Psyllid ID: psy17192
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 74 | ||||||
| 170043212 | 469 | bleomycin hydrolase [Culex quinquefascia | 1.0 | 0.157 | 0.675 | 3e-24 | |
| 189238112 | 456 | PREDICTED: similar to CG1440 CG1440-PC [ | 0.972 | 0.157 | 0.694 | 1e-23 | |
| 157117597 | 455 | bleomycin hydrolase [Aedes aegypti] gi|9 | 1.0 | 0.162 | 0.662 | 2e-23 | |
| 321474511 | 460 | hypothetical protein DAPPUDRAFT_300309 [ | 0.986 | 0.158 | 0.602 | 2e-22 | |
| 345490081 | 472 | PREDICTED: bleomycin hydrolase-like isof | 0.891 | 0.139 | 0.696 | 5e-22 | |
| 389609585 | 248 | bleomycin hydrolase [Papilio xuthus] | 0.945 | 0.282 | 0.685 | 5e-22 | |
| 345490079 | 456 | PREDICTED: bleomycin hydrolase-like isof | 0.891 | 0.144 | 0.696 | 6e-22 | |
| 30584035 | 456 | Homo sapiens bleomycin hydrolase [synthe | 0.891 | 0.144 | 0.712 | 7e-22 | |
| 62898367 | 455 | bleomycin hydrolase variant [Homo sapien | 0.891 | 0.145 | 0.712 | 7e-22 | |
| 4557367 | 455 | bleomycin hydrolase [Homo sapiens] gi|42 | 0.891 | 0.145 | 0.712 | 7e-22 |
| >gi|170043212|ref|XP_001849291.1| bleomycin hydrolase [Culex quinquefasciatus] gi|167866605|gb|EDS29988.1| bleomycin hydrolase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 115 bits (289), Expect = 3e-24, Method: Compositional matrix adjust.
Identities = 50/74 (67%), Positives = 63/74 (85%)
Query: 1 MDQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEP 60
+DQ T+ PTK+RVENSWGE++ KGY++MT+ WFKE+VFEVVVD+ VP VLDVF+ P
Sbjct: 396 VDQNTQRPTKFRVENSWGEDRGEKGYLIMTAEWFKEFVFEVVVDRSIVPQDVLDVFDLPP 455
Query: 61 TILPAWDPMGTLAQ 74
T+LPAWDPMGTLA+
Sbjct: 456 TVLPAWDPMGTLAK 469
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189238112|ref|XP_001814047.1| PREDICTED: similar to CG1440 CG1440-PC [Tribolium castaneum] gi|270008738|gb|EFA05186.1| hypothetical protein TcasGA2_TC015316 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157117597|ref|XP_001658844.1| bleomycin hydrolase [Aedes aegypti] gi|94469102|gb|ABF18400.1| bleomycin hydrolase [Aedes aegypti] gi|108875988|gb|EAT40213.1| AAEL008041-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|321474511|gb|EFX85476.1| hypothetical protein DAPPUDRAFT_300309 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|345490081|ref|XP_003426293.1| PREDICTED: bleomycin hydrolase-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|389609585|dbj|BAM18404.1| bleomycin hydrolase [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|345490079|ref|XP_001599607.2| PREDICTED: bleomycin hydrolase-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|30584035|gb|AAP36266.1| Homo sapiens bleomycin hydrolase [synthetic construct] gi|61371631|gb|AAX43703.1| bleomycin hydrolase [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|62898367|dbj|BAD97123.1| bleomycin hydrolase variant [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|4557367|ref|NP_000377.1| bleomycin hydrolase [Homo sapiens] gi|426348858|ref|XP_004042039.1| PREDICTED: bleomycin hydrolase [Gorilla gorilla gorilla] gi|3023394|sp|Q13867.1|BLMH_HUMAN RecName: Full=Bleomycin hydrolase; Short=BH; Short=BLM hydrolase; Short=BMH gi|1321858|emb|CAA63078.1| bleomycin hydrolase [Homo sapiens] gi|13177661|gb|AAH03616.1| Bleomycin hydrolase [Homo sapiens] gi|30582875|gb|AAP35664.1| bleomycin hydrolase [Homo sapiens] gi|60655031|gb|AAX32079.1| bleomycin hydrolase [synthetic construct] gi|119571609|gb|EAW51224.1| bleomycin hydrolase [Homo sapiens] gi|189053583|dbj|BAG35743.1| unnamed protein product [Homo sapiens] gi|208965884|dbj|BAG72956.1| bleomycin hydrolase [synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 74 | ||||||
| UNIPROTKB|F1RN71 | 192 | LOC100521221 "Uncharacterized | 0.972 | 0.375 | 0.684 | 4.2e-24 | |
| UNIPROTKB|E7EMN3 | 368 | BLMH "Bleomycin hydrolase" [Ho | 0.891 | 0.179 | 0.712 | 8.7e-24 | |
| MGI|MGI:1345186 | 455 | Blmh "bleomycin hydrolase" [Mu | 0.986 | 0.160 | 0.64 | 1.7e-23 | |
| UNIPROTKB|Q13867 | 455 | BLMH "Bleomycin hydrolase" [Ho | 0.891 | 0.145 | 0.712 | 2.2e-23 | |
| UNIPROTKB|P87362 | 455 | BLMH "Bleomycin hydrolase" [Ga | 0.878 | 0.142 | 0.707 | 3.7e-23 | |
| RGD|1304668 | 454 | Blmh "bleomycin hydrolase" [Ra | 0.959 | 0.156 | 0.680 | 6.2e-23 | |
| UNIPROTKB|P70645 | 454 | Blmh "Bleomycin hydrolase" [Ra | 0.959 | 0.156 | 0.680 | 6.2e-23 | |
| UNIPROTKB|E1BL29 | 459 | BLMH "Uncharacterized protein" | 0.878 | 0.141 | 0.707 | 6.5e-23 | |
| UNIPROTKB|E2R857 | 455 | BLMH "Uncharacterized protein" | 0.878 | 0.142 | 0.692 | 1.4e-22 | |
| FB|FBgn0030038 | 511 | CG1440 [Drosophila melanogaste | 0.878 | 0.127 | 0.676 | 4.5e-21 |
| UNIPROTKB|F1RN71 LOC100521221 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
Identities = 50/73 (68%), Positives = 56/73 (76%)
Query: 2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
DQE TKWRVENSWGE+ HKGY+ MT WF EYV+EVVVDKK+VP VL V QEP
Sbjct: 121 DQEGAF-TKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDKKHVPEEVLAVLEQEPI 179
Query: 62 ILPAWDPMGTLAQ 74
+LPAWDPMG LA+
Sbjct: 180 VLPAWDPMGALAE 192
|
|
| UNIPROTKB|E7EMN3 BLMH "Bleomycin hydrolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1345186 Blmh "bleomycin hydrolase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13867 BLMH "Bleomycin hydrolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P87362 BLMH "Bleomycin hydrolase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1304668 Blmh "bleomycin hydrolase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70645 Blmh "Bleomycin hydrolase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BL29 BLMH "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R857 BLMH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030038 CG1440 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 74 | |||
| cd00585 | 437 | cd00585, Peptidase_C1B, Peptidase C1B subfamily (M | 6e-33 | |
| pfam03051 | 438 | pfam03051, Peptidase_C1_2, Peptidase C1-like famil | 9e-32 | |
| COG3579 | 444 | COG3579, PepC, Aminopeptidase C [Amino acid transp | 3e-26 |
| >gnl|CDD|238328 cd00585, Peptidase_C1B, Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
Score = 116 bits (293), Expect = 6e-33
Identities = 41/67 (61%), Positives = 51/67 (76%)
Query: 4 ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTIL 63
E +P KW+VENSWGE+ KGY +M+ WF EYV++VVVDKKY+P VLD+ QEP +L
Sbjct: 371 EDGKPVKWKVENSWGEKVGKKGYFVMSDDWFDEYVYQVVVDKKYLPEEVLDLLKQEPIVL 430
Query: 64 PAWDPMG 70
P WDPMG
Sbjct: 431 PPWDPMG 437
|
The proteins of this subfamily contain a large insert relative to the C1A peptidase (papain) subfamily. BH is a cysteine peptidase that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. Bleomycin, a glycopeptide derived from the fungus Streptomyces verticullus, is an effective anticancer drug due to its ability to induce DNA strand breaks. Human BH is the major cause of tumor cell resistance to bleomycin chemotherapy, and is also genetically linked to Alzheimer's disease. In addition to its peptidase activity, the yeast BH (Gal6) binds DNA and acts as a repressor in the Gal4 regulatory system. BH forms a hexameric ring barrel structure with the active sites imbedded in the central channel. The bacterial homolog of BH, called pepC, is a cysteine aminopeptidase possessing broad specificity. Although its crystal structure has not been solved, biochemical analysis shows that pepC also forms a hexamer. . Length = 437 |
| >gnl|CDD|202517 pfam03051, Peptidase_C1_2, Peptidase C1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|226107 COG3579, PepC, Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 74 | |||
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 100.0 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 100.0 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.97 | |
| KOG4128|consensus | 457 | 99.94 | ||
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 98.82 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 98.67 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 98.67 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 98.66 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 98.61 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 98.59 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 98.55 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 98.51 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 98.5 | |
| KOG1542|consensus | 372 | 98.38 | ||
| KOG1543|consensus | 325 | 98.33 | ||
| PTZ00021 | 489 | falcipain-2; Provisional | 98.24 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 98.14 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 98.13 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 98.11 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 98.1 | |
| KOG1544|consensus | 470 | 96.63 |
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-35 Score=225.74 Aligned_cols=71 Identities=46% Similarity=1.102 Sum_probs=69.5
Q ss_pred CCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccCC
Q psy17192 4 ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ 74 (74)
Q Consensus 4 ~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~~ 74 (74)
++|+|.|||||||||++.|.+|||+|||+||+||+|||||+|++||+++++++..|||+|+|||||||||.
T Consensus 374 ~~g~p~rwkVENSWG~d~G~~GyfvaSd~wmdEytyQIvV~k~~l~~e~~~a~~~epivL~pWDPMGALA~ 444 (444)
T COG3579 374 ETGNPLRWKVENSWGKDVGKKGYFVASDAWMDEYTYQIVVDKKFLPKEELAAYEEEPIVLAPWDPMGALAK 444 (444)
T ss_pred cCCCceeeEeecccccccCCCceEeehHhHhhhheeEEEEehhhCCHHHHHhhcCCCeecCCCCccccccC
Confidence 67899999999999999999999999999999999999999999999999999999999999999999985
|
|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 74 | ||||
| 1cb5_A | 453 | Human Bleomycin Hydrolase. Length = 453 | 2e-24 | ||
| 2cb5_A | 453 | Human Bleomycin Hydrolase, C73s/dele455 Mutant Leng | 2e-24 | ||
| 1a6r_A | 471 | Gal6 (Yeast Bleomycin Hydrolase) Mutant C73a Length | 2e-14 | ||
| 1gcb_A | 454 | Gal6, Yeast Bleomycin Hydrolase Dna-Binding Proteas | 2e-14 | ||
| 3gcb_A | 470 | Gal6 (Yeast Bleomycin Hydrolase) Mutant C73aDELTAK4 | 3e-14 | ||
| 2e03_A | 457 | Crystal Structure Of Nq67e Mutant Of Yeast Bleomyci | 3e-14 | ||
| 2e02_A | 457 | Crystal Structure Of H369l Mutant Of Yeast Bleomyci | 3e-14 | ||
| 2e01_A | 457 | Crystal Structure Of H369a Mutant Of Yeast Bleomyci | 3e-14 | ||
| 2dzy_A | 457 | Crystal Structure Of N392a Mutant Of Yeast Bleomyci | 2e-13 | ||
| 2e00_A | 457 | Crystal Structure Of N392l Mutant Of Yeast Bleomyci | 3e-13 | ||
| 2dzz_A | 457 | Crystal Structure Of N392v Mutant Of Yeast Bleomyci | 3e-13 |
| >pdb|1CB5|A Chain A, Human Bleomycin Hydrolase. Length = 453 | Back alignment and structure |
|
| >pdb|2CB5|A Chain A, Human Bleomycin Hydrolase, C73s/dele455 Mutant Length = 453 | Back alignment and structure |
| >pdb|1A6R|A Chain A, Gal6 (Yeast Bleomycin Hydrolase) Mutant C73a Length = 471 | Back alignment and structure |
| >pdb|1GCB|A Chain A, Gal6, Yeast Bleomycin Hydrolase Dna-Binding Protease (Thiol) Length = 454 | Back alignment and structure |
| >pdb|3GCB|A Chain A, Gal6 (Yeast Bleomycin Hydrolase) Mutant C73aDELTAK454 Length = 470 | Back alignment and structure |
| >pdb|2E03|A Chain A, Crystal Structure Of Nq67e Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
| >pdb|2E02|A Chain A, Crystal Structure Of H369l Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
| >pdb|2E01|A Chain A, Crystal Structure Of H369a Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
| >pdb|2DZY|A Chain A, Crystal Structure Of N392a Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
| >pdb|2E00|A Chain A, Crystal Structure Of N392l Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
| >pdb|2DZZ|A Chain A, Crystal Structure Of N392v Mutant Of Yeast Bleomycin Hydrolase Length = 457 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 74 | |||
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 2e-29 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 3e-28 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 1e-19 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 7e-04 |
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Length = 453 | Back alignment and structure |
|---|
Score = 106 bits (266), Expect = 2e-29
Identities = 48/72 (66%), Positives = 54/72 (75%)
Query: 2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
D + TKWRVENSWGE+ HKGY+ MT WF EYV+EVVVD+K+VP VL V QEP
Sbjct: 382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPI 441
Query: 62 ILPAWDPMGTLA 73
ILPAWDPMG LA
Sbjct: 442 ILPAWDPMGALA 453
|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 74 | |||
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.97 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.85 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 98.99 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 98.85 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 98.84 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 98.83 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 98.82 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 98.82 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 98.82 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 98.81 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 98.77 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 98.76 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 98.75 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 98.74 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 98.73 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 98.72 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 98.72 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 98.72 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 98.71 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 98.7 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 98.69 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 98.68 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 98.67 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 98.67 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 98.67 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 98.65 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 98.65 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 98.64 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 98.64 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 98.62 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 98.62 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 98.62 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 98.61 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 98.6 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 98.59 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 98.59 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 98.58 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 98.56 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 98.55 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 98.55 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 98.55 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 98.4 |
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-33 Score=218.04 Aligned_cols=70 Identities=67% Similarity=1.231 Sum_probs=68.1
Q ss_pred CCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccC
Q psy17192 4 ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA 73 (74)
Q Consensus 4 ~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~ 73 (74)
++|+|.||+||||||+++|++|||+|+++||++|||+|||||++||++++++|+++||+||||||||+||
T Consensus 384 ~~G~~~yWiVkNSWG~~wG~~GY~~ms~~wf~ey~~~vvV~k~~l~~~~~~~l~~~p~~Lp~WDpmg~la 453 (453)
T 2cb5_A 384 QDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA 453 (453)
T ss_dssp SCSCEEEEEEECSBCTTSTBTTEEEEEHHHHHHHEEEEEEEGGGSCHHHHGGGGSCCEEECTTCSSCCBC
T ss_pred cCCCccEEEEEcCcCCCcCcCceEEechhhHhhceEEEEechhhCCHHHHHHhcCCCeeCCCCCcccccC
Confidence 3788789999999999999999999999999999999999999999999999999999999999999997
|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 74 | ||||
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 1e-34 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 2e-33 |
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Bleomycin hydrolase species: Human (Homo sapiens) [TaxId: 9606]
Score = 119 bits (300), Expect = 1e-34
Identities = 48/72 (66%), Positives = 54/72 (75%)
Query: 2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
D + TKWRVENSWGE+ HKGY+ MT WF EYV+EVVVD+K+VP VL V QEP
Sbjct: 382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPI 441
Query: 62 ILPAWDPMGTLA 73
ILPAWDPMG LA
Sbjct: 442 ILPAWDPMGALA 453
|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 74 | |||
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 98.86 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 98.86 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 98.85 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 98.83 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 98.83 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 98.82 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 98.8 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 98.78 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 98.77 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 98.77 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 98.76 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 98.76 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 98.76 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 98.72 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 98.72 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 98.72 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 98.71 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 98.71 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 98.59 |
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Bleomycin hydrolase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.7e-37 Score=235.42 Aligned_cols=72 Identities=67% Similarity=1.222 Sum_probs=70.3
Q ss_pred CCCCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccC
Q psy17192 2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA 73 (74)
Q Consensus 2 d~~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~ 73 (74)
|+++|+++|||||||||++.|++|||+||++||++|||+|||||++||++++++|+++||+|||||||||||
T Consensus 382 dd~~G~~~~w~VENSWG~~~g~kGy~~Msd~WF~eyv~eivV~K~~lp~~i~~~l~~~p~~Lp~WDpmGaLA 453 (453)
T d2cb5a_ 382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA 453 (453)
T ss_dssp TTSCSCEEEEEEECSBCTTSTBTTEEEEEHHHHHHHEEEEEEEGGGSCHHHHGGGGSCCEEECTTCSSCCBC
T ss_pred cccCCCEeEEEEEccccCcCCCCceEEecHHHHHhccEEEEEEhhhCCHHHHHHhcCCCeECCCCCCccccC
Confidence 468999999999999999999999999999999999999999999999999999999999999999999998
|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|