901.1| GG21197 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194740894|ref|XP_001952925.1| GF17472 [Drosophila ananassae] gi|190625984|gb|EDV41508.1| GF17472 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|24646860|ref|NP_650375.1| CG7987, isoform A [Drosophila melanogaster] gi|24646862|ref|NP_731922.1| CG7987, isoform B [Drosophila melanogaster] gi|7299899|gb|AAF55074.1| CG7987, isoform B [Drosophila melanogaster] gi|7299900|gb|AAF55075.1| CG7987, isoform A [Drosophila melanogaster] gi|85857512|gb|ABC86292.1| LD24322p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|20151899|gb|AAM11309.1| SD01232p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
FB|FBgn0038244 1283 CG7987 [Drosophila melanogaste 0.803 0.184 0.484 5.7e-54
UNIPROTKB|F1RJG7452 ZNF582 "Uncharacterized protei 0.467 0.305 0.416 2.7e-29
UNIPROTKB|J9NXG2517 ZNF582 "Uncharacterized protei 0.467 0.266 0.409 1.7e-28
UNIPROTKB|F1M5S6308 F1M5S6 "Uncharacterized protei 0.477 0.457 0.435 3.1e-28
UNIPROTKB|F1MFQ5517 ZNF582 "Uncharacterized protei 0.467 0.266 0.402 4.9e-28
UNIPROTKB|Q6ECI4717 ZNF470 "Zinc finger protein 47 0.457 0.188 0.452 6e-28
UNIPROTKB|Q96NG8517 ZNF582 "Zinc finger protein 58 0.467 0.266 0.402 8.3e-28
UNIPROTKB|J9P731602 ZNF470 "Uncharacterized protei 0.461 0.225 0.448 9.7e-28
UNIPROTKB|J9P7X7680 ZNF510 "Uncharacterized protei 0.471 0.204 0.414 1.1e-27
UNIPROTKB|I3LFP7434 I3LFP7 "Uncharacterized protei 0.457 0.311 0.418 1.3e-27
FB|FBgn0038244 CG7987 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 569 (205.4 bits), Expect = 5.7e-54, P = 5.7e-54
 Identities = 123/254 (48%), Positives = 153/254 (60%)

Query:    27 MCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERP 86
             +CE C EE+ D ++L  H+  H    T  G++FPC +CGKTF SRSSQQIH RIHTGERP
Sbjct:   588 VCEVCQEEFPDGRTLSNHRHSHST--TTPGKLFPCLECGKTFGSRSSQQIHVRIHTGERP 645

Query:    87 YSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGA 146
             Y CRYC+KAFADGGTLRKHER+HTGEKPY C +C +AFNQRVVLREHIR+HHSG +    
Sbjct:   646 YGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDV-AR 704

Query:   147 TTFECKVCGCMLSSSPELCQHLVQHSDENTAKNRVVPTAPXXXXXXXXLLPHEGDGFPDT 206
              T+ C VC   L+SS +L QHL+QHSD NTAK R   T P        L PHE       
Sbjct:   705 NTYHCTVCSEDLASSNDLIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAA 764

Query:   207 DDDEEASASKSAPADGTDTKPSASLLQPPRKPTPEYDREFLEWEMKVGINSMDKAASPVK 266
             +        + A  +G D +  AS            D +F +++++   +  D A SP K
Sbjct:   765 NKHVNGD-EEEAIGEG-DAEECAS------------DIDFCDFDVENVDDIFDMAESPKK 810

Query:   267 TKTKVRFAAVRPPA 280
              K K   AA +  A
Sbjct:   811 EKRKRGSAATKADA 824


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|F1RJG7 ZNF582 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXG2 ZNF582 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5S6 F1M5S6 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFQ5 ZNF582 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ECI4 ZNF470 "Zinc finger protein 470" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96NG8 ZNF582 "Zinc finger protein 582" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P731 ZNF470 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7X7 ZNF510 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFP7 I3LFP7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 2e-06
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
PHA00733128 PHA00733, PHA00733, hypothetical protein 0.004
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 42.8 bits (101), Expect = 2e-06
 Identities = 16/25 (64%), Positives = 20/25 (80%)

Query: 102 LRKHERVHTGEKPYVCPICSKAFNQ 126
           LR+H R HTGEKPY CP+C K+F+ 
Sbjct: 2   LRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|177301 PHA00733, PHA00733, hypothetical protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
KOG2462|consensus279 99.96
KOG2462|consensus279 99.95
KOG1074|consensus 958 99.89
KOG3608|consensus467 99.86
KOG3623|consensus1007 99.85
KOG3608|consensus467 99.83
KOG1074|consensus 958 99.81
KOG3576|consensus267 99.79
KOG3576|consensus267 99.78
KOG3623|consensus 1007 99.59
PLN03086567 PRLI-interacting factor K; Provisional 99.36
PLN03086567 PRLI-interacting factor K; Provisional 99.36
PHA00733128 hypothetical protein 99.19
PHA00733128 hypothetical protein 99.15
KOG3993|consensus500 99.05
KOG3993|consensus500 98.97
PHA0276855 hypothetical protein; Provisional 98.82
PHA0276855 hypothetical protein; Provisional 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.54
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.5
PHA0061644 hypothetical protein 98.37
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.37
PHA0073279 hypothetical protein 98.3
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.27
PHA0073279 hypothetical protein 98.25
PHA0061644 hypothetical protein 98.25
COG5189423 SFP1 Putative transcriptional repressor regulating 98.02
KOG2231|consensus 669 97.94
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.9
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.85
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.85
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.76
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.74
COG5189423 SFP1 Putative transcriptional repressor regulating 97.7
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.68
KOG2231|consensus 669 97.68
COG5236493 Uncharacterized conserved protein, contains RING Z 97.56
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.55
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.45
KOG1146|consensus 1406 97.43
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.09
KOG2482|consensus423 96.96
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.9
KOG4173|consensus253 96.89
smart0035526 ZnF_C2H2 zinc finger. 96.85
COG5236493 Uncharacterized conserved protein, contains RING Z 96.79
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.78
smart0035526 ZnF_C2H2 zinc finger. 96.72
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.61
KOG2482|consensus423 96.6
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.55
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.53
KOG2785|consensus390 96.5
KOG2785|consensus390 96.19
COG5048467 FOG: Zn-finger [General function prediction only] 96.02
PRK04860160 hypothetical protein; Provisional 95.99
COG5048467 FOG: Zn-finger [General function prediction only] 95.97
KOG1146|consensus 1406 95.92
PRK04860160 hypothetical protein; Provisional 95.68
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.66
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.58
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 95.39
KOG2893|consensus341 94.87
KOG2893|consensus 341 94.85
KOG4173|consensus253 94.4
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.94
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.87
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.5
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.36
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.06
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.77
COG404965 Uncharacterized protein containing archaeal-type C 92.69
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.03
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 91.56
COG404965 Uncharacterized protein containing archaeal-type C 90.7
KOG2186|consensus276 89.22
KOG2186|consensus276 88.76
KOG4124|consensus442 88.35
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.12
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.04
KOG4124|consensus442 85.79
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 85.72
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 84.9
KOG4167|consensus907 84.63
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.68
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.08
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.71
PF1371937 zinc_ribbon_5: zinc-ribbon domain 81.22
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 80.69
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.03
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=9.2e-31  Score=210.90  Aligned_cols=139  Identities=35%  Similarity=0.685  Sum_probs=125.6

Q ss_pred             CCCceecccchhhccCHHHHHHHHHhcccccCCCCccccccccccccCChHHHHHHHHHhcCCCCcccccchhccCChHh
Q psy17050         22 SPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGT  101 (295)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  101 (295)
                      ....|+|+.||+.+.+...|..|.+.|....  ..+.+.|.+|++.|.+...|+.|+++|+  .+++|.+||+.|...+.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~--s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWL  202 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLD--SKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWL  202 (279)
T ss_pred             cCCceeccccccccccccccchhhccccccc--ccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHH
Confidence            4567999999999999999999999997554  4678899999999999999999999997  56899999999999999


Q ss_pred             HHHHHHHhCCCCcccCcchhhhcCCHHHHHHHHHHhcCCCCCCCCcceecCcCccccCCHHHHHHHHhh
Q psy17050        102 LRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQ  170 (295)
Q Consensus       102 L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~  170 (295)
                      |+-|+++|+|||||.|+.|+++|.++++|+.||++|-      +.+.|+|..|+|.|...+.|.+|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS------~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHS------DVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhc------CCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999999999999999996      88899999999999999999999754



