Psyllid ID: psy17062

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MSEQWRTSKSSRTRTEQNQMLIDDQTNTSPDIGPKKKSKSKYWDWVSSSSDEEEKEENHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKSKSKYWDWVSSSSDEEEKEENHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccEEEEccccHHHHHHHHHHHHHcccccccHHHHHHHcccccccHHHHHHHcccHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHHHHccc
ccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEccEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEEcHHHHHHcccccEEEEccccccccccEEEEEEEEccccccHHccccHHHHHcccEEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccc
mseqwrtskssrtRTEQNQmliddqtntspdigpkkkskskywdwvssssdeeekeenhvigkldtapvenlrprslkstkksqhatpsshkpnvstpssikktvtltptlpkrltapltpstplQLARESlhlsrvpeslpcreAEFQSIHRFLLSKisqsttgcmyisgvpgtgktATVHAVMRKLKQEIGDKFVYVEMnalsipepkRAYSRILELLlnvdappeQAKAMLErhftrphgpcvllIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIAntmdlpertlkgkvssrmgltrlmfkpydhhQLQEIVQNRlknnncfhpdAVQLVarlepptsrseifcanhytnekkskskywdwvssssdeeekeenhvigkldtapvenlrprslkstkksqhatpsshkpnvstpssikktvtltptlpkrltapltpstplQLARESlhlsrvpeslpcreAEFQSIHRFLLSKisqsttgcmyisgvpgtgktATVHAVMRKLKQEIGDKF
mseqwrtskssrtrteqnqmliddqtntspdigpkkkskskywDWVSsssdeeekeenhvigkldtapvenlrpRSLKstkksqhatpsshkpnvstpssikKTVTltptlpkrltapltpsTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIAntmdlpertlkgkvssrmGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCAnhytnekkskskYWDWVSSSSDeeekeenhvigkldtapvenlrpRSLKstkksqhatpsshkpnvstpssikKTVTltptlpkrltapltpsTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF
MSEQWRTSKSSRTRTEQNQMLIDDQTNTSPDIGPKKKSKSKYWDWVssssdeeekeeNHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIkktvtltptlpkrltapltpSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKSKSKYWDWVssssdeeekeeNHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIkktvtltptlpkrltapltpSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF
**********************************************************************************************************************************************CREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPP**AKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEP***RSEIFCANHYTN******KYWDWV************************************************************************************************CREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVM***********
*******************************************************************************************************************************ARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKSKSKYWDWVSSSSDEEEKEENHVIGKLDTAPVENLRPRSLKSTKKS*********************VTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQ******
****************QNQMLIDDQTNTSP*****************************VIGKLDTAPVENLRPR*************************IKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNE************************VIGKLDTAPVENLRPR*************************IKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF
***********************************************************************************************************TPT**********PSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKSKSKYWDWVSSSSDEEEKEE*****************************************************************TPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEQWRTSKSSRTRTEQNQMLIDDQTNTSPDIGPKKKSKSKYWDWVSSSSDEEEKEENHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKSKSKYWDWVSSSSDEEEKEENHVIGKLDTAPVENLRPRSLKSTKKSQHATPSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query520 2.2.26 [Sep-21-2011]
O16810924 Origin recognition comple yes N/A 0.45 0.253 0.530 4e-66
Q13415861 Origin recognition comple yes N/A 0.546 0.329 0.455 5e-53
Q9JI69850 Origin recognition comple yes N/A 0.478 0.292 0.476 2e-52
Q58DC8863 Origin recognition comple yes N/A 0.544 0.327 0.427 7e-52
Q80Z32848 Origin recognition comple yes N/A 0.484 0.297 0.469 7e-52
Q9Z1N2840 Origin recognition comple yes N/A 0.448 0.277 0.491 2e-51
P54789707 Origin recognition comple yes N/A 0.553 0.407 0.372 1e-45
Q6BSE2810 Origin recognition comple yes N/A 0.421 0.270 0.387 1e-41
O74270805 Origin recognition comple N/A N/A 0.45 0.290 0.353 1e-36
Q54RM2631 Origin recognition comple yes N/A 0.407 0.335 0.367 1e-36
>sp|O16810|ORC1_DROME Origin recognition complex subunit 1 OS=Drosophila melanogaster GN=Orc1 PE=1 SV=2 Back     alignment and function desciption
 Score =  252 bits (644), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 167/243 (68%), Gaps = 9/243 (3%)

Query: 107 LTPTLPKRLTAPLTPST--PLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTT 164
           L+P++ +R   P   S+   LQLARE LH+S VP+SLPCRE EF++I+ FL  KI     
Sbjct: 532 LSPSMQQRTDLPAKDSSKSELQLAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCG 591

Query: 165 GCMYISGVPGTGKTATVHAVMRKL----KQEIGDKFVYVEMNALSIPEPKRAYSRILELL 220
           GCMY+SGVPGTGKTATV  V+R L    KQ     F Y+E+N + + EP++AY +I + L
Sbjct: 592 GCMYVSGVPGTGKTATVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQL 651

Query: 221 LNVDAPPEQAKAMLERHFTRP---HGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRL 277
                  EQA A+LE+ FT P       VLL+DELD LCN+RQDV+YN+L++  K  ++L
Sbjct: 652 TGKTVSWEQAHALLEKRFTTPAPRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKL 711

Query: 278 IILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQL 337
           +++ IANTMDLPER L GKV+SR+GLTRL F+PY H QLQEIV  RL  +  F  +AVQL
Sbjct: 712 VVVTIANTMDLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGEAVQL 771

Query: 338 VAR 340
           VAR
Sbjct: 772 VAR 774
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
Drosophila melanogaster (taxid: 7227)
>sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1 PE=1 SV=2 Back     alignment and function description
>sp|Q9JI69|ORC1_CRIGR Origin recognition complex subunit 1 OS=Cricetulus griseus GN=ORC1 PE=2 SV=1 Back     alignment and function description
>sp|Q58DC8|ORC1_BOVIN Origin recognition complex subunit 1 OS=Bos taurus GN=ORC1 PE=2 SV=2 Back     alignment and function description
>sp|Q80Z32|ORC1_RAT Origin recognition complex subunit 1 OS=Rattus norvegicus GN=Orc1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1N2|ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus GN=Orc1 PE=1 SV=2 Back     alignment and function description
>sp|P54789|ORC1_SCHPO Origin recognition complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc1 PE=1 SV=1 Back     alignment and function description
>sp|Q6BSE2|ORC1_DEBHA Origin recognition complex subunit 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ORC1 PE=3 SV=2 Back     alignment and function description
>sp|O74270|ORC1_CANAX Origin recognition complex subunit 1 OS=Candida albicans GN=ORC1 PE=2 SV=1 Back     alignment and function description
>sp|Q54RM2|ORC1_DICDI Origin recognition complex subunit 1 OS=Dictyostelium discoideum GN=orcA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
380016420480 PREDICTED: origin recognition complex su 0.486 0.527 0.516 3e-68
328783378531 PREDICTED: origin recognition complex su 0.505 0.495 0.501 2e-67
383860930 760 PREDICTED: origin recognition complex su 0.473 0.323 0.519 3e-66
291236785 962 PREDICTED: origin recognition complex, s 0.542 0.293 0.442 5e-65
195581242536 GD10243 [Drosophila simulans] gi|1941924 0.45 0.436 0.530 2e-64
2576416 924 origin recognition complex subunit 1 [Dr 0.45 0.253 0.530 2e-64
17137456 924 origin recognition complex subunit 1 [Dr 0.45 0.253 0.530 3e-64
194863786 913 GG10735 [Drosophila erecta] gi|190662480 0.45 0.256 0.526 4e-64
195332149 924 GM20781 [Drosophila sechellia] gi|194124 0.45 0.253 0.526 7e-64
195172790 933 GL20109 [Drosophila persimilis] gi|19411 0.45 0.250 0.522 1e-63
>gi|380016420|ref|XP_003692183.1| PREDICTED: origin recognition complex subunit 1-like [Apis florea] Back     alignment and taxonomy information
 Score =  266 bits (679), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 138/267 (51%), Positives = 182/267 (68%), Gaps = 14/267 (5%)

Query: 79  STKKSQHATPSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVP 138
           S +K+   TP SH    S          LTP+L KR  A L PSTPLQ AR  LH+S VP
Sbjct: 74  SQQKTHLNTPKSHSIKCSN---------LTPSLIKRNNALLKPSTPLQEARSRLHVSAVP 124

Query: 139 ESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIG----D 194
           +SLPCRE EF +I  FL  K+   + GC+YISGVPGTGKTATV+  +R L++ I     D
Sbjct: 125 KSLPCREEEFNNIFTFLRGKLEDKSGGCIYISGVPGTGKTATVNEAIRCLQKLILKGQLD 184

Query: 195 KFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGPC-VLLIDELD 253
            F YV +N + + EP++AY +IL+ L N  A  EQ+ ++LE+ F        +LL+DELD
Sbjct: 185 DFDYVTINGMKLTEPRQAYVQILKQLYNKTATWEQSYSILEKRFHNTTSKMTLLLVDELD 244

Query: 254 YLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDH 313
           +LC KRQDV+YN+L++  K  ++LI++ IANTMDLPER L G+V+SR+GLTRL F+PY++
Sbjct: 245 FLCTKRQDVVYNLLDWPTKSTAQLIVVTIANTMDLPERVLMGRVTSRLGLTRLTFQPYNY 304

Query: 314 HQLQEIVQNRLKNNNCFHPDAVQLVAR 340
            QLQEIV +RLKN N F  +A+QLVAR
Sbjct: 305 KQLQEIVMSRLKNFNGFRSEAIQLVAR 331

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328783378|ref|XP_392056.4| PREDICTED: origin recognition complex subunit 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383860930|ref|XP_003705940.1| PREDICTED: origin recognition complex subunit 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|291236785|ref|XP_002738319.1| PREDICTED: origin recognition complex, subunit 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|195581242|ref|XP_002080443.1| GD10243 [Drosophila simulans] gi|194192452|gb|EDX06028.1| GD10243 [Drosophila simulans] Back     alignment and taxonomy information
>gi|2576416|gb|AAC47802.1| origin recognition complex subunit 1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17137456|ref|NP_477303.1| origin recognition complex subunit 1 [Drosophila melanogaster] gi|13124778|sp|O16810.2|ORC1_DROME RecName: Full=Origin recognition complex subunit 1; Short=DmORC1 gi|7304200|gb|AAF59236.1| origin recognition complex subunit 1 [Drosophila melanogaster] gi|20151547|gb|AAM11133.1| LD11626p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194863786|ref|XP_001970613.1| GG10735 [Drosophila erecta] gi|190662480|gb|EDV59672.1| GG10735 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195332149|ref|XP_002032761.1| GM20781 [Drosophila sechellia] gi|194124731|gb|EDW46774.1| GM20781 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195172790|ref|XP_002027179.1| GL20109 [Drosophila persimilis] gi|194112992|gb|EDW35035.1| GL20109 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
FB|FBgn0022772924 Orc1 "Origin recognition compl 0.413 0.232 0.558 2.3e-57
UNIPROTKB|Q13415861 ORC1 "Origin recognition compl 0.415 0.250 0.511 3.3e-55
UNIPROTKB|Q5ZMC5858 ORC1 "Uncharacterized protein" 0.628 0.381 0.380 9.9e-54
UNIPROTKB|E2QU75863 ORC1 "Uncharacterized protein" 0.488 0.294 0.452 1.3e-53
ZFIN|ZDB-GENE-030131-6960912 orc1 "origin recognition compl 0.509 0.290 0.431 2.4e-53
UNIPROTKB|F1S6H7868 LOC100520746 "Uncharacterized 0.505 0.302 0.448 6.6e-53
UNIPROTKB|G4MNI2785 MGG_05615 "Origin recognition 0.486 0.322 0.434 1.2e-51
UNIPROTKB|Q58DC8863 ORC1 "Origin recognition compl 0.521 0.314 0.435 2.2e-51
UNIPROTKB|E1BKR3870 ORC1 "Origin recognition compl 0.521 0.311 0.435 2.4e-51
UNIPROTKB|F1LTT3833 Orc1 "Protein Orc1l" [Rattus n 0.484 0.302 0.455 2.9e-51
FB|FBgn0022772 Orc1 "Origin recognition complex subunit 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 595 (214.5 bits), Expect = 2.3e-57, P = 2.3e-57
 Identities = 125/224 (55%), Positives = 158/224 (70%)

Query:   125 LQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAV 184
             LQLARE LH+S VP+SLPCRE EF++I+ FL  KI     GCMY+SGVPGTGKTATV  V
Sbjct:   552 LQLAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCGGCMYVSGVPGTGKTATVTGV 611

Query:   185 MRKL----KQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAMLERHFTR 240
             +R L    KQ     F Y+E+N + + EP++AY +I + L       EQA A+LE+ FT 
Sbjct:   612 IRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVSWEQAHALLEKRFTT 671

Query:   241 PHGP----CVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGK 296
             P  P     VLL+DELD LCN+RQDV+YN+L++  K  ++L+++ IANTMDLPER L GK
Sbjct:   672 P-APRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMDLPERLLMGK 730

Query:   297 VSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVAR 340
             V+SR+GLTRL F+PY H QLQEIV  RL  +  F  +AVQLVAR
Sbjct:   731 VTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGEAVQLVAR 774
GO:0006261 "DNA-dependent DNA replication" evidence=ISS;NAS
GO:0005664 "nuclear origin of replication recognition complex" evidence=ISS;NAS;IDA
GO:0006270 "DNA replication initiation" evidence=IDA
GO:0005634 "nucleus" evidence=NAS
GO:0006342 "chromatin silencing" evidence=NAS
GO:0003677 "DNA binding" evidence=IEA;NAS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008283 "cell proliferation" evidence=IMP
GO:0006277 "DNA amplification" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q13415 ORC1 "Origin recognition complex subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMC5 ORC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU75 ORC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6960 orc1 "origin recognition complex, subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6H7 LOC100520746 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G4MNI2 MGG_05615 "Origin recognition complex subunit 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DC8 ORC1 "Origin recognition complex subunit 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKR3 ORC1 "Origin recognition complex subunit 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTT3 Orc1 "Protein Orc1l" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O16810ORC1_DROMENo assigned EC number0.53080.450.2532yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 1e-40
PTZ001121164 PTZ00112, PTZ00112, origin recognition complex 1 p 7e-35
TIGR02928365 TIGR02928, TIGR02928, orc1/cdc6 family replication 4e-19
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-16
PRK00411394 PRK00411, cdc6, cell division control protein 6; R 1e-15
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-13
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 1e-12
PTZ00112 1164 PTZ00112, PTZ00112, origin recognition complex 1 p 2e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-10
COG1474 366 COG1474, CDC6, Cdc6-related protein, AAA superfami 2e-09
pfam13401124 pfam13401, AAA_22, AAA domain 6e-09
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 1e-08
TIGR02928 365 TIGR02928, TIGR02928, orc1/cdc6 family replication 2e-05
PRK00411 394 PRK00411, cdc6, cell division control protein 6; R 3e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.002
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.004
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  149 bits (379), Expect = 1e-40
 Identities = 60/221 (27%), Positives = 109/221 (49%), Gaps = 12/221 (5%)

Query: 129 RESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKL 188
           ++ L    +PE LP RE E   +  FL   +       + I G  GTGKTATV  VM +L
Sbjct: 7   KDVLLEDYIPEELPHREEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATVKFVMEEL 66

Query: 189 KQEIGDKFVYVEMNALSIPEPKRAYSRILELLLNVDAPPEQAKAM-----LERHFTRPHG 243
           + E       V +N L +  P +  S+IL  L  V  P     ++     L  + ++   
Sbjct: 67  E-ESSANVEVVYINCLELRTPYQVLSKILNKLGKV--PLTGDSSLEILKRLYDNLSKKGK 123

Query: 244 PCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIANTMDLPERTLKGKVSSRMGL 303
             ++++DE+D L +K  +V+Y++L    + K ++ I+ ++N     +  L  +V S +G 
Sbjct: 124 TVIVILDEVDALVDKDGEVLYSLLRAPGENKVKVSIIAVSNDDKFLDY-LDPRVKSSLGP 182

Query: 304 TRLMFKPYDHHQLQEIVQNRLK---NNNCFHPDAVQLVARL 341
           + ++F PY   +L +I++ R++   +      D ++L+A L
Sbjct: 183 SEIVFPPYTAEELYDILRERVEEGFSAGVIDDDVLKLIAAL 223

Length = 366
>gnl|CDD|240274 PTZ00112, PTZ00112, origin recognition complex 1 protein; Provisional Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|234751 PRK00411, cdc6, cell division control protein 6; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|240274 PTZ00112, PTZ00112, origin recognition complex 1 protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|234751 PRK00411, cdc6, cell division control protein 6; Reviewed Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 520
KOG0733|consensus 802 100.0
KOG1514|consensus767 100.0
PTZ001121164 origin recognition complex 1 protein; Provisional 99.97
KOG0730|consensus 693 99.97
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.96
KOG2227|consensus529 99.95
KOG0736|consensus 953 99.95
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.95
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.95
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.94
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.94
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.94
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.93
CHL00095 821 clpC Clp protease ATP binding subunit 99.93
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.93
KOG0734|consensus752 99.92
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.91
KOG0735|consensus 952 99.9
PRK10865 857 protein disaggregation chaperone; Provisional 99.9
KOG0730|consensus693 99.89
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.87
KOG0733|consensus802 99.87
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.86
KOG0741|consensus 744 99.86
PRK03992389 proteasome-activating nucleotidase; Provisional 99.83
KOG0989|consensus346 99.83
KOG0731|consensus774 99.82
KOG0728|consensus404 99.82
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.81
KOG0738|consensus491 99.81
CHL00176638 ftsH cell division protein; Validated 99.81
KOG0727|consensus408 99.8
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.8
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.8
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.8
KOG0652|consensus424 99.79
KOG2028|consensus554 99.79
KOG0729|consensus435 99.79
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.79
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.78
CHL00195489 ycf46 Ycf46; Provisional 99.78
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.78
KOG0735|consensus952 99.78
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.77
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.77
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.77
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.77
KOG0736|consensus953 99.77
KOG0739|consensus439 99.77
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.77
KOG0737|consensus386 99.76
PLN03025319 replication factor C subunit; Provisional 99.75
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.75
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK04195 482 replication factor C large subunit; Provisional 99.75
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.74
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK13342413 recombination factor protein RarA; Reviewed 99.73
CHL00181287 cbbX CbbX; Provisional 99.72
PRK13341 725 recombination factor protein RarA/unknown domain f 99.72
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.72
KOG0991|consensus333 99.72
KOG0726|consensus440 99.71
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.71
PRK06893229 DNA replication initiation factor; Validated 99.7
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.7
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.7
KOG0732|consensus 1080 99.7
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.7
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.7
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.7
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.7
CHL00206 2281 ycf2 Ycf2; Provisional 99.69
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK08727233 hypothetical protein; Validated 99.68
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.67
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.67
KOG0740|consensus428 99.67
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.67
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.67
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK00440319 rfc replication factor C small subunit; Reviewed 99.66
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.66
PRK08084235 DNA replication initiation factor; Provisional 99.66
PRK12402337 replication factor C small subunit 2; Reviewed 99.65
PHA02544316 44 clamp loader, small subunit; Provisional 99.65
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.65
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.64
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.64
KOG0651|consensus388 99.64
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.64
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.64
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.63
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.62
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.62
PRK05642234 DNA replication initiation factor; Validated 99.62
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.61
PF00004132 AAA: ATPase family associated with various cellula 99.61
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.6
PRK14088440 dnaA chromosomal replication initiation protein; P 99.6
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.6
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.6
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.6
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.59
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.59
PRK14086617 dnaA chromosomal replication initiation protein; P 99.59
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK00149450 dnaA chromosomal replication initiation protein; R 99.59
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK14087450 dnaA chromosomal replication initiation protein; P 99.59
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.58
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.58
PRK12422445 chromosomal replication initiation protein; Provis 99.58
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.58
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.58
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.57
PRK07940394 DNA polymerase III subunit delta'; Validated 99.57
PRK09112351 DNA polymerase III subunit delta'; Validated 99.56
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.56
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.56
KOG1051|consensus 898 99.56
KOG2228|consensus408 99.56
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.55
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.54
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.54
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.54
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.54
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.54
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.53
KOG2004|consensus 906 99.53
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.52
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.52
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.51
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.51
KOG0742|consensus630 99.51
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.49
CHL00095821 clpC Clp protease ATP binding subunit 99.49
PRK04132846 replication factor C small subunit; Provisional 99.49
KOG1969|consensus 877 99.49
PRK11608326 pspF phage shock protein operon transcriptional ac 99.49
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.48
PRK06620214 hypothetical protein; Validated 99.48
PRK07471365 DNA polymerase III subunit delta'; Validated 99.48
PRK10865857 protein disaggregation chaperone; Provisional 99.48
COG2204464 AtoC Response regulator containing CheY-like recei 99.48
PRK09087226 hypothetical protein; Validated 99.47
KOG1942|consensus456 99.46
KOG0744|consensus423 99.46
KOG2035|consensus351 99.45
COG0593408 DnaA ATPase involved in DNA replication initiation 99.44
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.44
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.44
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.44
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.42
COG1221403 PspF Transcriptional regulators containing an AAA- 99.42
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 99.42
PRK05564313 DNA polymerase III subunit delta'; Validated 99.42
KOG1970|consensus 634 99.41
PRK07399314 DNA polymerase III subunit delta'; Validated 99.41
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.41
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.4
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.4
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.39
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.39
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.39
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.38
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.38
PRK05707328 DNA polymerase III subunit delta'; Validated 99.36
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.36
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.36
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.36
PRK08058329 DNA polymerase III subunit delta'; Validated 99.34
PRK15424538 propionate catabolism operon regulatory protein Pr 99.33
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.32
KOG0743|consensus457 99.32
KOG2680|consensus454 99.32
KOG0990|consensus360 99.31
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.29
CHL00195 489 ycf46 Ycf46; Provisional 99.29
KOG2543|consensus438 99.28
PRK06871325 DNA polymerase III subunit delta'; Validated 99.28
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.28
PRK07993334 DNA polymerase III subunit delta'; Validated 99.28
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.27
PRK13531498 regulatory ATPase RavA; Provisional 99.27
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 99.26
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.26
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.24
PRK08769319 DNA polymerase III subunit delta'; Validated 99.24
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.24
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.22
KOG0745|consensus564 99.2
COG0714329 MoxR-like ATPases [General function prediction onl 99.2
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.2
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.19
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.18
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.18
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.17
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.17
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.16
PHA02244383 ATPase-like protein 99.16
PRK06090319 DNA polymerase III subunit delta'; Validated 99.15
PRK15115444 response regulator GlrR; Provisional 99.15
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.13
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 99.13
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.13
PRK06964342 DNA polymerase III subunit delta'; Validated 99.13
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.11
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.11
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 99.1
KOG1051|consensus898 99.06
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.06
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.05
PF07726131 AAA_3: ATPase family associated with various cellu 99.04
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.99
PRK08116268 hypothetical protein; Validated 98.98
KOG0727|consensus 408 98.98
PF05729166 NACHT: NACHT domain 98.96
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.94
smart00382148 AAA ATPases associated with a variety of cellular 98.94
PRK12377248 putative replication protein; Provisional 98.94
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.93
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.93
PF13173128 AAA_14: AAA domain 98.92
PRK08699325 DNA polymerase III subunit delta'; Validated 98.92
KOG1968|consensus 871 98.9
KOG0741|consensus744 98.89
PRK07132299 DNA polymerase III subunit delta'; Validated 98.87
PRK06835329 DNA replication protein DnaC; Validated 98.87
PRK05917290 DNA polymerase III subunit delta'; Validated 98.86
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.86
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.86
smart00350509 MCM minichromosome maintenance proteins. 98.85
PRK07952244 DNA replication protein DnaC; Validated 98.83
PF14516331 AAA_35: AAA-like domain 98.82
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.81
PRK07276290 DNA polymerase III subunit delta'; Validated 98.81
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.78
PRK06921266 hypothetical protein; Provisional 98.78
PRK05818261 DNA polymerase III subunit delta'; Validated 98.77
PRK08181269 transposase; Validated 98.77
KOG0729|consensus 435 98.77
COG3899 849 Predicted ATPase [General function prediction only 98.77
PRK08939306 primosomal protein DnaI; Reviewed 98.77
KOG0737|consensus 386 98.75
KOG0652|consensus 424 98.75
PRK06526254 transposase; Provisional 98.73
PRK13765637 ATP-dependent protease Lon; Provisional 98.73
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.73
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.72
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 98.72
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.7
KOG0726|consensus 440 98.69
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.69
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 98.68
PTZ00202550 tuzin; Provisional 98.64
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.64
KOG0738|consensus 491 98.63
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.63
PRK04841 903 transcriptional regulator MalT; Provisional 98.63
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.62
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 98.62
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.6
PRK09183259 transposase/IS protein; Provisional 98.58
PRK03992 389 proteasome-activating nucleotidase; Provisional 98.57
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.55
KOG0728|consensus 404 98.54
KOG0731|consensus 774 98.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.54
KOG0734|consensus 752 98.53
PHA00729226 NTP-binding motif containing protein 98.52
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.52
COG0488 530 Uup ATPase components of ABC transporters with dup 98.52
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.48
KOG2170|consensus344 98.48
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 98.47
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.46
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.45
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 98.45
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 98.44
KOG0989|consensus 346 98.43
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 98.42
PRK06851367 hypothetical protein; Provisional 98.41
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 98.41
PRK09862506 putative ATP-dependent protease; Provisional 98.41
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.38
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.34
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.33
PRK09302 509 circadian clock protein KaiC; Reviewed 98.32
KOG0651|consensus 388 98.32
KOG0739|consensus 439 98.31
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 98.31
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.3
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.29
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.28
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.28
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.26
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.26
KOG0744|consensus 423 98.24
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.19
PRK00771437 signal recognition particle protein Srp54; Provisi 98.19
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.19
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.18
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.17
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.16
PRK04195 482 replication factor C large subunit; Provisional 98.15
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.15
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.15
CHL00206 2281 ycf2 Ycf2; Provisional 98.14
KOG0478|consensus804 98.13
PRK06581263 DNA polymerase III subunit delta'; Validated 98.13
PRK13695174 putative NTPase; Provisional 98.12
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 98.11
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.11
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.1
PRK04296190 thymidine kinase; Provisional 98.1
CHL00181 287 cbbX CbbX; Provisional 98.1
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 98.09
CHL00176 638 ftsH cell division protein; Validated 98.08
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.08
COG1123539 ATPase components of various ABC-type transport sy 98.07
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.07
KOG1808|consensus 1856 98.07
PLN03025 319 replication factor C subunit; Provisional 98.06
KOG0927|consensus 614 98.06
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.06
PRK11147 635 ABC transporter ATPase component; Reviewed 98.05
PHA02774613 E1; Provisional 98.05
cd01128249 rho_factor Transcription termination factor rho is 98.04
PRK13531 498 regulatory ATPase RavA; Provisional 98.03
KOG2004|consensus 906 98.03
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.02
PRK10536262 hypothetical protein; Provisional 98.01
KOG0742|consensus 630 98.01
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.0
KOG0480|consensus764 98.0
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.99
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.98
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 97.98
PRK14974336 cell division protein FtsY; Provisional 97.97
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 97.96
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.96
COG0606490 Predicted ATPase with chaperone activity [Posttran 97.96
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.94
KOG4658|consensus 889 97.93
KOG1514|consensus 767 97.93
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.92
PRK08939 306 primosomal protein DnaI; Reviewed 97.92
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.91
PRK14700300 recombination factor protein RarA; Provisional 97.91
PRK12377 248 putative replication protein; Provisional 97.91
PLN03073 718 ABC transporter F family; Provisional 97.91
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 97.91
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.91
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.9
PRK12402 337 replication factor C small subunit 2; Reviewed 97.9
PRK13342 413 recombination factor protein RarA; Reviewed 97.89
KOG0732|consensus 1080 97.89
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.89
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.89
PRK06893 229 DNA replication initiation factor; Validated 97.87
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.87
COG1485367 Predicted ATPase [General function prediction only 97.86
KOG0743|consensus 457 97.86
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.86
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 97.86
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.85
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.85
PRK13341 725 recombination factor protein RarA/unknown domain f 97.84
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.84
PRK08084 235 DNA replication initiation factor; Provisional 97.83
COG1484 254 DnaC DNA replication protein [DNA replication, rec 97.83
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.82
TIGR00767415 rho transcription termination factor Rho. Members 97.82
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.82
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.81
KOG0740|consensus 428 97.81
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.81
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.8
PRK08181 269 transposase; Validated 97.8
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.8
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.8
COG4619223 ABC-type uncharacterized transport system, ATPase 97.8
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.8
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.8
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.79
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.79
PRK06835 329 DNA replication protein DnaC; Validated 97.79
PRK08116 268 hypothetical protein; Validated 97.78
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.77
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.76
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.76
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 97.75
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.75
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.75
PHA02244 383 ATPase-like protein 97.75
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.74
PRK12608380 transcription termination factor Rho; Provisional 97.74
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.74
PRK06526 254 transposase; Provisional 97.73
KOG2028|consensus 554 97.72
PRK07952 244 DNA replication protein DnaC; Validated 97.71
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.71
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.71
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.7
PHA02544 316 44 clamp loader, small subunit; Provisional 97.7
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.7
PRK09376416 rho transcription termination factor Rho; Provisio 97.69
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.69
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.69
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.69
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.68
KOG1942|consensus 456 97.68
KOG0991|consensus 333 97.68
PRK06067234 flagellar accessory protein FlaH; Validated 97.66
COG4178604 ABC-type uncharacterized transport system, permeas 97.66
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.66
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.66
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.65
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.65
PF07034330 ORC3_N: Origin recognition complex (ORC) subunit 3 97.65
PRK15455 644 PrkA family serine protein kinase; Provisional 97.64
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.64
PRK06921 266 hypothetical protein; Provisional 97.64
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.64
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.64
COG2842297 Uncharacterized ATPase, putative transposase [Gene 97.64
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.64
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.63
KOG0482|consensus721 97.62
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.62
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.62
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.6
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.6
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.6
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.6
KOG0477|consensus854 97.6
COG0606 490 Predicted ATPase with chaperone activity [Posttran 97.59
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.59
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.59
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.59
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.59
PRK08903 227 DnaA regulatory inactivator Hda; Validated 97.59
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.58
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.58
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.58
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.57
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.57
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.57
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.57
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.56
COG0714 329 MoxR-like ATPases [General function prediction onl 97.56
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.56
KOG3347|consensus176 97.56
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.55
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.54
KOG0062|consensus 582 97.54
PRK06620 214 hypothetical protein; Validated 97.54
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.53
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.53
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.53
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.53
cd03115173 SRP The signal recognition particle (SRP) mediates 97.53
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.52
KOG3928|consensus461 97.52
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.52
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.51
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.51
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.5
PLN02674244 adenylate kinase 97.5
PRK11823446 DNA repair protein RadA; Provisional 97.5
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.49
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.49
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.48
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.48
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.48
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.48
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.48
PRK05973237 replicative DNA helicase; Provisional 97.46
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.46
PRK08727 233 hypothetical protein; Validated 97.46
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.46
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.46
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.45
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.45
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.44
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.44
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 97.44
>KOG0733|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.3e-38  Score=314.14  Aligned_cols=334  Identities=16%  Similarity=0.242  Sum_probs=227.1

Q ss_pred             CCCCCchHHHHHHHHHHHHHHhh--------cCCCCeEEEEcCCCCcHHHHHHHHHHHHHHHhCCCeEEEEEccccCCCh
Q psy17062        138 PESLPCREAEFQSIHRFLLSKIS--------QSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSIPEP  209 (520)
Q Consensus       138 p~~l~gr~~ei~~l~~~L~~~~~--------~~~~~~lLl~G~~GtGKT~la~~la~~l~~~~~~~~~~i~v~~~~~~~~  209 (520)
                      ...+-|.++.+.+|++.+.....        -.++.++|||||||||||.||+++|.++      +++|+.|++.++   
T Consensus       189 f~diGG~d~~~~el~~li~~i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel------~vPf~~isApei---  259 (802)
T KOG0733|consen  189 FSDIGGLDKTLAELCELIIHIKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGEL------GVPFLSISAPEI---  259 (802)
T ss_pred             hhhccChHHHHHHHHHHHHHhcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhc------CCceEeecchhh---
Confidence            34688999999999998876321        1467889999999999999999999999      999999999876   


Q ss_pred             HHHHHHHHHHHhcCCCChHHHHHHHHHHHcCC--CCceEEEEcCCccccccChH-----------HHHHHHHhcCCC---
Q psy17062        210 KRAYSRILELLLNVDAPPEQAKAMLERHFTRP--HGPCVLLIDELDYLCNKRQD-----------VIYNILEYLNKP---  273 (520)
Q Consensus       210 ~~~~~~i~~~l~g~~~~~~~~~~~l~~~~~~~--~~~~vLiiDEid~l~~~~~~-----------~L~~ll~~~~~~---  273 (520)
                             ++.+.|+      .++.++.+|.++  ..|||+||||||.+.+.++.           .|+..|+.+...   
T Consensus       260 -------vSGvSGE------SEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~  326 (802)
T KOG0733|consen  260 -------VSGVSGE------SEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTK  326 (802)
T ss_pred             -------hcccCcc------cHHHHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccccC
Confidence                   5677777      789999999998  88999999999999998643           356666665433   


Q ss_pred             CCcEEEEEEEcCCCCchhhhhhhhhccCCcceEEeCCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHcCCCCCCHHHHH
Q psy17062        274 KSRLIILCIANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNNCFHPDAVQLVARLEPPTSRSEIFCA  353 (520)
Q Consensus       274 ~~~v~vI~~tn~~~~~~~~l~~~l~sR~~~~~i~~~~~~~~~~~~Il~~~l~~~~~~~~~~l~~la~~~~~~~G~~r~al  353 (520)
                      ..+|+|||+||+++.++..|.  -..||. ++|.+.-|+..++.+||+..++.+....+-.++.||++++||.|....| 
T Consensus       327 g~~VlVIgATnRPDslDpaLR--RaGRFd-rEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~~qlA~lTPGfVGADL~A-  402 (802)
T KOG0733|consen  327 GDPVLVIGATNRPDSLDPALR--RAGRFD-REICLGVPSETAREEILRIICRGLRLSGDFDFKQLAKLTPGFVGADLMA-  402 (802)
T ss_pred             CCCeEEEecCCCCcccCHHHh--cccccc-ceeeecCCchHHHHHHHHHHHhhCCCCCCcCHHHHHhcCCCccchhHHH-
Confidence            467999999999998887663  347897 4599999999999999999999886666888999999999999987776 


Q ss_pred             HHHHhhhccCCCC-ceeccc-------ccch--hhhhccc--cccccc-cCCCccc--ccccccccCCc----cccc---
Q psy17062        354 NHYTNEKKSKSKY-WDWVSS-------SSDE--EEKEENH--VIGKLD-TAPVENL--RPRSLKSTKKS----QHAT---  411 (520)
Q Consensus       354 ~~l~~a~~~~~~~-~~~~a~-------~~~~--~~~~~~~--v~~a~~-~~~~~~~--~~~~~~~~~~~----~~~~---  411 (520)
                       +|..|+.-+.++ ......       ..+.  ..+.++.  +..... ....+..  -...+....++    ....   
T Consensus       403 -L~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i  481 (802)
T KOG0733|consen  403 -LCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSKELLEGLSI  481 (802)
T ss_pred             -HHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcChHHhcccee
Confidence             455554321111 000000       0000  0000000  000000 0000000  00000000000    0000   


Q ss_pred             ---CCCCCCCCCCCCCcccccccCCCCCCccCCCCCCCChHHHhHhhcCCCCCCCCCCChHHHHHHHHHHHHhhhcCCCC
Q psy17062        412 ---PSSHKPNVSTPSSIKKTVTLTPTLPKRLTAPLTPSTPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTT  488 (520)
Q Consensus       412 ---~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  488 (520)
                         .+...-....|+..++.+..+|      ++.|.++++++..|..|.+.++..  +.+        .-+...++...|
T Consensus       482 ~~eDF~~Al~~iQPSakREGF~tVP------dVtW~dIGaL~~vR~eL~~aI~~P--iK~--------pd~~k~lGi~~P  545 (802)
T KOG0733|consen  482 KFEDFEEALSKIQPSAKREGFATVP------DVTWDDIGALEEVRLELNMAILAP--IKR--------PDLFKALGIDAP  545 (802)
T ss_pred             cHHHHHHHHHhcCcchhcccceecC------CCChhhcccHHHHHHHHHHHHhhh--ccC--------HHHHHHhCCCCC
Confidence               0000012344556666666666      678899999999999999866522  111        113456788899


Q ss_pred             CcEEEEcCCCCcHHHHHHHHHHHHHH
Q psy17062        489 GCMYISGVPGTGKTATVHAVMRKLKQ  514 (520)
Q Consensus       489 ~~iLLyGPpGtGKT~lAkalA~~l~~  514 (520)
                      .|||||||||||||+||||||+|-.-
T Consensus       546 sGvLL~GPPGCGKTLlAKAVANEag~  571 (802)
T KOG0733|consen  546 SGVLLCGPPGCGKTLLAKAVANEAGA  571 (802)
T ss_pred             CceEEeCCCCccHHHHHHHHhhhccC
Confidence            99999999999999999999998543

>KOG1514|consensus Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1968|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF07034 ORC3_N: Origin recognition complex (ORC) subunit 3 N-terminus; InterPro: IPR020795 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG3928|consensus Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
2v1u_A387 Structure Of The Aeropyrum Pernix Orc1 Protein In C 2e-13
2qby_A386 Crystal Structure Of A Heterodimer Of Cdc6ORC1 INIT 2e-13
2qby_A 386 Crystal Structure Of A Heterodimer Of Cdc6ORC1 INIT 6e-04
1fnn_A389 Crystal Structure Of Cdc6p From Pyrobaculum Aerophi 3e-04
>pdb|2V1U|A Chain A, Structure Of The Aeropyrum Pernix Orc1 Protein In Complex With Dna Length = 387 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 103/220 (46%), Gaps = 17/220 (7%)
Query: 137 VPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKF 196
           VP+ LP REAE + +   L   +         + G+ GTGKTA    V+R+L+       
Sbjct: 17  VPDVLPHREAELRRLAEVLAPALRGEKPSNALLYGLTGTGKTAVARLVLRRLEARASSLG 76
Query: 197 VYVE---MNALSIPEPKRAYSRILELLLNVDAP-----PEQAKAMLERHFTRPHGPCVLL 248
           V V+   +NA     P R  S I E  + V  P       +    L +  +R  G  +++
Sbjct: 77  VLVKPIYVNARHRETPYRVASAIAE-AVGVRVPFTGLSVGEVYERLVKRLSRLRGIYIIV 135
Query: 249 IDELDYLCNK--RQDVIYNILEYLNKPKSRLII--LCIANTMDLPERTLKGKVSSRMGLT 304
           +DE+D+L  +   QD++Y I     +   R+ +  + I N++   E  L+ +V S +G  
Sbjct: 136 LDEIDFLPKRPGGQDLLYRITRINQELGDRVWVSLVGITNSLGFVE-NLEPRVKSSLGEV 194
Query: 305 RLMFKPYDHHQLQEIVQNRLK---NNNCFHPDAVQLVARL 341
            L+F PY   QL++I++ R +   N     PD V L A L
Sbjct: 195 ELVFPPYTAPQLRDILETRAEEAFNPGVLDPDVVPLCAAL 234
>pdb|2QBY|A Chain A, Crystal Structure Of A Heterodimer Of Cdc6ORC1 INITIATORS Bound To Origin Dna (From S. Solfataricus) Length = 386 Back     alignment and structure
>pdb|2QBY|A Chain A, Crystal Structure Of A Heterodimer Of Cdc6ORC1 INITIATORS Bound To Origin Dna (From S. Solfataricus) Length = 386 Back     alignment and structure
>pdb|1FNN|A Chain A, Crystal Structure Of Cdc6p From Pyrobaculum Aerophilum Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 2e-55
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 2e-21
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 3e-54
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 1e-15
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 1e-48
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 3e-18
2v1u_A387 Cell division control protein 6 homolog; DNA repli 2e-47
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 1e-16
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 2e-46
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 7e-20
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 5e-35
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 1e-06
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-06
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 6e-04
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
 Score =  189 bits (482), Expect = 2e-55
 Identities = 56/229 (24%), Positives = 101/229 (44%), Gaps = 10/229 (4%)

Query: 122 STPLQLARESLHLSRVPESLPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATV 181
            + + + RE L    +P+ LP RE + + I   L     +     ++I G+ GTGKTA V
Sbjct: 3   MSSIFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEKPNNIFIYGLTGTGKTAVV 62

Query: 182 HAVMRKLKQEIGDKFVYVEMNALSIPEPKRAYSRIL-ELLLNVDAPPEQAKAMLERHFTR 240
             V+ KL ++   KF +V +N   I  P R  + +L  L + V         +  R    
Sbjct: 63  KFVLSKLHKKFLGKFKHVYINTRQIDTPYRVLADLLESLDVKVPFTGLSIAELYRRLVKA 122

Query: 241 P---HGPCVLLIDELDYLCNKR-QDVIYNILE-YLNKPKSRLIILCIANTMDLPERTLKG 295
                   V+++DE+D    K   D++Y +        KS++  + I N +   +  L  
Sbjct: 123 VRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVNKSKISFIGITNDVKFVDL-LDP 181

Query: 296 KVSSRMGLTRLMFKPYDHHQLQEIVQNRLK---NNNCFHPDAVQLVARL 341
           +V S +    ++F PY+  +L++I+  R +          + ++L A L
Sbjct: 182 RVKSSLSEEEIIFPPYNAEELEDILTKRAQMAFKPGVLPDNVIKLCAAL 230
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.98
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.97
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.91
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.9
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.9
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.9
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.9
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.89
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.89
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.88
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.88
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.88
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.88
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.88
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.88
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.87
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.84
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.82
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.81
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.81
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.81
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.8
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.8
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.79
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.78
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.78
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.77
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.77
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.77
3pvs_A447 Replication-associated recombination protein A; ma 99.77
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.77
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.77
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.76
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.76
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.76
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.75
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.75
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.74
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.73
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.73
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.73
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.71
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.71
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.7
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.7
3bos_A242 Putative DNA replication factor; P-loop containing 99.7
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.7
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.69
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.69
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.69
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.67
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.67
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.66
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.65
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.65
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.65
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.64
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.64
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.64
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.64
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.64
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.63
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.63
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.62
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.62
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.62
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.61
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.6
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.57
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.54
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.53
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.51
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.5
3co5_A143 Putative two-component system transcriptional RES 99.48
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.47
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.46
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.46
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.45
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.44
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.41
2fna_A357 Conserved hypothetical protein; structural genomic 99.4
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.33
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.31
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.31
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.21
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.18
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.16
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.06
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 99.04
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.01
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.98
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.98
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 98.96
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.91
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 98.91
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 98.91
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 98.88
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.87
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.87
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.86
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.81
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.81
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.74
2qgz_A308 Helicase loader, putative primosome component; str 98.72
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.68
1tue_A212 Replication protein E1; helicase, replication, E1E 98.65
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.57
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.52
3f8t_A506 Predicted ATPase involved in replication control, 98.51
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.49
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.46
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.46
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 98.45
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.44
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.44
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.43
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.41
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.39
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.38
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 98.36
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.35
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.35
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.32
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.31
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.29
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.29
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.28
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 98.27
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.26
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.25
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.25
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.25
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.23
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.23
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.19
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.19
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 98.19
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.18
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.17
3co5_A143 Putative two-component system transcriptional RES 98.17
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.16
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.16
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.15
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.14
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.14
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.14
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.13
1tue_A 212 Replication protein E1; helicase, replication, E1E 98.13
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 98.08
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 98.08
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.04
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.04
3bos_A 242 Putative DNA replication factor; P-loop containing 98.03
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.03
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 98.03
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.03
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.03
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.02
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.02
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.01
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.01
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.0
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.97
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.96
3pvs_A 447 Replication-associated recombination protein A; ma 97.95
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.94
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.93
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.92
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.92
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.89
2qgz_A 308 Helicase loader, putative primosome component; str 97.87
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.86
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.83
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.82
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.81
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.8
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.77
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.76
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.75
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.75
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.71
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.7
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.65
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.64
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.64
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.62
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.61
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.6
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.58
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.58
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.57
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.57
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.51
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.51
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.51
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.45
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.44
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 97.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.42
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.41
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.41
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.35
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.35
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.33
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.33
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.31
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.29
2z43_A324 DNA repair and recombination protein RADA; archaea 97.27
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.25
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.24
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.21
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.18
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.18
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.17
2fna_A 357 Conserved hypothetical protein; structural genomic 97.15
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.13
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.13
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.13
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.1
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.09
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.09
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.08
3io5_A333 Recombination and repair protein; storage dimer, i 97.08
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.07
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.06
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.04
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.03
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.02
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.02
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.01
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.99
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.98
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.98
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.97
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.96
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.95
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.95
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.94
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.94
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.92
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.89
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.89
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 96.88
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 96.88
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.87
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.87
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.85
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.85
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.84
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.83
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.83
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.82
1via_A175 Shikimate kinase; structural genomics, transferase 96.81
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.8
1g6h_A257 High-affinity branched-chain amino acid transport 96.79
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.79
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.78
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.78
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.77
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.76
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.75
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.75
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.74
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.73
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.72
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.72
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.72
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.7
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.69
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.69
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.68
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.68
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.67
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.65
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.65
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.65
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.65
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.64
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.64
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.64
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.63
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 96.63
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.63
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.62
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.62
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.61
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.6
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.55
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.55
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.53
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.52
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 96.52
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.5
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.5
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.5
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.49
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.48
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.46
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.46
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.45
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 96.44
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.44
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.44
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.43
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.43
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 96.42
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.42
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.4
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.4
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.39
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.39
3ice_A422 Transcription termination factor RHO; transcriptio 96.38
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 96.37
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.37
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.36
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.36
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.35
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.34
3ice_A 422 Transcription termination factor RHO; transcriptio 96.34
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 96.34
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.33
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.33
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.33
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.31
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.3
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.29
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.28
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.27
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.24
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.23
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.23
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.23
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.21
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.21
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 96.2
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.2
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.19
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.18
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.17
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.16
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.16
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.15
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.15
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.14
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 96.13
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.12
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.12
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 96.12
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.12
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.1
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.09
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.08
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.08
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.07
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.07
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.05
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.05
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 96.04
2xxa_A433 Signal recognition particle protein; protein trans 96.04
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.04
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 96.03
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.03
3io5_A 333 Recombination and repair protein; storage dimer, i 96.0
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 95.99
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.98
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.98
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.98
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.96
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.95
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.95
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.95
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.93
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.92
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.91
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.91
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.89
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 95.86
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.84
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 95.84
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.83
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.83
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 95.83
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.82
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 95.78
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.77
3bor_A237 Human initiation factor 4A-II; translation initiat 95.77
1xp8_A 366 RECA protein, recombinase A; recombination, radior 95.76
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.76
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 95.76
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 95.75
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.74
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.74
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.74
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 95.73
2ewv_A 372 Twitching motility protein PILT; pilus retraction 95.72
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.71
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.71
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.7
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.68
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.68
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.68
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 95.68
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 95.67
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 95.66
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 95.65
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.65
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 95.65
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.64
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.64
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 95.63
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.62
3l0o_A 427 Transcription termination factor RHO; helicase, RH 95.62
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.62
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 95.62
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 95.61
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.6
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.6
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.58
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.58
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.58
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.56
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 95.55
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.54
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 95.53
1b0u_A 262 Histidine permease; ABC transporter, transport pro 95.51
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 95.51
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 95.51
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.5
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 95.5
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.5
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 95.5
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 95.49
1sgw_A 214 Putative ABC transporter; structural genomics, P p 95.48
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.48
2og2_A 359 Putative signal recognition particle receptor; nuc 95.46
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.46
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.46
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.46
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.46
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 95.45
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.45
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.43
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.43
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 95.43
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.42
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.41
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 95.41
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.41
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 95.41
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.4
3h1t_A590 Type I site-specific restriction-modification syst 95.4
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 95.4
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.38
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.38
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.38
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.35
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 95.35
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 95.35
1g6h_A 257 High-affinity branched-chain amino acid transport 95.35
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 95.34
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.34
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 95.34
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.34
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 95.33
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.33
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.33
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.33
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.32
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 95.32
1ji0_A 240 ABC transporter; ATP binding protein, structural g 95.32
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 95.32
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 95.31
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 95.31
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.31
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.31
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.31
2ghi_A 260 Transport protein; multidrug resistance protein, M 95.3
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 95.29
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 95.29
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 95.29
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.27
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 95.27
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 95.27
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.26
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.25
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 95.25
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.24
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.24
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.24
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.24
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.24
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 95.24
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 95.23
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.98  E-value=1.9e-32  Score=268.21  Aligned_cols=227  Identities=18%  Similarity=0.216  Sum_probs=193.3

Q ss_pred             CCCCCCC-CCchHHHHHHHHHHHHHHhhcCCCCeEEEEcCCCCcHHHHHHHHHHHHHHHhCC----CeEEEEEccccCCC
Q psy17062        134 LSRVPES-LPCREAEFQSIHRFLLSKISQSTTGCMYISGVPGTGKTATVHAVMRKLKQEIGD----KFVYVEMNALSIPE  208 (520)
Q Consensus       134 ~~~~p~~-l~gr~~ei~~l~~~L~~~~~~~~~~~lLl~G~~GtGKT~la~~la~~l~~~~~~----~~~~i~v~~~~~~~  208 (520)
                      .++.+.. |+||++|+..|..+|...+..+.++++||+||||||||++++.+++++......    .+.++++||..+.+
T Consensus        14 ~~~~~~~~L~~Re~E~~~i~~~L~~~i~~~~~~~lli~GpPGTGKT~~v~~v~~~L~~~~~~~~~~~~~~v~INc~~~~t   93 (318)
T 3te6_A           14 ESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELAG   93 (318)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCEEEEECCCSHHHHHHHHHHHHHHHHTTTTTSSCCEEEEEEETTCCC-
T ss_pred             hccCCccccCCHHHHHHHHHHHHHHHhcCCCCCeEEEECCCCCCHHHHHHHHHHHHHHHhhhccCCceEEEEEeccccCC
Confidence            3444444 899999999999999999999999999999999999999999999999764321    47899999999999


Q ss_pred             hHHHHHHHHHHHhcCCCChHHHHHHHHHHHcCC----CCceEEEEcCCccccccChHHHHHHHHhcCCCCCcEEEEEEEc
Q psy17062        209 PKRAYSRILELLLNVDAPPEQAKAMLERHFTRP----HGPCVLLIDELDYLCNKRQDVIYNILEYLNKPKSRLIILCIAN  284 (520)
Q Consensus       209 ~~~~~~~i~~~l~g~~~~~~~~~~~l~~~~~~~----~~~~vLiiDEid~l~~~~~~~L~~ll~~~~~~~~~v~vI~~tn  284 (520)
                      +..+|..|+.++.|...........+...|...    ..+.||||||+|.+.  .+++|+.+++|.....+++++|+++|
T Consensus        94 ~~~~~~~I~~~L~g~~~~~~~~~~~L~~~f~~~~~~~~~~~ii~lDE~d~l~--~q~~L~~l~~~~~~~~s~~~vI~i~n  171 (318)
T 3te6_A           94 MDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRKTLILIQNPENLL--SEKILQYFEKWISSKNSKLSIICVGG  171 (318)
T ss_dssp             -HHHHHHHHHHHSCCC--CCCCHHHHHHHHHHSCGGGSCEEEEEEECCSSSC--CTHHHHHHHHHHHCSSCCEEEEEECC
T ss_pred             HHHHHHHHHHHhcCCCCCchHHHHHHHHHHHHhhhccCCceEEEEecHHHhh--cchHHHHHHhcccccCCcEEEEEEec
Confidence            999999999999887544333445566666542    678999999999998  78999999999876788999999999


Q ss_pred             CCCCchhhhhhhhhccCCcceEEeCCCCHHHHHHHHHHHHhCCC------------------------------------
Q psy17062        285 TMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNNN------------------------------------  328 (520)
Q Consensus       285 ~~~~~~~~l~~~l~sR~~~~~i~~~~~~~~~~~~Il~~~l~~~~------------------------------------  328 (520)
                      +.+++++.+.+++.+||...+|+|+||+.+++.+||+.++....                                    
T Consensus       172 ~~d~~~~~L~~~v~SR~~~~~i~F~pYt~~el~~Il~~Rl~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (318)
T 3te6_A          172 HNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQKIPDNVIVINH  251 (318)
T ss_dssp             SSCCCHHHHHTCHHHHTTEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECTTCCEEECCCC--------CTTEEEECE
T ss_pred             CcccchhhcchhhhccCCceEEEeCCCCHHHHHHHHHHHHHhhhcccccccccccccccccccccccccccccccccccc
Confidence            99988877888999999877899999999999999999997631                                    


Q ss_pred             CCCHHHHHHHHHHcCCCCCCHHHHHHHHHhhhcc
Q psy17062        329 CFHPDAVQLVARLEPPTSRSEIFCANHYTNEKKS  362 (520)
Q Consensus       329 ~~~~~~l~~la~~~~~~~G~~r~al~~l~~a~~~  362 (520)
                      .+++++++++|++++..+||+|+|+++|+.|+..
T Consensus       252 ~i~~~ai~~~A~~vA~~~GD~R~Al~ilr~A~~~  285 (318)
T 3te6_A          252 KINNKITQLIAKNVANVSGSTEKAFKICEAAVEI  285 (318)
T ss_dssp             ECCHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHH
T ss_pred             ccCHHHHHHHHHHHHhhCChHHHHHHHHHHHHHH
Confidence            3689999999999888999999999999999873
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 520
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-20
d1fnna2 276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-10
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-16
d1w5sa2 287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 7e-10
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 6e-08
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 8e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-07
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 7e-06
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 5e-05
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-04
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-04
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 8e-04
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 7e-04
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

 Score = 88.7 bits (218), Expect = 2e-20
 Identities = 41/231 (17%), Positives = 80/231 (34%), Gaps = 9/231 (3%)

Query: 129 RESLHLSRVPESLPCREAEFQSIHRFLLSKISQ--STTGCMYISGVPGTGKTATVHAVMR 186
                 S VP+ LP RE + Q +   L + +           + G PGTGKT T+  +  
Sbjct: 6   DSVFSPSYVPKRLPHREQQLQQLDILLGNWLRNPGHHYPRATLLGRPGTGKTVTLRKLWE 65

Query: 187 KLKQEIGDKFVYVEMNALSIP--EPKRAYSRILELLLNVDAPPEQAKAMLERHFTRPHGP 244
             K +   +FVY+                  +           ++  A+L  H       
Sbjct: 66  LYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRERDLY 125

Query: 245 CVLLIDELDYLCNKRQDVIYNILEYLNK-PKSRLIILCIANTMDLPERTLKGKVSSRMGL 303
             L++D+   L          + +  +K    R+ ++ + +   +            MG 
Sbjct: 126 MFLVLDDAFNLAPDILSTFIRLGQEADKLGAFRIALVIVGHNDAVLNNLDPST-RGIMGK 184

Query: 304 TRLMFKPYDHHQLQEIVQNRLK---NNNCFHPDAVQLVARLEPPTSRSEIF 351
             + F PY   Q+ +I+ +R K       +  D +Q++A +    +  +  
Sbjct: 185 YVIRFSPYTKDQIFDILLDRAKAGLAEGSYSEDILQMIADITGAQTPLDTN 235
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.9
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.89
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.88
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.84
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.84
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.82
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.82
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.82
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.81
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.81
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.81
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.78
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.76
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.76
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.75
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.75
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.72
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.67
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.66
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.6
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.55
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.54
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.54
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.48
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.48
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.34
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.33
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.15
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.03
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.01
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.98
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 98.95
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.95
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.89
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.83
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.81
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 98.78
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 98.75
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 98.72
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.7
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.64
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.61
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.58
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 98.57
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.54
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.41
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.41
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.4
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.34
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.29
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.29
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.29
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.28
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.27
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.22
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.12
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.1
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.07
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.07
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.96
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.9
d2qy9a2211 GTPase domain of the signal recognition particle r 97.77
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.73
d1okkd2207 GTPase domain of the signal recognition particle r 97.72
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.71
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.7
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.69
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.68
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.68
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.67
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.63
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.58
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.57
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.56
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.52
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.48
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.45
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.44
d1vmaa2213 GTPase domain of the signal recognition particle r 97.42
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.42
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.42
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.4
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.38
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.37
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.34
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.3
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.3
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.3
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.29
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.28
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.27
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.26
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.24
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.21
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.2
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.19
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.16
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.16
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 97.16
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.14
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.13
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.11
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.07
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.03
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.01
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.0
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.0
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.99
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.98
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.98
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.94
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.94
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.9
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.9
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.9
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.9
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.85
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.84
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.83
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.82
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.81
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.8
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.8
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.75
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.75
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.73
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.72
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.69
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.69
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.68
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.66
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.65
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.65
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.57
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.52
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.5
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.46
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 96.46
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.39
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.39
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.38
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.38
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.36
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.3
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.3
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.22
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.17
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.17
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.08
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.07
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.05
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.01
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.0
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.92
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.91
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.88
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.88
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.86
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.79
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.75
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.74
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.73
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.72
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.71
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.69
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.65
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.63
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.6
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.58
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.57
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.55
d1g2912 240 Maltose transport protein MalK, N-terminal domain 95.53
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.51
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.5
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.44
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 95.42
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.38
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.37
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.36
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 95.31
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.31
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.31
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 95.3
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.26
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 95.26
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.23
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 95.23
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 95.19
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 95.18
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.16
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.14
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 95.11
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.08
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.06
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 95.04
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.98
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 94.98
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.93
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.93
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.85
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.81
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.8
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 94.78
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.77
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.74
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 94.73
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.65
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.62
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.61
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.61
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.49
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.47
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.42
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 94.38
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.37
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.34
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.3
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 94.3
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 94.3
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 94.27
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.27
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.26
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.19
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 94.17
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.1
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.03
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.03
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.02
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.95
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.9
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.8
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.79
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.79
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.77
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.73
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 93.73
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.7
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.54
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.5
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.39
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.37
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.36
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.3
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 93.29
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 93.25
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.19
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.18
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.17
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.12
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 93.1
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.1
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.07
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.04
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.98
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.98
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.94
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.86
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.84
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.84
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.71
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.65
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.6
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 92.58
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 92.58
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.55
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.54
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.52
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 92.48
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.45
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.44
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.43
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.39
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.34
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.23
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.18
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.13
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.13
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.08
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.05
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.94
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 91.85
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.82
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 91.8
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.68
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 91.61
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.6
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.43
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 91.02
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 91.01
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.81
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 90.73
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 90.67
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.6
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.54
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.49
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.07
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 90.06
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 89.84
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.75
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.73
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.7
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 89.68
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 89.37
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.37
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.35
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.16
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.9
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.81
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.76
d1gm5a3 264 RecG helicase domain {Thermotoga maritima [TaxId: 88.57
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.46
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.42
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.39
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 88.35
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.24
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 88.17
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 88.07
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.99
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 87.83
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 87.56
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 87.39
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 87.36
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 87.27
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 86.71
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 86.7
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 86.69
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 86.69
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 86.42
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 86.32
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 86.25
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 86.2
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 85.85
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 85.78
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 85.7
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 85.56
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.56
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 85.44
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 85.4
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 85.18
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 85.13
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 84.85
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 84.84
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 84.45
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 84.4
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 84.25
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 84.06
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 83.95
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 83.92
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 83.79
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 83.49
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 83.09
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 82.53
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 82.52
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 82.28
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 82.2
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 82.18
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 81.76
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 81.39
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 81.05
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=99.90  E-value=6.5e-24  Score=203.42  Aligned_cols=249  Identities=17%  Similarity=0.212  Sum_probs=192.1

Q ss_pred             HhhccCCCCCCCCCchHHHHHHHHHHHHHHhhc--CCCCeEEEEcCCCCcHHHHHHHHHHHHHHHhCCCeEEEEEccccC
Q psy17062        129 RESLHLSRVPESLPCREAEFQSIHRFLLSKISQ--STTGCMYISGVPGTGKTATVHAVMRKLKQEIGDKFVYVEMNALSI  206 (520)
Q Consensus       129 ~~~l~~~~~p~~l~gr~~ei~~l~~~L~~~~~~--~~~~~lLl~G~~GtGKT~la~~la~~l~~~~~~~~~~i~v~~~~~  206 (520)
                      +..|+++|+|+.++||+.+++.|.++|...+..  ..+++++|+||||||||++++.+++.+....  ...+++++|...
T Consensus         6 ~~~l~~~y~p~~l~~Re~ei~~l~~~l~~~l~~~~~~~~~lll~GppGtGKT~l~~~l~~~l~~~~--~~~~~~~~~~~~   83 (276)
T d1fnna2           6 DSVFSPSYVPKRLPHREQQLQQLDILLGNWLRNPGHHYPRATLLGRPGTGKTVTLRKLWELYKDKT--TARFVYINGFIY   83 (276)
T ss_dssp             GGGGSTTCCCSCCTTCHHHHHHHHHHHHHHHHSTTSSCCEEEEECCTTSSHHHHHHHHHHHHTTSC--CCEEEEEETTTC
T ss_pred             cccCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCceEEECCCCCCHHHHHHHHHHHHhccc--CCcEEEecchhh
Confidence            356889999999999999999999999987543  4568999999999999999999999985433  678999999999


Q ss_pred             CChHHHHHHHHHHHhcCCC----ChHHHHHHHHHHHcCCCCceEEEEcCCccccccChHHHHHHHHhc-CCCCCcEEEEE
Q psy17062        207 PEPKRAYSRILELLLNVDA----PPEQAKAMLERHFTRPHGPCVLLIDELDYLCNKRQDVIYNILEYL-NKPKSRLIILC  281 (520)
Q Consensus       207 ~~~~~~~~~i~~~l~g~~~----~~~~~~~~l~~~~~~~~~~~vLiiDEid~l~~~~~~~L~~ll~~~-~~~~~~v~vI~  281 (520)
                      ......+..+...+.....    ........+...+.......++++|++|.+.......+..++... ......+.+|+
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  163 (276)
T d1fnna2          84 RNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRERDLYMFLVLDDAFNLAPDILSTFIRLGQEADKLGAFRIALVI  163 (276)
T ss_dssp             CSHHHHHHHHHHHTTCCCCSSCCCHHHHHHHHHHHHHHTTCCEEEEEETGGGSCHHHHHHHHHHTTCHHHHSSCCEEEEE
T ss_pred             hhhhhhhhhhHHhhhhhhhhhccchhHHHHHHHHHHhhcccccccchhHHHHhhhhhhhhHHHHHhccccccccceEEee
Confidence            9999888888777643321    223344444444444467888999999999887666666665533 23456788999


Q ss_pred             EEcCCCCchhhhhhhhhccCCcceEEeCCCCHHHHHHHHHHHHhCC---CCCCHHHHHHHHHHcC------CCCCCHHHH
Q psy17062        282 IANTMDLPERTLKGKVSSRMGLTRLMFKPYDHHQLQEIVQNRLKNN---NCFHPDAVQLVARLEP------PTSRSEIFC  352 (520)
Q Consensus       282 ~tn~~~~~~~~l~~~l~sR~~~~~i~~~~~~~~~~~~Il~~~l~~~---~~~~~~~l~~la~~~~------~~~G~~r~a  352 (520)
                      +++..+..+. +.+++.+|+....|.|++|+.+++.+|++.++...   ..+++++++.|++.+.      .+.|++|.+
T Consensus       164 ~~~~~~~~~~-~~~~~~~r~~~~~i~~~~~~~~e~~~il~~r~~~~~~~~~~~~~~l~~ia~~~~~~~~~~~~~G~~R~a  242 (276)
T d1fnna2         164 VGHNDAVLNN-LDPSTRGIMGKYVIRFSPYTKDQIFDILLDRAKAGLAEGSYSEDILQMIADITGAQTPLDTNRGDARLA  242 (276)
T ss_dssp             EESSTHHHHT-SCHHHHHHHTTCEEECCCCBHHHHHHHHHHHHHHHBCTTSSCHHHHHHHHHHHSBSSTTCTTSCCHHHH
T ss_pred             cCCchhhhhh-cchhhhhhhcchhccccchhHHHHHHHHHHHHHHhcccccccHHHHHHHHHHhhhhhhhhhcCCCHHHH
Confidence            9998765543 56778888876779999999999999999988752   5689999999998863      367999999


Q ss_pred             HHHHHhhhccCCCCceecccccchhhhhcccccccc
Q psy17062        353 ANHYTNEKKSKSKYWDWVSSSSDEEEKEENHVIGKL  388 (520)
Q Consensus       353 l~~l~~a~~~~~~~~~~~a~~~~~~~~~~~~v~~a~  388 (520)
                      +++|+.|+.        .+...+...++.+++..|.
T Consensus       243 ~~ll~~a~~--------~A~~~~~~~I~~edv~~A~  270 (276)
T d1fnna2         243 IDILYRSAY--------AAQQNGRKHIAPEDVRKSS  270 (276)
T ss_dssp             HHHHHHHHH--------HHHHTTCSSCCHHHHHHHH
T ss_pred             HHHHHHHHH--------HHHHcCCCCcCHHHHHHHH
Confidence            999999876        3444555567777776654
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure