Psyllid ID: psy17192


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MDQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ
cccccccEEEEEEEcccccccccEEEEEEEHHHHHHccEEEEEEcccccHHHHHHHccccEEEccccccccccc
ccccccccEEEEEEccEcccccEccEEEEEHHHHHHHEEEEEEEHHHccHHHHHHHHcccEEEccccccccEcc
mdqeteeptkwrvenswgeeqnhkgyilmtspwfKEYVFEVVvdkkyvpasvldvfnqeptilpawdpmgtlaq
mdqeteeptkwrvenswgeeqnhkGYILMTSPWFKEYVFEVVVDKKYVPASVLDVfnqeptilpawDPMGTLAQ
MDQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ
****************W***QNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWD*******
MD*ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA*
************VENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ
****TEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
Q13867455 Bleomycin hydrolase OS=Ho yes N/A 0.891 0.145 0.712 2e-23
Q8R016455 Bleomycin hydrolase OS=Mu yes N/A 0.986 0.160 0.64 6e-23
P70645454 Bleomycin hydrolase OS=Ra yes N/A 0.878 0.143 0.707 9e-23
P87362455 Bleomycin hydrolase OS=Ga yes N/A 0.878 0.142 0.707 9e-23
O69192441 Aminopeptidase C OS=Liste yes N/A 0.905 0.151 0.492 3e-15
Q928V0441 Aminopeptidase C OS=Liste yes N/A 0.905 0.151 0.462 5e-14
P94868437 Aminopeptidase W OS=Lacto N/A N/A 0.932 0.157 0.434 2e-13
Q01532483 Cysteine proteinase 1, mi yes N/A 1.0 0.153 0.415 2e-13
C8ZFZ7483 Cysteine proteinase 1, mi N/A N/A 1.0 0.153 0.415 2e-13
B5VQH0483 Cysteine proteinase 1, mi N/A N/A 1.0 0.153 0.415 2e-13
>sp|Q13867|BLMH_HUMAN Bleomycin hydrolase OS=Homo sapiens GN=BLMH PE=1 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%)

Query: 9   TKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDP 68
           TKWRVENSWGE+  HKGY+ MT  WF EYV+EVVVD+K+VP  VL V  QEP ILPAWDP
Sbjct: 390 TKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDP 449

Query: 69  MGTLAQ 74
           MG LA+
Sbjct: 450 MGALAE 455




The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 4EC: 0
>sp|Q8R016|BLMH_MOUSE Bleomycin hydrolase OS=Mus musculus GN=Blmh PE=2 SV=1 Back     alignment and function description
>sp|P70645|BLMH_RAT Bleomycin hydrolase OS=Rattus norvegicus GN=Blmh PE=1 SV=1 Back     alignment and function description
>sp|P87362|BLMH_CHICK Bleomycin hydrolase OS=Gallus gallus GN=BLMH PE=1 SV=1 Back     alignment and function description
>sp|O69192|PEPC_LISMO Aminopeptidase C OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pepC PE=3 SV=1 Back     alignment and function description
>sp|Q928V0|PEPC_LISIN Aminopeptidase C OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pepC PE=3 SV=1 Back     alignment and function description
>sp|P94868|PEPW_LACDL Aminopeptidase W OS=Lactobacillus delbrueckii subsp. lactis GN=pepW PE=3 SV=1 Back     alignment and function description
>sp|Q01532|BLH1_YEAST Cysteine proteinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAP3 PE=1 SV=3 Back     alignment and function description
>sp|C8ZFZ7|BLH1_YEAS8 Cysteine proteinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LAP3 PE=3 SV=2 Back     alignment and function description
>sp|B5VQH0|BLH1_YEAS6 Cysteine proteinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LAP3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
170043212 469 bleomycin hydrolase [Culex quinquefascia 1.0 0.157 0.675 3e-24
189238112 456 PREDICTED: similar to CG1440 CG1440-PC [ 0.972 0.157 0.694 1e-23
157117597 455 bleomycin hydrolase [Aedes aegypti] gi|9 1.0 0.162 0.662 2e-23
321474511 460 hypothetical protein DAPPUDRAFT_300309 [ 0.986 0.158 0.602 2e-22
345490081 472 PREDICTED: bleomycin hydrolase-like isof 0.891 0.139 0.696 5e-22
389609585 248 bleomycin hydrolase [Papilio xuthus] 0.945 0.282 0.685 5e-22
345490079 456 PREDICTED: bleomycin hydrolase-like isof 0.891 0.144 0.696 6e-22
30584035 456 Homo sapiens bleomycin hydrolase [synthe 0.891 0.144 0.712 7e-22
62898367 455 bleomycin hydrolase variant [Homo sapien 0.891 0.145 0.712 7e-22
4557367 455 bleomycin hydrolase [Homo sapiens] gi|42 0.891 0.145 0.712 7e-22
>gi|170043212|ref|XP_001849291.1| bleomycin hydrolase [Culex quinquefasciatus] gi|167866605|gb|EDS29988.1| bleomycin hydrolase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 63/74 (85%)

Query: 1   MDQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEP 60
           +DQ T+ PTK+RVENSWGE++  KGY++MT+ WFKE+VFEVVVD+  VP  VLDVF+  P
Sbjct: 396 VDQNTQRPTKFRVENSWGEDRGEKGYLIMTAEWFKEFVFEVVVDRSIVPQDVLDVFDLPP 455

Query: 61  TILPAWDPMGTLAQ 74
           T+LPAWDPMGTLA+
Sbjct: 456 TVLPAWDPMGTLAK 469




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189238112|ref|XP_001814047.1| PREDICTED: similar to CG1440 CG1440-PC [Tribolium castaneum] gi|270008738|gb|EFA05186.1| hypothetical protein TcasGA2_TC015316 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157117597|ref|XP_001658844.1| bleomycin hydrolase [Aedes aegypti] gi|94469102|gb|ABF18400.1| bleomycin hydrolase [Aedes aegypti] gi|108875988|gb|EAT40213.1| AAEL008041-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|321474511|gb|EFX85476.1| hypothetical protein DAPPUDRAFT_300309 [Daphnia pulex] Back     alignment and taxonomy information
>gi|345490081|ref|XP_003426293.1| PREDICTED: bleomycin hydrolase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|389609585|dbj|BAM18404.1| bleomycin hydrolase [Papilio xuthus] Back     alignment and taxonomy information
>gi|345490079|ref|XP_001599607.2| PREDICTED: bleomycin hydrolase-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|30584035|gb|AAP36266.1| Homo sapiens bleomycin hydrolase [synthetic construct] gi|61371631|gb|AAX43703.1| bleomycin hydrolase [synthetic construct] Back     alignment and taxonomy information
>gi|62898367|dbj|BAD97123.1| bleomycin hydrolase variant [Homo sapiens] Back     alignment and taxonomy information
>gi|4557367|ref|NP_000377.1| bleomycin hydrolase [Homo sapiens] gi|426348858|ref|XP_004042039.1| PREDICTED: bleomycin hydrolase [Gorilla gorilla gorilla] gi|3023394|sp|Q13867.1|BLMH_HUMAN RecName: Full=Bleomycin hydrolase; Short=BH; Short=BLM hydrolase; Short=BMH gi|1321858|emb|CAA63078.1| bleomycin hydrolase [Homo sapiens] gi|13177661|gb|AAH03616.1| Bleomycin hydrolase [Homo sapiens] gi|30582875|gb|AAP35664.1| bleomycin hydrolase [Homo sapiens] gi|60655031|gb|AAX32079.1| bleomycin hydrolase [synthetic construct] gi|119571609|gb|EAW51224.1| bleomycin hydrolase [Homo sapiens] gi|189053583|dbj|BAG35743.1| unnamed protein product [Homo sapiens] gi|208965884|dbj|BAG72956.1| bleomycin hydrolase [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
UNIPROTKB|F1RN71192 LOC100521221 "Uncharacterized 0.972 0.375 0.684 4.2e-24
UNIPROTKB|E7EMN3368 BLMH "Bleomycin hydrolase" [Ho 0.891 0.179 0.712 8.7e-24
MGI|MGI:1345186455 Blmh "bleomycin hydrolase" [Mu 0.986 0.160 0.64 1.7e-23
UNIPROTKB|Q13867455 BLMH "Bleomycin hydrolase" [Ho 0.891 0.145 0.712 2.2e-23
UNIPROTKB|P87362455 BLMH "Bleomycin hydrolase" [Ga 0.878 0.142 0.707 3.7e-23
RGD|1304668454 Blmh "bleomycin hydrolase" [Ra 0.959 0.156 0.680 6.2e-23
UNIPROTKB|P70645454 Blmh "Bleomycin hydrolase" [Ra 0.959 0.156 0.680 6.2e-23
UNIPROTKB|E1BL29459 BLMH "Uncharacterized protein" 0.878 0.141 0.707 6.5e-23
UNIPROTKB|E2R857455 BLMH "Uncharacterized protein" 0.878 0.142 0.692 1.4e-22
FB|FBgn0030038511 CG1440 [Drosophila melanogaste 0.878 0.127 0.676 4.5e-21
UNIPROTKB|F1RN71 LOC100521221 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
 Identities = 50/73 (68%), Positives = 56/73 (76%)

Query:     2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
             DQE    TKWRVENSWGE+  HKGY+ MT  WF EYV+EVVVDKK+VP  VL V  QEP 
Sbjct:   121 DQEGAF-TKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDKKHVPEEVLAVLEQEPI 179

Query:    62 ILPAWDPMGTLAQ 74
             +LPAWDPMG LA+
Sbjct:   180 VLPAWDPMGALAE 192




GO:0006508 "proteolysis" evidence=IEA
GO:0004197 "cysteine-type endopeptidase activity" evidence=IEA
UNIPROTKB|E7EMN3 BLMH "Bleomycin hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1345186 Blmh "bleomycin hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q13867 BLMH "Bleomycin hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P87362 BLMH "Bleomycin hydrolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1304668 Blmh "bleomycin hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P70645 Blmh "Bleomycin hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BL29 BLMH "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R857 BLMH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0030038 CG1440 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P70645BLMH_RAT3, ., 4, ., 2, 2, ., 4, 00.70760.87830.1431yesN/A
P87362BLMH_CHICK3, ., 4, ., 2, 2, ., 4, 00.70760.87830.1428yesN/A
Q8R016BLMH_MOUSE3, ., 4, ., 2, 2, ., 4, 00.640.98640.1604yesN/A
Q13867BLMH_HUMAN3, ., 4, ., 2, 2, ., 4, 00.71210.89180.1450yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
cd00585437 cd00585, Peptidase_C1B, Peptidase C1B subfamily (M 6e-33
pfam03051438 pfam03051, Peptidase_C1_2, Peptidase C1-like famil 9e-32
COG3579444 COG3579, PepC, Aminopeptidase C [Amino acid transp 3e-26
>gnl|CDD|238328 cd00585, Peptidase_C1B, Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
 Score =  116 bits (293), Expect = 6e-33
 Identities = 41/67 (61%), Positives = 51/67 (76%)

Query: 4   ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTIL 63
           E  +P KW+VENSWGE+   KGY +M+  WF EYV++VVVDKKY+P  VLD+  QEP +L
Sbjct: 371 EDGKPVKWKVENSWGEKVGKKGYFVMSDDWFDEYVYQVVVDKKYLPEEVLDLLKQEPIVL 430

Query: 64  PAWDPMG 70
           P WDPMG
Sbjct: 431 PPWDPMG 437


The proteins of this subfamily contain a large insert relative to the C1A peptidase (papain) subfamily. BH is a cysteine peptidase that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. Bleomycin, a glycopeptide derived from the fungus Streptomyces verticullus, is an effective anticancer drug due to its ability to induce DNA strand breaks. Human BH is the major cause of tumor cell resistance to bleomycin chemotherapy, and is also genetically linked to Alzheimer's disease. In addition to its peptidase activity, the yeast BH (Gal6) binds DNA and acts as a repressor in the Gal4 regulatory system. BH forms a hexameric ring barrel structure with the active sites imbedded in the central channel. The bacterial homolog of BH, called pepC, is a cysteine aminopeptidase possessing broad specificity. Although its crystal structure has not been solved, biochemical analysis shows that pepC also forms a hexamer. . Length = 437

>gnl|CDD|202517 pfam03051, Peptidase_C1_2, Peptidase C1-like family Back     alignment and domain information
>gnl|CDD|226107 COG3579, PepC, Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 100.0
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 100.0
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.97
KOG4128|consensus457 99.94
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 98.82
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 98.67
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 98.67
PF00112219 Peptidase_C1: Papain family cysteine protease This 98.66
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 98.61
PTZ00203348 cathepsin L protease; Provisional 98.59
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 98.55
smart00645174 Pept_C1 Papain family cysteine protease. 98.51
PTZ00200448 cysteine proteinase; Provisional 98.5
KOG1542|consensus372 98.38
KOG1543|consensus325 98.33
PTZ00021489 falcipain-2; Provisional 98.24
COG4870372 Cysteine protease [Posttranslational modification, 98.14
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 98.13
PTZ00049693 cathepsin C-like protein; Provisional 98.11
PTZ00462 1004 Serine-repeat antigen protein; Provisional 98.1
KOG1544|consensus470 96.63
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3.3e-35  Score=225.74  Aligned_cols=71  Identities=46%  Similarity=1.102  Sum_probs=69.5

Q ss_pred             CCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccCC
Q psy17192          4 ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ   74 (74)
Q Consensus         4 ~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~~   74 (74)
                      ++|+|.|||||||||++.|.+|||+|||+||+||+|||||+|++||+++++++..|||+|+|||||||||.
T Consensus       374 ~~g~p~rwkVENSWG~d~G~~GyfvaSd~wmdEytyQIvV~k~~l~~e~~~a~~~epivL~pWDPMGALA~  444 (444)
T COG3579         374 ETGNPLRWKVENSWGKDVGKKGYFVASDAWMDEYTYQIVVDKKFLPKEELAAYEEEPIVLAPWDPMGALAK  444 (444)
T ss_pred             cCCCceeeEeecccccccCCCceEeehHhHhhhheeEEEEehhhCCHHHHHhhcCCCeecCCCCccccccC
Confidence            67899999999999999999999999999999999999999999999999999999999999999999985



>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>KOG4128|consensus Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1542|consensus Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
1cb5_A453 Human Bleomycin Hydrolase. Length = 453 2e-24
2cb5_A453 Human Bleomycin Hydrolase, C73s/dele455 Mutant Leng 2e-24
1a6r_A471 Gal6 (Yeast Bleomycin Hydrolase) Mutant C73a Length 2e-14
1gcb_A454 Gal6, Yeast Bleomycin Hydrolase Dna-Binding Proteas 2e-14
3gcb_A470 Gal6 (Yeast Bleomycin Hydrolase) Mutant C73aDELTAK4 3e-14
2e03_A457 Crystal Structure Of Nq67e Mutant Of Yeast Bleomyci 3e-14
2e02_A457 Crystal Structure Of H369l Mutant Of Yeast Bleomyci 3e-14
2e01_A457 Crystal Structure Of H369a Mutant Of Yeast Bleomyci 3e-14
2dzy_A457 Crystal Structure Of N392a Mutant Of Yeast Bleomyci 2e-13
2e00_A457 Crystal Structure Of N392l Mutant Of Yeast Bleomyci 3e-13
2dzz_A457 Crystal Structure Of N392v Mutant Of Yeast Bleomyci 3e-13
>pdb|1CB5|A Chain A, Human Bleomycin Hydrolase. Length = 453 Back     alignment and structure

Iteration: 1

Score = 107 bits (267), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 47/65 (72%), Positives = 52/65 (80%) Query: 9 TKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDP 68 TKWRVENSWGE+ HKGY+ MT WF EYV+EVVVD+K+VP VL V QEP ILPAWDP Sbjct: 389 TKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDP 448 Query: 69 MGTLA 73 MG LA Sbjct: 449 MGALA 453
>pdb|2CB5|A Chain A, Human Bleomycin Hydrolase, C73s/dele455 Mutant Length = 453 Back     alignment and structure
>pdb|1A6R|A Chain A, Gal6 (Yeast Bleomycin Hydrolase) Mutant C73a Length = 471 Back     alignment and structure
>pdb|1GCB|A Chain A, Gal6, Yeast Bleomycin Hydrolase Dna-Binding Protease (Thiol) Length = 454 Back     alignment and structure
>pdb|3GCB|A Chain A, Gal6 (Yeast Bleomycin Hydrolase) Mutant C73aDELTAK454 Length = 470 Back     alignment and structure
>pdb|2E03|A Chain A, Crystal Structure Of Nq67e Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure
>pdb|2E02|A Chain A, Crystal Structure Of H369l Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure
>pdb|2E01|A Chain A, Crystal Structure Of H369a Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure
>pdb|2DZY|A Chain A, Crystal Structure Of N392a Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure
>pdb|2E00|A Chain A, Crystal Structure Of N392l Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure
>pdb|2DZZ|A Chain A, Crystal Structure Of N392v Mutant Of Yeast Bleomycin Hydrolase Length = 457 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 2e-29
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 3e-28
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 1e-19
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 7e-04
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Length = 453 Back     alignment and structure
 Score =  106 bits (266), Expect = 2e-29
 Identities = 48/72 (66%), Positives = 54/72 (75%)