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG4124|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG4124|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-22
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-13
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 5e-15
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-12
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-04
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 7e-12
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-12
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 8e-12
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-10
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-11
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-09
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-11
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-11
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 9e-11
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-10
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-09
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-06
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-09
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 6e-09
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-09
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-09
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-08
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 4e-07
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 6e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-06
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2en9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 2e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 2e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 3e-04
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-04
2enh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 6e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 7e-04
2lvr_A30 Solution Structure Of Miz-1 Zinc Finger 8 Length = 8e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 103 bits (257), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 57/153 (37%), Positives = 85/153 (55%), Gaps = 13/153 (8%) Query: 26 HMCEDCGEEYWDRQSLLVHKARHDVIRTERG-RIFPCHDCGKTFNSRSSQQIHQRIHTGE 84 + C +CG+ + D++ L H+ RT G + + C +CGK+F+ R++ + HQR HTGE Sbjct: 50 YKCPECGKSFSDKKDLTRHQ------RTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGE 103 Query: 85 RPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESK 144 +PY+C C K+F+ LR H+R HTGEKPY CP C K+F++ L H R H Sbjct: 104 KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTH------T 157 Query: 145 GATTFECKVCGCMLSSSPELCQHLVQHSDENTA 177 G ++C CG S L H H+ + T+ Sbjct: 158 GEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS 190
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EN9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 415- 447) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2ENH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 556- 588) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2LVR|A Chain A, Solution Structure Of Miz-1 Zinc Finger 8 Length = 30 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-37
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-34
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-24
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-34
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-34
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-23
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-34
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-31
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-33
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-32
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-32
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-31
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-28
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-16
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-28
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-27
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-24
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-27
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-27
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-26
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-26
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-26
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-24
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-22
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-18
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-18
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-18
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-18
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-18
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-18
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-18
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-18
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-18
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-18
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-18
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-18
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-18
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-18
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-17
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-17
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-17
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-17
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-17
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-17
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-17
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-17
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-17
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-17
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-17
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-17
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-17
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-17
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-17
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-17
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-17
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-17
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-17
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-17
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-17
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-17
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-17
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-17
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-17
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-16
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-16
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-16
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-15
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-14
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-14
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-13
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-13
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-07
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 8e-07
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 2e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 7e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 1e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  128 bits (325), Expect = 8e-37
 Identities = 55/153 (35%), Positives = 73/153 (47%), Gaps = 23/153 (15%)

Query: 28  CEDCGEEYWDRQSLLVHKARHDVIRTERGRI------FPCHDCGKTFNSRSSQQIHQRIH 81
           C +CG+ +     L  H+           R       + C +CGK+F+ +     HQR H
Sbjct: 24  CPECGKSFSRSDHLAEHQ-----------RTHTGEKPYKCPECGKSFSDKKDLTRHQRTH 72

Query: 82  TGERPYSCRYCYKAFADGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGP 141
           TGE+PY C  C K+F+    LR H+R HTGEKPY CP C K+F+Q   LR H R H    
Sbjct: 73  TGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTH---- 128

Query: 142 ESKGATTFECKVCGCMLSSSPELCQHLVQHSDE 174
              G   ++C  CG   S    L  H   H+ E
Sbjct: 129 --TGEKPYKCPECGKSFSREDNLHTHQRTHTGE 159


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.64
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.61
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.58
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.56
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.45
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.42
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.34
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.34
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.34
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.32
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.32
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.2
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.93
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.92
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.9
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.89
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.87
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.87
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.86
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.85
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.83
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.83
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.81
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.81
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.8
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.78
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.75
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.72
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.72
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.71
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.63
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.62
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.5
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.5
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.49
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.45
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.44
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.44
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.39
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.32
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.27
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.26
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.21
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.18
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.13
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.12
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.12
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.12
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.11
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.1
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.1
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.09
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.09
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.09
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.08
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.07
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.07
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.06
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.04
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.04
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.04
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.01
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.0
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.0
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.0
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.98
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.98
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.97
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.97
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.96
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.2
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.96
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.96
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.95
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.94
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.94
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.16
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.14
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.12
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.11
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.02
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.81
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.78
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.77
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.7
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.69
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.66
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.58
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.76
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.58
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.55
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.61
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.54
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.42
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.89
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.22
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 92.06
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.36
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.04
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 88.84
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.24
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 87.67
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 86.86
2k5c_A95 Uncharacterized protein PF0385; structural genomic 86.77
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.63
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 85.17
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 85.08
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 83.84
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 83.14
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.08
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 82.08
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 81.42
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 80.03
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.2e-36  Score=243.59  Aligned_cols=174  Identities=34%  Similarity=0.703  Sum_probs=146.2

Q ss_pred             CCCCCCCceecccchhhccCHHHHHHHHHhcccccCCCCccccccccccccCChHHHHHHHHHhcCCCCcccccchhccC
Q psy17050         18 GPPASPASHMCEDCGEEYWDRQSLLVHKARHDVIRTERGRIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFA   97 (295)
Q Consensus        18 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   97 (295)
                      ....++++|.|..|++.|.+...|..|++.|+     +.++|.|..|++.|.+...|..|++.|+++++|.|.+|++.|.
T Consensus        14 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-----~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   88 (190)
T 2i13_A           14 ALEPGEKPYACPECGKSFSRSDHLAEHQRTHT-----GEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFS   88 (190)
T ss_dssp             -----------------CCSSHHHHHGGGCC--------CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEES
T ss_pred             hhcCCCCCCcCCCCccccCCHHHHHHHHHHcC-----CCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccC
Confidence            34566789999999999999999999999985     6789999999999999999999999999999999999999999


Q ss_pred             ChHhHHHHHHHhCCCCcccCcchhhhcCCHHHHHHHHHHhcCCCCCCCCcceecCcCccccCCHHHHHHHHhhccCCCCc
Q psy17050         98 DGGTLRKHERVHTGEKPYVCPICSKAFNQRVVLREHIRAHHSGPESKGATTFECKVCGCMLSSSPELCQHLVQHSDENTA  177 (295)
Q Consensus        98 ~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~  177 (295)
                      +...|..|++.|+++++|.|.+|++.|.+...|..|++.|+      ++++|.|.+|++.|.+...|..|+++|+++.  
T Consensus        89 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~------~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~--  160 (190)
T 2i13_A           89 QRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHT------GEKPYKCPECGKSFSREDNLHTHQRTHTGEK--  160 (190)
T ss_dssp             CHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHH------CCCCEECTTTCCEESCHHHHHHHHHHHHCCC--
T ss_pred             CHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhC------CCCCeECCCCCcccCCHHHHHHHHHhcCCCC--
Confidence            99999999999999999999999999999999999999997      7899999999999999999999999999874  


Q ss_pred             CCCCCCCCccchhhhhccCCCCCCCCCC
Q psy17050        178 KNRVVPTAPRKYKRRRKLLPHEGDGFPD  205 (295)
Q Consensus       178 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~  205 (295)
                       .+.|+.|++.|..+..|..|++.|+.+
T Consensus       161 -~~~C~~C~~~f~~~~~L~~H~~~H~~~  187 (190)
T 2i13_A          161 -PYKCPECGKSFSRRDALNVHQRTHTGK  187 (190)
T ss_dssp             -CEECTTTCCEESSHHHHHHHHTTC---
T ss_pred             -CeECCCCCCccCCHHHHHHHHHhcCCC
Confidence             577999999999999999999998754



>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-12
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-10
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-08
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 6e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.003
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 8e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 6e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.5 bits (137), Expect = 8e-12
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 80  IHTGERPYSCRYCYKAFADGGTLRKHERVHTGE 112
           IH+GE+PY C  C KAF+    L +H+RVHTGE
Sbjct: 1   IHSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.58
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.57
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.05
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.99
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.96
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.94
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.93
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.93
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.88
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.86
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.83
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.83
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.83
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.82
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.82
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.77
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.72
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.67
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.62
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.56
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.56
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.46
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.46
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.44
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.37
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.21
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.19
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.11
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.06
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.84
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.82
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.68
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.63
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.6
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.57
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.53
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.5
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.49
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.45
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.39
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.39
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.32
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.26
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.21
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.18
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.18
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.17
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.14
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.1
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.07
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.99
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.87
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.81
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.78
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.78
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.77
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.63
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.55
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.46
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.39
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.36
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.34
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.31
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.93
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.77
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.75
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.71
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.69
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.52
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.47
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.43
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.41
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.4
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.31
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.13
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.11
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.78
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.63
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.01
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.78
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.74
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.72
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.61
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.52
d1y0jb136 U-shaped transcription factor, different fingers { 92.66
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.32
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.96
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.69
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.65
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.43
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.38
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.85
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 90.66
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.14
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.77
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.37
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.84
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 88.6
d1y0jb136 U-shaped transcription factor, different fingers { 88.42
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.92
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.22
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 84.69
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.87
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.55
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.11
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 80.49
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.58  E-value=5.3e-16  Score=95.32  Aligned_cols=52  Identities=38%  Similarity=0.894  Sum_probs=26.9

Q ss_pred             ccccccccccccCChHHHHHHHHHhcCCCCcccccchhccCChHhHHHHHHHh
Q psy17050         57 RIFPCHDCGKTFNSRSSQQIHQRIHTGERPYSCRYCYKAFADGGTLRKHERVH  109 (295)
Q Consensus        57 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  109 (295)
                      ++|+|. ||+.|.....|..|+++|+++++|.|.+|++.|.....|..|+++|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            445552 5555555555555555555555555555555555555555555443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure