Psyllid ID: psy17123


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MAAVNTTTDAGAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHRRDHKEYEDSNLY
cccccccccccccccccccccccccHHHHcccEEEEEEcccEEEEEEEEEEcccccEEEccEEEEEEccccccEEEEEEEEEEEcccEEEEEccccccccccccc
cccccccccccccccccccHHHHHHHHHHHcccEEEEEccccEEEEEEccccHHHHHHHHHHHHHHcccccccEEEEEEEEEEEcccEEcccccccccccccccc
maavntttdagaetkdrkrKESILDLSKFLDKVIRVKfaggrecsgilkgfdpllnlvldNTTEYLRVTYQSVQVRSWCSIVRRqesrrnvhrrdhkeyedsnly
maavntttdagaetkdrkrkesildlskfLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYqsvqvrswcsivrrqesrrnvhrrdhkeyedsnly
MAAVNTTTDAGAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHRRDHKEYEDSNLY
**********************ILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVR**********************
***************************KFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHRRDHKE*****L*
********************ESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQE*******************
*****************KRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHRRDHKEYE*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVNTTTDAGAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHRRDHKEYEDSNLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
Q9CQQ8103 U6 snRNA-associated Sm-li yes N/A 0.504 0.514 0.792 1e-18
Q9UK45103 U6 snRNA-associated Sm-li yes N/A 0.504 0.514 0.792 1e-18
O74499113 U6 snRNA-associated Sm-li yes N/A 0.533 0.495 0.571 3e-12
Q54HF697 Probable U6 snRNA-associa yes N/A 0.476 0.515 0.64 2e-11
P53905115 U6 snRNA-associated Sm-li yes N/A 0.457 0.417 0.562 6e-10
P6230976 Small nuclear ribonucleop no N/A 0.390 0.539 0.512 2e-06
P6230876 Small nuclear ribonucleop no N/A 0.390 0.539 0.512 2e-06
Q3ZBL076 Small nuclear ribonucleop no N/A 0.390 0.539 0.512 2e-06
Q9VXE076 Probable small nuclear ri no N/A 0.380 0.526 0.5 2e-06
Q9N4G977 Probable small nuclear ri no N/A 0.390 0.532 0.487 2e-06
>sp|Q9CQQ8|LSM7_MOUSE U6 snRNA-associated Sm-like protein LSm7 OS=Mus musculus GN=Lsm7 PE=3 SV=1 Back     alignment and function desciption
 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (90%)

Query: 15 KDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
          K++K+KESILDLSK++DK IRVKF GGRE SGILKGFDPLLNLVLD T EY+R
Sbjct: 4  KEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTMEYMR 56




Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Mus musculus (taxid: 10090)
>sp|Q9UK45|LSM7_HUMAN U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens GN=LSM7 PE=1 SV=1 Back     alignment and function description
>sp|O74499|LSM7_SCHPO U6 snRNA-associated Sm-like protein LSm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm7 PE=1 SV=1 Back     alignment and function description
>sp|Q54HF6|LSM7_DICDI Probable U6 snRNA-associated Sm-like protein LSm7 OS=Dictyostelium discoideum GN=lsm7 PE=3 SV=1 Back     alignment and function description
>sp|P53905|LSM7_YEAST U6 snRNA-associated Sm-like protein LSm7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSM7 PE=1 SV=2 Back     alignment and function description
>sp|P62309|RUXG_MOUSE Small nuclear ribonucleoprotein G OS=Mus musculus GN=Snrpg PE=1 SV=1 Back     alignment and function description
>sp|P62308|RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens GN=SNRPG PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBL0|RUXG_BOVIN Small nuclear ribonucleoprotein G OS=Bos taurus GN=SNRPG PE=3 SV=1 Back     alignment and function description
>sp|Q9VXE0|RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster GN=SmG PE=3 SV=1 Back     alignment and function description
>sp|Q9N4G9|RUXG_CAEEL Probable small nuclear ribonucleoprotein G OS=Caenorhabditis elegans GN=snr-7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
328791249113 PREDICTED: U6 snRNA-associated Sm-like p 0.638 0.592 0.731 2e-20
383847376115 PREDICTED: U6 snRNA-associated Sm-like p 0.561 0.513 0.813 1e-19
340721932113 PREDICTED: u6 snRNA-associated Sm-like p 0.638 0.592 0.701 2e-19
328791247109 PREDICTED: U6 snRNA-associated Sm-like p 0.590 0.568 0.758 3e-19
156544990115 PREDICTED: U6 snRNA-associated Sm-like p 0.533 0.486 0.821 7e-19
357613355116 U6 snRNA-associated Sm-like protein [Dan 0.580 0.525 0.721 1e-18
307194533107 U6 snRNA-associated Sm-like protein LSm7 0.533 0.523 0.821 1e-18
242009022109 conserved hypothetical protein [Pediculu 0.533 0.513 0.803 2e-18
91089491113 PREDICTED: similar to U6 snRNA-associate 0.533 0.495 0.803 2e-18
332374862116 unknown [Dendroctonus ponderosae] 0.523 0.474 0.818 3e-18
>gi|328791249|ref|XP_003251537.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 isoform 2 [Apis mellifera] gi|350407868|ref|XP_003488222.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like [Bombus impatiens] gi|380018582|ref|XP_003693206.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like isoform 2 [Apis florea] Back     alignment and taxonomy information
 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%)

Query: 1  MAAVNTTTDAGAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLD 60
          M+A     +A  E K+RK+KESILDLSK+L+K IRVKFAGGRE +GILKG+DPLLNLVLD
Sbjct: 1  MSAAKQQQNAHGEPKERKKKESILDLSKYLEKNIRVKFAGGREAAGILKGYDPLLNLVLD 60

Query: 61 NTTEYLR 67
          NTTEYLR
Sbjct: 61 NTTEYLR 67




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383847376|ref|XP_003699330.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340721932|ref|XP_003399367.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm7-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328791247|ref|XP_001121212.2| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 isoform 1 [Apis mellifera] gi|380018580|ref|XP_003693205.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|156544990|ref|XP_001608041.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357613355|gb|EHJ68454.1| U6 snRNA-associated Sm-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|307194533|gb|EFN76825.1| U6 snRNA-associated Sm-like protein LSm7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242009022|ref|XP_002425292.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509057|gb|EEB12554.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91089491|ref|XP_969723.1| PREDICTED: similar to U6 snRNA-associated Sm-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332374862|gb|AEE62572.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
UNIPROTKB|Q9UK45103 LSM7 "U6 snRNA-associated Sm-l 0.504 0.514 0.792 2.8e-18
FB|FBgn0261068110 LSm7 [Drosophila melanogaster 0.504 0.481 0.811 3.6e-18
ZFIN|ZDB-GENE-030131-8284103 lsm7 "LSM7 homolog, U6 small n 0.504 0.514 0.773 7.5e-18
WB|WBGene00003081104 lsm-7 [Caenorhabditis elegans 0.514 0.519 0.642 8.8e-15
UNIPROTKB|Q23543104 lsm-7 "Protein LSM-7" [Caenorh 0.514 0.519 0.642 8.8e-15
ASPGD|ASPL0000056132136 AN0767 [Emericella nidulans (t 0.714 0.551 0.493 1.3e-13
DICTYBASE|DDB_G028949997 lsm7 "putative U6 small nuclea 0.466 0.505 0.653 3.9e-12
POMBASE|SPCC285.12113 lsm7 "U6 snRNP-associated prot 0.533 0.495 0.571 3.9e-12
UNIPROTKB|G4NLE3146 MGG_02938 "Uncharacterized pro 0.504 0.363 0.566 5e-12
TAIR|locus:205682599 EMB2816 "AT2G03870" [Arabidops 0.466 0.494 0.591 8.2e-12
UNIPROTKB|Q9UK45 LSM7 "U6 snRNA-associated Sm-like protein LSm7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 221 (82.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 42/53 (79%), Positives = 48/53 (90%)

Query:    15 KDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
             K++K+KESILDLSK++DK IRVKF GGRE SGILKGFDPLLNLVLD T EY+R
Sbjct:     4 KEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMR 56




GO:0005681 "spliceosomal complex" evidence=IEA
GO:0017070 "U6 snRNA binding" evidence=NAS
GO:0000398 "mRNA splicing, via spliceosome" evidence=NAS
GO:0005634 "nucleus" evidence=NAS
GO:0000288 "nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay" evidence=TAS
GO:0005829 "cytosol" evidence=TAS
GO:0010467 "gene expression" evidence=TAS
GO:0016070 "RNA metabolic process" evidence=TAS
GO:0016071 "mRNA metabolic process" evidence=TAS
GO:0043928 "exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
FB|FBgn0261068 LSm7 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8284 lsm7 "LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00003081 lsm-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q23543 lsm-7 "Protein LSM-7" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056132 AN0767 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289499 lsm7 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPCC285.12 lsm7 "U6 snRNP-associated protein Lsm7 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4NLE3 MGG_02938 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2056825 EMB2816 "AT2G03870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54HF6LSM7_DICDINo assigned EC number0.640.47610.5154yesN/A
Q9UK45LSM7_HUMANNo assigned EC number0.79240.50470.5145yesN/A
P53905LSM7_YEASTNo assigned EC number0.56250.45710.4173yesN/A
Q9CQQ8LSM7_MOUSENo assigned EC number0.79240.50470.5145yesN/A
O74499LSM7_SCHPONo assigned EC number0.57140.53330.4955yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
cd0172989 cd01729, LSm7, Like-Sm protein 7 2e-28
cd0171970 cd01719, Sm_G, Sm protein G 2e-14
smart0065167 smart00651, Sm, snRNP Sm proteins 3e-11
pfam0142366 pfam01423, LSM, LSM domain 3e-10
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 5e-08
cd0173169 cd01731, archaeal_Sm1, archaeal Sm protein 1 5e-08
cd0060063 cd00600, Sm_like, Sm and related proteins 1e-07
PRK0073772 PRK00737, PRK00737, small nuclear ribonucleoprotei 3e-07
cd0172791 cd01727, LSm8, Like-Sm protein 8 7e-06
cd0616873 cd06168, LSMD1, LSM domain containing 1 1e-05
cd1167965 cd11679, archaeal_Sm_like, archaeal Sm-related pro 5e-05
cd0172269 cd01722, Sm_F, Sm protein F 8e-05
cd0173082 cd01730, LSm3, Like-Sm protein 3 1e-04
cd0173276 cd01732, LSm5, Like-Sm protein 5 1e-04
cd1167869 cd11678, archaeal_LSm, archaeal Like-Sm protein 3e-04
cd0172668 cd01726, LSm6, Like-Sm protein 6 7e-04
>gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 Back     alignment and domain information
 Score = 98.0 bits (245), Expect = 2e-28
 Identities = 38/48 (79%), Positives = 43/48 (89%)

Query: 20 KESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
          KESILDLSK++DK IRVKF GGRE +GILKG+D LLNLVLD+T EYLR
Sbjct: 1  KESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLR 48


The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm657 is believed to be an assembly intermediate for both the LSm1-7 and LSm2-8 rings. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 89

>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 Back     alignment and domain information
>gnl|CDD|212486 cd06168, LSMD1, LSM domain containing 1 Back     alignment and domain information
>gnl|CDD|212490 cd11679, archaeal_Sm_like, archaeal Sm-related protein Back     alignment and domain information
>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 Back     alignment and domain information
>gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 Back     alignment and domain information
>gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein Back     alignment and domain information
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.92
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.91
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.89
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.89
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.89
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.86
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.86
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.86
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.84
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.83
KOG1781|consensus108 99.83
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.83
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.83
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.81
KOG1780|consensus77 99.81
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.8
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.78
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.77
KOG3482|consensus79 99.7
KOG1784|consensus96 99.68
KOG1782|consensus129 99.58
KOG1783|consensus77 99.57
KOG3460|consensus91 99.55
KOG3168|consensus177 99.55
KOG1775|consensus84 99.48
KOG1774|consensus88 99.45
KOG3293|consensus134 99.38
KOG3448|consensus96 99.36
KOG3172|consensus119 99.03
KOG3428|consensus109 98.86
KOG3459|consensus114 98.34
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 98.14
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 97.94
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 97.29
PF06372166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 96.8
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 96.74
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 96.64
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 96.42
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 96.29
PRK0039579 hfq RNA-binding protein Hfq; Provisional 95.89
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 95.64
PRK14638150 hypothetical protein; Provisional 95.35
COG192377 Hfq Uncharacterized host factor I protein [General 95.12
PRK14639140 hypothetical protein; Provisional 94.79
PRK02001152 hypothetical protein; Validated 94.72
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 94.51
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 94.15
PRK14644136 hypothetical protein; Provisional 93.68
PRK14091165 RNA-binding protein Hfq; Provisional 93.19
PRK14091165 RNA-binding protein Hfq; Provisional 93.11
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 93.01
PRK14640152 hypothetical protein; Provisional 92.85
PRK14633150 hypothetical protein; Provisional 92.28
KOG1073|consensus 361 91.95
PRK14645154 hypothetical protein; Provisional 91.51
PRK14642197 hypothetical protein; Provisional 91.32
PRK14636176 hypothetical protein; Provisional 91.09
PF02576141 DUF150: Uncharacterised BCR, YhbC family COG0779; 91.02
PRK00092154 ribosome maturation protein RimP; Reviewed 90.83
PRK14632172 hypothetical protein; Provisional 90.54
PRK14634155 hypothetical protein; Provisional 90.49
PRK14643164 hypothetical protein; Provisional 90.47
COG0779153 Uncharacterized protein conserved in bacteria [Fun 90.15
PRK14647159 hypothetical protein; Provisional 89.82
PRK14646155 hypothetical protein; Provisional 89.32
PRK14631174 hypothetical protein; Provisional 88.49
PRK06955300 biotin--protein ligase; Provisional 87.69
PRK14637151 hypothetical protein; Provisional 87.44
PRK14641173 hypothetical protein; Provisional 87.35
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 84.28
PRK13325 592 bifunctional biotin--[acetyl-CoA-carboxylase] liga 82.09
TIGR00121237 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] 81.92
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
Probab=99.92  E-value=6.3e-25  Score=142.81  Aligned_cols=77  Identities=56%  Similarity=0.770  Sum_probs=67.5

Q ss_pred             ccchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCce----eeeeeEEeeEEEcCCcEEEEEecC
Q psy17123         20 KESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQ----SVQVRSWCSIVRRQESRRNVHRRD   95 (105)
Q Consensus        20 ~~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~----~~~~~~lg~vlIRG~~I~~i~~~d   95 (105)
                      ++++..|.++++|+|+|+|+|||.|+|+|.|||+||||+|++|+|+...++.    ....+.+|.++|||++|++|++.|
T Consensus         1 ~~~~~~L~~~i~k~V~V~l~~gr~~~G~L~~~D~~mNlvL~~~~E~~~~~~~~~~~~~~~~~lG~v~iRG~nV~~i~~~~   80 (81)
T cd01729           1 KESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLRDPDDPYKLTDKTRQLGLVVCRGTSVVLISPVD   80 (81)
T ss_pred             CcchhhHHHhcCCeEEEEECCCcEEEEEEEEEcCcccEEecCEEEEEccCCcccccccceeEccEEEEcCCEEEEEecCC
Confidence            3578899999999999999999999999999999999999999999764321    124688999999999999999876


Q ss_pred             C
Q psy17123         96 H   96 (105)
Q Consensus        96 ~   96 (105)
                      +
T Consensus        81 ~   81 (81)
T cd01729          81 G   81 (81)
T ss_pred             C
Confidence            4



Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure. Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.

>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>KOG1781|consensus Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780|consensus Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3482|consensus Back     alignment and domain information
>KOG1784|consensus Back     alignment and domain information
>KOG1782|consensus Back     alignment and domain information
>KOG1783|consensus Back     alignment and domain information
>KOG3460|consensus Back     alignment and domain information
>KOG3168|consensus Back     alignment and domain information
>KOG1775|consensus Back     alignment and domain information
>KOG1774|consensus Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG3448|consensus Back     alignment and domain information
>KOG3172|consensus Back     alignment and domain information
>KOG3428|consensus Back     alignment and domain information
>KOG3459|consensus Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>KOG1073|consensus Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>PRK14642 hypothetical protein; Provisional Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK14637 hypothetical protein; Provisional Back     alignment and domain information
>PRK14641 hypothetical protein; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
3swn_C117 Structure Of The Lsm657 Complex: An Assembly Interm 2e-13
4emk_C113 Crystal Structure Of Splsm567 Length = 113 7e-13
3cw1_G76 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 1e-07
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 117 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 32/56 (57%), Positives = 43/56 (76%) Query: 12 AETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67 ++ +R RKESILDLS++ D+ I+ F GGR+ +GILKGFD L+NLVLD+ E LR Sbjct: 18 SQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLR 73
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567 Length = 113 Back     alignment and structure
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 7e-19
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 2e-18
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 7e-17
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 2e-15
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 1e-14
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 2e-14
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 6e-14
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 7e-14
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 1e-12
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 2e-12
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 6e-12
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 9e-12
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 1e-10
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 4e-09
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 4e-09
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 4e-07
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 1e-04
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 1e-04
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 7e-04
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 9e-04
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
 Score = 74.2 bits (182), Expect = 7e-19
 Identities = 32/55 (58%), Positives = 41/55 (74%)

Query: 15 KDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVT 69
           +R RKESILDLS++ D+ I+  F GGR+ +GILKGFD L+NLVLD+  E LR  
Sbjct: 17 TERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNP 71


>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Length = 130 Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.94
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.92
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.91
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.91
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.91
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.91
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.9
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.9
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.9
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.9
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.9
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.9
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.9
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.89
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.88
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.88
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.88
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.88
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.87
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.86
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.86
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.85
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.83
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.8
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 99.15
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 97.11
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 96.88
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 96.8
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 96.7
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 96.61
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 96.49
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 96.44
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 96.32
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 95.83
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 95.57
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 95.3
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 95.15
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 94.84
1ycy_A71 Conserved hypothetical protein; structural genomic 94.81
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 94.65
1ib8_A164 Conserved protein SP14.3; nucleic acid binding pro 91.51
3rux_A270 BIRA bifunctional protein; biotin-protein ligase, 91.06
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 82.6
2rm4_A103 CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- 81.18
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
Probab=99.94  E-value=1.1e-26  Score=158.47  Aligned_cols=88  Identities=42%  Similarity=0.637  Sum_probs=57.8

Q ss_pred             CCCccccccccchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCce---eeeeeEEeeEEEcCCc
Q psy17123         11 GAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQ---SVQVRSWCSIVRRQES   87 (105)
Q Consensus        11 ~~~~~~~~~~~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~---~~~~~~lg~vlIRG~~   87 (105)
                      ..++.++|+++++..|.++++++|+|+|+|||.|+|+|+|||+||||+|+||+|++.+++.   ....+.+|+++|||++
T Consensus        13 ~~~~~~~~kke~i~~L~~~l~k~V~V~L~dGr~~~G~L~~fD~~mNLVL~d~~E~~~~~~~~~~~~~~r~lG~v~IRG~n   92 (113)
T 4emk_C           13 SSQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTT   92 (113)
T ss_dssp             -------------------CCSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEC---------CCEEEEEEEEECTTT
T ss_pred             CCCCccCCccchHHHHHHHcCCcEEEEEeCCeEEEEEEEEEcCcccEEEeeEEEEEcCCCCcccccceeEccEEEECCCe
Confidence            3456688999999999999999999999999999999999999999999999999865321   1357899999999999


Q ss_pred             EEEEEecCCcc
Q psy17123         88 RRNVHRRDHKE   98 (105)
Q Consensus        88 I~~i~~~d~~~   98 (105)
                      |++|+++|+..
T Consensus        93 Iv~I~~~d~~e  103 (113)
T 4emk_C           93 LVLIAPMDGSE  103 (113)
T ss_dssp             EEEEEECC---
T ss_pred             EEEEEecCccc
Confidence            99999999765



>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure
>3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 7e-12
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 2e-11
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 1e-10
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 1e-10
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-10
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 8e-10
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 1e-09
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 1e-09
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 1e-09
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 5e-09
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 2e-08
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 1e-06
d1b34a_80 b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s 3e-06
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: B core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.4 bits (131), Expect = 7e-12
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRV 68
          + + +D  +R     GR   G  K FD  +NL+L +  E+ ++
Sbjct: 3  MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKI 45


>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.9
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.9
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.9
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.9
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.89
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.89
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.89
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.87
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.87
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.86
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.84
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.81
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.73
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 97.3
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 96.81
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 96.02
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 95.81
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 93.64
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 93.6
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Archaeon Pyrococcus abyssi [TaxId: 29292]
Probab=99.90  E-value=5.7e-24  Score=132.17  Aligned_cols=69  Identities=26%  Similarity=0.304  Sum_probs=62.9

Q ss_pred             cchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCceeeeeeEEeeEEEcCCcEEEEEe
Q psy17123         21 ESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHR   93 (105)
Q Consensus        21 ~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~~~~~~~lg~vlIRG~~I~~i~~   93 (105)
                      .|...|++++|++|+|+|+||+.|+|+|.+||+||||+|++|.|+..+.    +.+.+|.++|||++|++|+|
T Consensus         2 ~Pl~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~----~~~~l~~~~IRG~~I~~Isp   70 (71)
T d1h641_           2 RPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE----VVKRYGKIVIRGDNVLAISP   70 (71)
T ss_dssp             CHHHHHHTTTTSEEEEEETTSEEEEEEEEEECTTCCEEEEEEEEEETTE----EEEEEEEEEECGGGEEEEEE
T ss_pred             CchHHHHHhCCCEEEEEEcCCCEEEEEEEEECCCCCeEEeeEEEEecCC----cEeEcCcEEEECCeEEEEeC
Confidence            4677899999999999999999999999999999999999999986433    36889999999999999986



>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure