Psyllid ID: psy1718
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 237761916 | 114 | ribosomal protein L36e [Blattella german | 0.408 | 0.508 | 0.844 | 1e-21 | |
| 342905893 | 114 | ribosomal protein L36e [Rhodnius prolixu | 0.408 | 0.508 | 0.827 | 1e-20 | |
| 70909879 | 110 | ribosomal protein L36e [Timarcha baleari | 0.408 | 0.527 | 0.810 | 2e-20 | |
| 70909877 | 111 | ribosomal protein L36e [Cicindela littor | 0.394 | 0.504 | 0.839 | 3e-20 | |
| 264667401 | 110 | ribosomal protein L36 [Chrysomela tremul | 0.408 | 0.527 | 0.793 | 4e-20 | |
| 347968856 | 113 | AGAP002921-PA [Anopheles gambiae str. PE | 0.408 | 0.513 | 0.827 | 4e-20 | |
| 70909873 | 112 | ribosomal protein L36e [Agriotes lineatu | 0.408 | 0.517 | 0.793 | 7e-20 | |
| 215259505 | 143 | 60S ribosomal protein L36 [Culex tarsali | 0.408 | 0.405 | 0.810 | 9e-20 | |
| 342356403 | 120 | ribosomal protein L36 [Heliconius melpom | 0.408 | 0.483 | 0.793 | 1e-19 | |
| 315115415 | 122 | ribosomal protein L36 [Euphydryas aurini | 0.408 | 0.475 | 0.793 | 1e-19 |
| >gi|237761916|emb|CAR94544.1| ribosomal protein L36e [Blattella germanica] | Back alignment and taxonomy information |
|---|
Score = 107 bits (267), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 49/58 (84%), Positives = 55/58 (94%)
Query: 1 MRPSRLKGIQTKNTKFTRDLVREVCGHAPYEKRAMELLKVSKDKRALKFLKRRVSLYV 58
+RPSRLKGIQTK+TKF RDL+REVCGHAPYEKRAMELLKVSKDKRALKFLKRR+ ++
Sbjct: 33 IRPSRLKGIQTKHTKFVRDLIREVCGHAPYEKRAMELLKVSKDKRALKFLKRRLGTHI 90
|
Source: Blattella germanica Species: Blattella germanica Genus: Blattella Family: Ectobiidae Order: Blattodea Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|342905893|gb|AEL79230.1| ribosomal protein L36e [Rhodnius prolixus] | Back alignment and taxonomy information |
|---|
| >gi|70909879|emb|CAJ17426.1| ribosomal protein L36e [Timarcha balearica] | Back alignment and taxonomy information |
|---|
| >gi|70909877|emb|CAJ17425.1| ribosomal protein L36e [Cicindela littoralis] | Back alignment and taxonomy information |
|---|
| >gi|264667401|gb|ACY71286.1| ribosomal protein L36 [Chrysomela tremula] | Back alignment and taxonomy information |
|---|
| >gi|347968856|ref|XP_311984.4| AGAP002921-PA [Anopheles gambiae str. PEST] gi|347968858|ref|XP_003436309.1| AGAP002921-PB [Anopheles gambiae str. PEST] gi|333467808|gb|EAA08114.5| AGAP002921-PA [Anopheles gambiae str. PEST] gi|333467809|gb|EGK96704.1| AGAP002921-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|70909873|emb|CAJ17423.1| ribosomal protein L36e [Agriotes lineatus] | Back alignment and taxonomy information |
|---|
| >gi|215259505|gb|ACJ64244.1| 60S ribosomal protein L36 [Culex tarsalis] | Back alignment and taxonomy information |
|---|
| >gi|342356403|gb|AEL28860.1| ribosomal protein L36 [Heliconius melpomene cythera] | Back alignment and taxonomy information |
|---|
| >gi|315115415|gb|ADT80680.1| ribosomal protein L36 [Euphydryas aurinia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| FB|FBgn0002579 | 115 | RpL36 "Ribosomal protein L36" | 0.408 | 0.504 | 0.775 | 4e-19 | |
| MGI|MGI:3645343 | 104 | Gm5745 "predicted gene 5745" [ | 0.401 | 0.548 | 0.701 | 2e-17 | |
| RGD|1563135 | 105 | RGD1563135 "hypothetical gene | 0.401 | 0.542 | 0.701 | 2.5e-17 | |
| RGD|2325111 | 105 | LOC100359616 "ribosomal protei | 0.401 | 0.542 | 0.701 | 2.5e-17 | |
| UNIPROTKB|Q3T171 | 105 | RPL36 "60S ribosomal protein L | 0.401 | 0.542 | 0.701 | 3.2e-17 | |
| UNIPROTKB|Q9Y3U8 | 105 | RPL36 "60S ribosomal protein L | 0.401 | 0.542 | 0.701 | 3.2e-17 | |
| UNIPROTKB|F2Z5K6 | 105 | RPL36 "Uncharacterized protein | 0.401 | 0.542 | 0.701 | 3.2e-17 | |
| UNIPROTKB|G3MYF8 | 105 | RPL36 "60S ribosomal protein L | 0.401 | 0.542 | 0.701 | 4.1e-17 | |
| RGD|2319728 | 104 | LOC100361644 "ribosomal protei | 0.401 | 0.548 | 0.684 | 6.7e-17 | |
| RGD|2320881 | 104 | LOC100361079 "ribosomal protei | 0.401 | 0.548 | 0.684 | 6.7e-17 |
| FB|FBgn0002579 RpL36 "Ribosomal protein L36" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 229 (85.7 bits), Expect = 4.0e-19, P = 4.0e-19
Identities = 45/58 (77%), Positives = 51/58 (87%)
Query: 1 MRPSRLKGIQTKNTKFTRDLVREVCGHAPYEKRAMELLKVSKDKRALKFLKRRVSLYV 58
+R SRLK IQT++TKF RDLVREV GHAPYEKR MELLKVSKDKRALKFLKRR+ ++
Sbjct: 34 LRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHI 91
|
|
| MGI|MGI:3645343 Gm5745 "predicted gene 5745" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1563135 RGD1563135 "hypothetical gene supported by NM_022504" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2325111 LOC100359616 "ribosomal protein L36-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T171 RPL36 "60S ribosomal protein L36" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y3U8 RPL36 "60S ribosomal protein L36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5K6 RPL36 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MYF8 RPL36 "60S ribosomal protein L36" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|2319728 LOC100361644 "ribosomal protein L36-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2320881 LOC100361079 "ribosomal protein L36-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| pfam01158 | 95 | pfam01158, Ribosomal_L36e, Ribosomal protein L36e | 4e-26 | |
| PTZ00196 | 98 | PTZ00196, PTZ00196, 60S ribosomal protein L36; Pro | 2e-15 | |
| COG5051 | 97 | COG5051, RPL36A, Ribosomal protein L36E [Translati | 3e-11 |
| >gnl|CDD|201631 pfam01158, Ribosomal_L36e, Ribosomal protein L36e | Back alignment and domain information |
|---|
Score = 93.8 bits (234), Expect = 4e-26
Identities = 37/53 (69%), Positives = 43/53 (81%)
Query: 2 RPSRLKGIQTKNTKFTRDLVREVCGHAPYEKRAMELLKVSKDKRALKFLKRRV 54
RPSR KG +K TKF RD++REV G APYEKR +ELLKV KDKRALKF K+R+
Sbjct: 20 RPSRRKGKLSKRTKFVRDIIREVAGFAPYEKRVIELLKVGKDKRALKFAKKRL 72
|
Length = 95 |
| >gnl|CDD|185509 PTZ00196, PTZ00196, 60S ribosomal protein L36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227384 COG5051, RPL36A, Ribosomal protein L36E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| PTZ00196 | 98 | 60S ribosomal protein L36; Provisional | 99.97 | |
| PF01158 | 98 | Ribosomal_L36e: Ribosomal protein L36e; InterPro: | 99.97 | |
| KOG3452|consensus | 102 | 99.96 | ||
| COG5051 | 97 | RPL36A Ribosomal protein L36E [Translation, riboso | 99.85 |
| >PTZ00196 60S ribosomal protein L36; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=6.9e-33 Score=204.08 Aligned_cols=61 Identities=48% Similarity=0.834 Sum_probs=59.4
Q ss_pred CCcCcccCCCCcchHHHHHHhhhhccccchhHhHHHHhhccchhhHHHHHHhhhhceeecc
Q psy1718 1 MRPSRLKGIQTKNTKFTRDLVREVCGHAPYEKRAMELLKVSKDKRALKFLKRRVSLYVLRS 61 (142)
Q Consensus 1 ~R~SrrKG~lTKrtKfVRdiIREV~GFAPYERRaMELLKVSKDKRALKFaKKRLGTHiRr~ 61 (142)
+|||+++|.+|||++||||||+|||||||||+|+|||||+|+||+||||+|||||||+||-
T Consensus 22 ~r~s~rkg~~tkr~~fVr~vIrEV~GfaPYErr~mELLkv~kdKrAlKfaKkRlGth~RaK 82 (98)
T PTZ00196 22 PSPSKRKGLLSKRKRLVKDVIREVCGFSPYERRMIELLKVGKDKRALKYAKKRLGTHKRAK 82 (98)
T ss_pred CCcccccCCCCchhHHHHHHHHHHhcccHHHHHHHHHHHhcchHHHHHHHHHHhhhHHHHH
Confidence 5899999999999999999999999999999999999999999999999999999999984
|
|
| >PF01158 Ribosomal_L36e: Ribosomal protein L36e; InterPro: IPR000509 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG3452|consensus | Back alignment and domain information |
|---|
| >COG5051 RPL36A Ribosomal protein L36E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 142 | ||||
| 3izr_k | 112 | Localization Of The Large Subunit Ribosomal Protein | 2e-12 | ||
| 3izs_k | 100 | Localization Of The Large Subunit Ribosomal Protein | 2e-07 | ||
| 3zf7_m | 109 | High-resolution Cryo-electron Microscopy Structure | 9e-05 | ||
| 4a18_Q | 104 | T.Thermophila 60s Ribosomal Subunit In Complex With | 3e-04 |
| >pdb|3IZR|KK Chain k, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 112 | Back alignment and structure |
|
| >pdb|3IZS|KK Chain k, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 100 | Back alignment and structure |
| >pdb|3ZF7|MM Chain m, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 109 | Back alignment and structure |
| >pdb|4A18|Q Chain Q, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 104 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 3izc_K | 199 | 60S ribosomal protein RPL16 (L13P); eukaryotic rib | 2e-19 | |
| 3iz5_K | 206 | 60S ribosomal protein L13A (L13P); eukaryotic ribo | 1e-18 | |
| 4a18_Q | 104 | RPL36, 60S ribosomal protein L36; ribosome, eukary | 6e-18 |
| >4a18_Q RPL36, 60S ribosomal protein L36; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_Q 4a1b_Q 4a1d_Q Length = 104 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 3izc_k | 100 | 60S ribosomal protein RPL36 (L36E); eukaryotic rib | 99.97 | |
| 4a18_Q | 104 | RPL36, 60S ribosomal protein L36; ribosome, eukary | 99.97 | |
| 3iz5_k | 112 | 60S ribosomal protein L36 (L36E); eukaryotic ribos | 99.97 |
| >4a18_Q RPL36, 60S ribosomal protein L36; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_Q 4a1b_Q 4a1d_Q | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00