Psyllid ID: psy17123
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| 328791249 | 113 | PREDICTED: U6 snRNA-associated Sm-like p | 0.638 | 0.592 | 0.731 | 2e-20 | |
| 383847376 | 115 | PREDICTED: U6 snRNA-associated Sm-like p | 0.561 | 0.513 | 0.813 | 1e-19 | |
| 340721932 | 113 | PREDICTED: u6 snRNA-associated Sm-like p | 0.638 | 0.592 | 0.701 | 2e-19 | |
| 328791247 | 109 | PREDICTED: U6 snRNA-associated Sm-like p | 0.590 | 0.568 | 0.758 | 3e-19 | |
| 156544990 | 115 | PREDICTED: U6 snRNA-associated Sm-like p | 0.533 | 0.486 | 0.821 | 7e-19 | |
| 357613355 | 116 | U6 snRNA-associated Sm-like protein [Dan | 0.580 | 0.525 | 0.721 | 1e-18 | |
| 307194533 | 107 | U6 snRNA-associated Sm-like protein LSm7 | 0.533 | 0.523 | 0.821 | 1e-18 | |
| 242009022 | 109 | conserved hypothetical protein [Pediculu | 0.533 | 0.513 | 0.803 | 2e-18 | |
| 91089491 | 113 | PREDICTED: similar to U6 snRNA-associate | 0.533 | 0.495 | 0.803 | 2e-18 | |
| 332374862 | 116 | unknown [Dendroctonus ponderosae] | 0.523 | 0.474 | 0.818 | 3e-18 |
| >gi|328791249|ref|XP_003251537.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 isoform 2 [Apis mellifera] gi|350407868|ref|XP_003488222.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like [Bombus impatiens] gi|380018582|ref|XP_003693206.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
Score = 103 bits (256), Expect = 2e-20, Method: Compositional matrix adjust.
Identities = 49/67 (73%), Positives = 57/67 (85%)
Query: 1 MAAVNTTTDAGAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLD 60
M+A +A E K+RK+KESILDLSK+L+K IRVKFAGGRE +GILKG+DPLLNLVLD
Sbjct: 1 MSAAKQQQNAHGEPKERKKKESILDLSKYLEKNIRVKFAGGREAAGILKGYDPLLNLVLD 60
Query: 61 NTTEYLR 67
NTTEYLR
Sbjct: 61 NTTEYLR 67
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383847376|ref|XP_003699330.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340721932|ref|XP_003399367.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm7-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328791247|ref|XP_001121212.2| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 isoform 1 [Apis mellifera] gi|380018580|ref|XP_003693205.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156544990|ref|XP_001608041.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm7 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|357613355|gb|EHJ68454.1| U6 snRNA-associated Sm-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307194533|gb|EFN76825.1| U6 snRNA-associated Sm-like protein LSm7 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242009022|ref|XP_002425292.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509057|gb|EEB12554.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91089491|ref|XP_969723.1| PREDICTED: similar to U6 snRNA-associated Sm-like protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332374862|gb|AEE62572.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| UNIPROTKB|Q9UK45 | 103 | LSM7 "U6 snRNA-associated Sm-l | 0.504 | 0.514 | 0.792 | 2.8e-18 | |
| FB|FBgn0261068 | 110 | LSm7 [Drosophila melanogaster | 0.504 | 0.481 | 0.811 | 3.6e-18 | |
| ZFIN|ZDB-GENE-030131-8284 | 103 | lsm7 "LSM7 homolog, U6 small n | 0.504 | 0.514 | 0.773 | 7.5e-18 | |
| WB|WBGene00003081 | 104 | lsm-7 [Caenorhabditis elegans | 0.514 | 0.519 | 0.642 | 8.8e-15 | |
| UNIPROTKB|Q23543 | 104 | lsm-7 "Protein LSM-7" [Caenorh | 0.514 | 0.519 | 0.642 | 8.8e-15 | |
| ASPGD|ASPL0000056132 | 136 | AN0767 [Emericella nidulans (t | 0.714 | 0.551 | 0.493 | 1.3e-13 | |
| DICTYBASE|DDB_G0289499 | 97 | lsm7 "putative U6 small nuclea | 0.466 | 0.505 | 0.653 | 3.9e-12 | |
| POMBASE|SPCC285.12 | 113 | lsm7 "U6 snRNP-associated prot | 0.533 | 0.495 | 0.571 | 3.9e-12 | |
| UNIPROTKB|G4NLE3 | 146 | MGG_02938 "Uncharacterized pro | 0.504 | 0.363 | 0.566 | 5e-12 | |
| TAIR|locus:2056825 | 99 | EMB2816 "AT2G03870" [Arabidops | 0.466 | 0.494 | 0.591 | 8.2e-12 |
| UNIPROTKB|Q9UK45 LSM7 "U6 snRNA-associated Sm-like protein LSm7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 221 (82.9 bits), Expect = 2.8e-18, P = 2.8e-18
Identities = 42/53 (79%), Positives = 48/53 (90%)
Query: 15 KDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
K++K+KESILDLSK++DK IRVKF GGRE SGILKGFDPLLNLVLD T EY+R
Sbjct: 4 KEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMR 56
|
|
| FB|FBgn0261068 LSm7 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8284 lsm7 "LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003081 lsm-7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q23543 lsm-7 "Protein LSM-7" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000056132 AN0767 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0289499 lsm7 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC285.12 lsm7 "U6 snRNP-associated protein Lsm7 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NLE3 MGG_02938 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056825 EMB2816 "AT2G03870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| cd01729 | 89 | cd01729, LSm7, Like-Sm protein 7 | 2e-28 | |
| cd01719 | 70 | cd01719, Sm_G, Sm protein G | 2e-14 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 3e-11 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 3e-10 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 5e-08 | |
| cd01731 | 69 | cd01731, archaeal_Sm1, archaeal Sm protein 1 | 5e-08 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 1e-07 | |
| PRK00737 | 72 | PRK00737, PRK00737, small nuclear ribonucleoprotei | 3e-07 | |
| cd01727 | 91 | cd01727, LSm8, Like-Sm protein 8 | 7e-06 | |
| cd06168 | 73 | cd06168, LSMD1, LSM domain containing 1 | 1e-05 | |
| cd11679 | 65 | cd11679, archaeal_Sm_like, archaeal Sm-related pro | 5e-05 | |
| cd01722 | 69 | cd01722, Sm_F, Sm protein F | 8e-05 | |
| cd01730 | 82 | cd01730, LSm3, Like-Sm protein 3 | 1e-04 | |
| cd01732 | 76 | cd01732, LSm5, Like-Sm protein 5 | 1e-04 | |
| cd11678 | 69 | cd11678, archaeal_LSm, archaeal Like-Sm protein | 3e-04 | |
| cd01726 | 68 | cd01726, LSm6, Like-Sm protein 6 | 7e-04 |
| >gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 | Back alignment and domain information |
|---|
Score = 98.0 bits (245), Expect = 2e-28
Identities = 38/48 (79%), Positives = 43/48 (89%)
Query: 20 KESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
KESILDLSK++DK IRVKF GGRE +GILKG+D LLNLVLD+T EYLR
Sbjct: 1 KESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLR 48
|
The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. LSm657 is believed to be an assembly intermediate for both the LSm1-7 and LSm2-8 rings. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 89 |
| >gnl|CDD|212466 cd01719, Sm_G, Sm protein G | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 | Back alignment and domain information |
|---|
| >gnl|CDD|212486 cd06168, LSMD1, LSM domain containing 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212490 cd11679, archaeal_Sm_like, archaeal Sm-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|212469 cd01722, Sm_F, Sm protein F | Back alignment and domain information |
|---|
| >gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 | Back alignment and domain information |
|---|
| >gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein | Back alignment and domain information |
|---|
| >gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.92 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.91 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.9 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.9 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.89 | |
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.89 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.86 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.86 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.86 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.84 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.83 | |
| KOG1781|consensus | 108 | 99.83 | ||
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.83 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.83 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.81 | |
| KOG1780|consensus | 77 | 99.81 | ||
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.8 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.78 | |
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.77 | |
| KOG3482|consensus | 79 | 99.7 | ||
| KOG1784|consensus | 96 | 99.68 | ||
| KOG1782|consensus | 129 | 99.58 | ||
| KOG1783|consensus | 77 | 99.57 | ||
| KOG3460|consensus | 91 | 99.55 | ||
| KOG3168|consensus | 177 | 99.55 | ||
| KOG1775|consensus | 84 | 99.48 | ||
| KOG1774|consensus | 88 | 99.45 | ||
| KOG3293|consensus | 134 | 99.38 | ||
| KOG3448|consensus | 96 | 99.36 | ||
| KOG3172|consensus | 119 | 99.03 | ||
| KOG3428|consensus | 109 | 98.86 | ||
| KOG3459|consensus | 114 | 98.34 | ||
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 98.14 | |
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 97.94 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 97.29 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 96.8 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 96.74 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 96.64 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 96.42 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 96.29 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 95.89 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 95.64 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 95.35 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 95.12 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 94.79 | |
| PRK02001 | 152 | hypothetical protein; Validated | 94.72 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 94.51 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 94.15 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 93.68 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 93.19 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 93.11 | |
| cd01734 | 83 | YlxS_C YxlS is a Bacillus subtilis gene of unknown | 93.01 | |
| PRK14640 | 152 | hypothetical protein; Provisional | 92.85 | |
| PRK14633 | 150 | hypothetical protein; Provisional | 92.28 | |
| KOG1073|consensus | 361 | 91.95 | ||
| PRK14645 | 154 | hypothetical protein; Provisional | 91.51 | |
| PRK14642 | 197 | hypothetical protein; Provisional | 91.32 | |
| PRK14636 | 176 | hypothetical protein; Provisional | 91.09 | |
| PF02576 | 141 | DUF150: Uncharacterised BCR, YhbC family COG0779; | 91.02 | |
| PRK00092 | 154 | ribosome maturation protein RimP; Reviewed | 90.83 | |
| PRK14632 | 172 | hypothetical protein; Provisional | 90.54 | |
| PRK14634 | 155 | hypothetical protein; Provisional | 90.49 | |
| PRK14643 | 164 | hypothetical protein; Provisional | 90.47 | |
| COG0779 | 153 | Uncharacterized protein conserved in bacteria [Fun | 90.15 | |
| PRK14647 | 159 | hypothetical protein; Provisional | 89.82 | |
| PRK14646 | 155 | hypothetical protein; Provisional | 89.32 | |
| PRK14631 | 174 | hypothetical protein; Provisional | 88.49 | |
| PRK06955 | 300 | biotin--protein ligase; Provisional | 87.69 | |
| PRK14637 | 151 | hypothetical protein; Provisional | 87.44 | |
| PRK14641 | 173 | hypothetical protein; Provisional | 87.35 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 84.28 | |
| PRK13325 | 592 | bifunctional biotin--[acetyl-CoA-carboxylase] liga | 82.09 | |
| TIGR00121 | 237 | birA_ligase birA, biotin-[acetyl-CoA-carboxylase] | 81.92 |
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
Probab=99.92 E-value=6.3e-25 Score=142.81 Aligned_cols=77 Identities=56% Similarity=0.770 Sum_probs=67.5
Q ss_pred ccchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCce----eeeeeEEeeEEEcCCcEEEEEecC
Q psy17123 20 KESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQ----SVQVRSWCSIVRRQESRRNVHRRD 95 (105)
Q Consensus 20 ~~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~----~~~~~~lg~vlIRG~~I~~i~~~d 95 (105)
++++..|.++++|+|+|+|+|||.|+|+|.|||+||||+|++|+|+...++. ....+.+|.++|||++|++|++.|
T Consensus 1 ~~~~~~L~~~i~k~V~V~l~~gr~~~G~L~~~D~~mNlvL~~~~E~~~~~~~~~~~~~~~~~lG~v~iRG~nV~~i~~~~ 80 (81)
T cd01729 1 KESILDLSKYVDKKIRVKFQGGREVTGILKGYDQLLNLVLDDTVEYLRDPDDPYKLTDKTRQLGLVVCRGTSVVLISPVD 80 (81)
T ss_pred CcchhhHHHhcCCeEEEEECCCcEEEEEEEEEcCcccEEecCEEEEEccCCcccccccceeEccEEEEcCCEEEEEecCC
Confidence 3578899999999999999999999999999999999999999999764321 124688999999999999999876
Q ss_pred C
Q psy17123 96 H 96 (105)
Q Consensus 96 ~ 96 (105)
+
T Consensus 81 ~ 81 (81)
T cd01729 81 G 81 (81)
T ss_pred C
Confidence 4
|
Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure. Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes. |
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >KOG1781|consensus | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1780|consensus | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3482|consensus | Back alignment and domain information |
|---|
| >KOG1784|consensus | Back alignment and domain information |
|---|
| >KOG1782|consensus | Back alignment and domain information |
|---|
| >KOG1783|consensus | Back alignment and domain information |
|---|
| >KOG3460|consensus | Back alignment and domain information |
|---|
| >KOG3168|consensus | Back alignment and domain information |
|---|
| >KOG1775|consensus | Back alignment and domain information |
|---|
| >KOG1774|consensus | Back alignment and domain information |
|---|
| >KOG3293|consensus | Back alignment and domain information |
|---|
| >KOG3448|consensus | Back alignment and domain information |
|---|
| >KOG3172|consensus | Back alignment and domain information |
|---|
| >KOG3428|consensus | Back alignment and domain information |
|---|
| >KOG3459|consensus | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold | Back alignment and domain information |
|---|
| >PRK14640 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1073|consensus | Back alignment and domain information |
|---|
| >PRK14645 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14642 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14636 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] | Back alignment and domain information |
|---|
| >PRK00092 ribosome maturation protein RimP; Reviewed | Back alignment and domain information |
|---|
| >PRK14632 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14634 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14643 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0779 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14647 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14646 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14631 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06955 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14641 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 105 | ||||
| 3swn_C | 117 | Structure Of The Lsm657 Complex: An Assembly Interm | 2e-13 | ||
| 4emk_C | 113 | Crystal Structure Of Splsm567 Length = 113 | 7e-13 | ||
| 3cw1_G | 76 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 1e-07 |
| >pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 117 | Back alignment and structure |
|
| >pdb|4EMK|C Chain C, Crystal Structure Of Splsm567 Length = 113 | Back alignment and structure |
| >pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 7e-19 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 2e-18 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 7e-17 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 2e-15 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 1e-14 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 2e-14 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 6e-14 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 7e-14 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 1e-12 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 2e-12 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 6e-12 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 9e-12 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 1e-10 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 4e-09 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 4e-09 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 4e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-05 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 1e-04 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 1e-04 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 7e-04 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 9e-04 |
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
Score = 74.2 bits (182), Expect = 7e-19
Identities = 32/55 (58%), Positives = 41/55 (74%)
Query: 15 KDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVT 69
+R RKESILDLS++ D+ I+ F GGR+ +GILKGFD L+NLVLD+ E LR
Sbjct: 17 TERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNP 71
|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Length = 130 | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.94 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.92 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.91 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.91 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.91 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.91 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.9 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.9 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.9 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.9 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.9 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.9 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.9 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.89 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.88 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.88 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.88 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.88 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.87 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.86 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.86 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.85 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.83 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.8 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 99.15 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 97.11 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 96.88 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 96.8 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 96.7 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 96.61 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 96.49 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 96.44 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.32 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 95.83 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 95.57 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 95.3 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 95.15 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 94.84 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 94.81 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 94.65 | |
| 1ib8_A | 164 | Conserved protein SP14.3; nucleic acid binding pro | 91.51 | |
| 3rux_A | 270 | BIRA bifunctional protein; biotin-protein ligase, | 91.06 | |
| 2eay_A | 233 | Biotin [acetyl-COA-carboxylase] ligase; biotin bio | 82.6 | |
| 2rm4_A | 103 | CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- | 81.18 |
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
Probab=99.94 E-value=1.1e-26 Score=158.47 Aligned_cols=88 Identities=42% Similarity=0.637 Sum_probs=57.8
Q ss_pred CCCccccccccchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCce---eeeeeEEeeEEEcCCc
Q psy17123 11 GAETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQ---SVQVRSWCSIVRRQES 87 (105)
Q Consensus 11 ~~~~~~~~~~~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~---~~~~~~lg~vlIRG~~ 87 (105)
..++.++|+++++..|.++++++|+|+|+|||.|+|+|+|||+||||+|+||+|++.+++. ....+.+|+++|||++
T Consensus 13 ~~~~~~~~kke~i~~L~~~l~k~V~V~L~dGr~~~G~L~~fD~~mNLVL~d~~E~~~~~~~~~~~~~~r~lG~v~IRG~n 92 (113)
T 4emk_C 13 SSQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTT 92 (113)
T ss_dssp -------------------CCSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEEC---------CCEEEEEEEEECTTT
T ss_pred CCCCccCCccchHHHHHHHcCCcEEEEEeCCeEEEEEEEEEcCcccEEEeeEEEEEcCCCCcccccceeEccEEEECCCe
Confidence 3456688999999999999999999999999999999999999999999999999865321 1357899999999999
Q ss_pred EEEEEecCCcc
Q psy17123 88 RRNVHRRDHKE 98 (105)
Q Consensus 88 I~~i~~~d~~~ 98 (105)
|++|+++|+..
T Consensus 93 Iv~I~~~d~~e 103 (113)
T 4emk_C 93 LVLIAPMDGSE 103 (113)
T ss_dssp EEEEEECC---
T ss_pred EEEEEecCccc
Confidence 99999999765
|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A | Back alignment and structure |
|---|
| >2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* | Back alignment and structure |
|---|
| >2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 105 | ||||
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 7e-12 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 2e-11 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 1e-10 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 1e-10 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-10 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 8e-10 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 1e-09 | |
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 1e-09 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 1e-09 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 5e-09 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 2e-08 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 1e-06 | |
| d1b34a_ | 80 | b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s | 3e-06 |
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: B core SNRNP protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.4 bits (131), Expect = 7e-12
Identities = 12/43 (27%), Positives = 22/43 (51%)
Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRV 68
+ + +D +R GR G K FD +NL+L + E+ ++
Sbjct: 3 MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKI 45
|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.9 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.9 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.9 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.9 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.89 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.89 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.89 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.87 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.87 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.86 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.84 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.81 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.73 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 97.3 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 96.81 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 96.02 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 95.81 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 93.64 | |
| d1ib8a1 | 74 | Hypothetical protein SP14.3 (SP0552) {Streptococcu | 93.6 |
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Archaeal homoheptameric Sm protein species: Archaeon Pyrococcus abyssi [TaxId: 29292]
Probab=99.90 E-value=5.7e-24 Score=132.17 Aligned_cols=69 Identities=26% Similarity=0.304 Sum_probs=62.9
Q ss_pred cchhhHHhhcCCEEEEEEcCCeEEEEEEEEecCccCeEecceEEEEecCceeeeeeEEeeEEEcCCcEEEEEe
Q psy17123 21 ESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRRQESRRNVHR 93 (105)
Q Consensus 21 ~~~~~L~~~i~k~V~V~LkdGr~i~G~L~~fD~~mNlvL~da~E~~~~~~~~~~~~~lg~vlIRG~~I~~i~~ 93 (105)
.|...|++++|++|+|+|+||+.|+|+|.+||+||||+|++|.|+..+. +.+.+|.++|||++|++|+|
T Consensus 2 ~Pl~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~----~~~~l~~~~IRG~~I~~Isp 70 (71)
T d1h641_ 2 RPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE----VVKRYGKIVIRGDNVLAISP 70 (71)
T ss_dssp CHHHHHHTTTTSEEEEEETTSEEEEEEEEEECTTCCEEEEEEEEEETTE----EEEEEEEEEECGGGEEEEEE
T ss_pred CchHHHHHhCCCEEEEEEcCCCEEEEEEEEECCCCCeEEeeEEEEecCC----cEeEcCcEEEECCeEEEEeC
Confidence 4677899999999999999999999999999999999999999986433 36889999999999999986
|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|