Query: 2   DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
           D +    TKWRVENSWGE+  HKGY+ MT  WF EYV+EVVVD+K+VP  VL V  QEP 
Sbjct: 382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPI 441

Query: 62  ILPAWDPMGTLA 73
           ILPAWDPMG LA
Sbjct: 442 ILPAWDPMGALA 453


>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 99.97
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.85
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 98.99
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 98.85
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 98.84
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 98.83
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 98.82
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 98.82
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 98.82
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 98.81
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 98.77
1cqd_A221 Protein (protease II); cysteine protease, glycopro 98.76
3u8e_A222 Papain-like cysteine protease; papain-like cystein 98.75
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 98.74
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 98.73
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 98.72
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 98.72
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 98.72
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 98.71
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 98.7
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 98.69
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 98.68
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 98.67
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 98.67
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 98.67
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 98.65
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 98.65
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 98.64
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 98.64
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 98.62
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 98.62
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 98.62
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 98.61
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 98.6
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 98.59
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 98.59
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 98.58
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 98.56
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 98.55
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 98.55
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 98.55
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 98.4
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
Probab=100.00  E-value=1.5e-33  Score=218.04  Aligned_cols=70  Identities=67%  Similarity=1.231  Sum_probs=68.1

Q ss_pred             CCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccC
Q psy17192          4 ETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA   73 (74)
Q Consensus         4 ~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~   73 (74)
                      ++|+|.||+||||||+++|++|||+|+++||++|||+|||||++||++++++|+++||+||||||||+||
T Consensus       384 ~~G~~~yWiVkNSWG~~wG~~GY~~ms~~wf~ey~~~vvV~k~~l~~~~~~~l~~~p~~Lp~WDpmg~la  453 (453)
T 2cb5_A          384 QDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA  453 (453)
T ss_dssp             SCSCEEEEEEECSBCTTSTBTTEEEEEHHHHHHHEEEEEEEGGGSCHHHHGGGGSCCEEECTTCSSCCBC
T ss_pred             cCCCccEEEEEcCcCCCcCcCceEEechhhHhhceEEEEechhhCCHHHHHHhcCCCeeCCCCCcccccC
Confidence            3788789999999999999999999999999999999999999999999999999999999999999997



>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 74
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 1e-34
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 2e-33
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Bleomycin hydrolase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  119 bits (300), Expect = 1e-34
 Identities = 48/72 (66%), Positives = 54/72 (75%)

Query: 2   DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPT 61
           D +    TKWRVENSWGE+  HKGY+ MT  WF EYV+EVVVD+K+VP  VL V  QEP 
Sbjct: 382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPI 441

Query: 62  ILPAWDPMGTLA 73
           ILPAWDPMG LA
Sbjct: 442 ILPAWDPMGALA 453


>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 98.86
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 98.86
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 98.85
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 98.83
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 98.83
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 98.82
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 98.8
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 98.78
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 98.77
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 98.77
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 98.76
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 98.76
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 98.76
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 98.72
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 98.72
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 98.72
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 98.71
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 98.71
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 98.59
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Bleomycin hydrolase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.7e-37  Score=235.42  Aligned_cols=72  Identities=67%  Similarity=1.222  Sum_probs=70.3

Q ss_pred             CCCCCccceEEEecccCCCCCCceEEEEeHHHHhhhceeeeecCCCCCHHHHhhhcCCCeeeCCCCccCccC
Q psy17192          2 DQETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA   73 (74)
Q Consensus         2 d~~~g~~~~wkVeNSWG~~~G~~Gy~~ms~~wF~eyv~~ivV~K~~l~~~~~~~l~~~p~~l~~wDpmg~l~   73 (74)
                      |+++|+++|||||||||++.|++|||+||++||++|||+|||||++||++++++|+++||+|||||||||||
T Consensus       382 dd~~G~~~~w~VENSWG~~~g~kGy~~Msd~WF~eyv~eivV~K~~lp~~i~~~l~~~p~~Lp~WDpmGaLA  453 (453)
T d2cb5a_         382 DDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA  453 (453)
T ss_dssp             TTSCSCEEEEEEECSBCTTSTBTTEEEEEHHHHHHHEEEEEEEGGGSCHHHHGGGGSCCEEECTTCSSCCBC
T ss_pred             cccCCCEeEEEEEccccCcCCCCceEEecHHHHHhccEEEEEEhhhCCHHHHHHhcCCCeECCCCCCccccC
Confidence            468999999999999999999999999999999999999999999999999999999999999999999998



>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure