Psyllid ID: psy17241


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MRIATGANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELET
ccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHHHHccHHHcEEEEEccccccccccccHHHHHHHHHHccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MRIATGANMIFDklkqeqpgflSKVTIIcgdcskkklgisdENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELET
mriatganmifdklkqeqpgfLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELatsfgelet
MRIATGANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELET
********MIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATS******
MRI*T*ANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELE*
MRIATGANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELET
MRIATGANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGEL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGANMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFGELET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
A1ZAI5 625 Putative fatty acyl-CoA r no N/A 0.806 0.12 0.453 5e-12
Q922J9 515 Fatty acyl-CoA reductase yes N/A 0.924 0.166 0.372 9e-11
Q66H50 515 Fatty acyl-CoA reductase yes N/A 0.892 0.161 0.385 1e-10
Q5ZM72 515 Fatty acyl-CoA reductase yes N/A 0.892 0.161 0.385 1e-10
Q5R834 515 Fatty acyl-CoA reductase yes N/A 0.892 0.161 0.373 2e-10
Q8WVX9 515 Fatty acyl-CoA reductase yes N/A 0.892 0.161 0.373 2e-10
Q7TNT2 515 Fatty acyl-CoA reductase no N/A 0.892 0.161 0.373 1e-09
Q0P5J1 515 Fatty acyl-CoA reductase no N/A 0.892 0.161 0.373 1e-09
Q7ZXF5 515 Fatty acyl-CoA reductase N/A N/A 0.892 0.161 0.385 2e-09
Q96K12 515 Fatty acyl-CoA reductase no N/A 0.892 0.161 0.361 6e-09
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 51/75 (68%)

Query: 10  IFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQ 69
           +F+ L+QE+P  LSKV  I GD + ++LGIS+++  LL  NV+V+FH+AA V F+  L  
Sbjct: 179 LFESLRQEKPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKL 238

Query: 70  AVLSNVCATKEFLEL 84
           +V  N+  TK  +EL
Sbjct: 239 SVTINMLGTKRLVEL 253




Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: nEC: 2
>sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 Back     alignment and function description
>sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 Back     alignment and function description
>sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
195129858 494 GI15313 [Drosophila mojavensis] gi|19390 0.881 0.165 0.493 1e-13
195446244 517 GK10887 [Drosophila willistoni] gi|19416 0.892 0.160 0.409 5e-12
405971824 525 Fatty acyl-CoA reductase 1 [Crassostrea 0.892 0.158 0.457 5e-12
391329016 388 PREDICTED: putative fatty acyl-CoA reduc 0.892 0.213 0.397 1e-11
307169656 500 Fatty acyl-CoA reductase 1 [Camponotus f 0.881 0.164 0.493 1e-11
345497105 529 PREDICTED: LOW QUALITY PROTEIN: putative 0.913 0.160 0.411 1e-11
321473808 198 hypothetical protein DAPPUDRAFT_46791 [D 0.913 0.429 0.435 1e-11
391344432 516 PREDICTED: putative fatty acyl-CoA reduc 0.892 0.160 0.433 1e-11
357617056 518 hypothetical protein KGM_10439 [Danaus p 0.881 0.158 0.451 2e-11
195109807 521 GI24527 [Drosophila mojavensis] gi|19391 0.892 0.159 0.409 2e-11
>gi|195129858|ref|XP_002009371.1| GI15313 [Drosophila mojavensis] gi|193907821|gb|EDW06688.1| GI15313 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 1/83 (1%)

Query: 10  IFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQ 69
           +FD+L++EQP  +SKV  I GDC K  LGIS+ +L  L TNVNV++H+AA V F+  LA+
Sbjct: 63  LFDRLRREQPQTISKVVPIAGDCMKLGLGISETDLAKL-TNVNVVYHSAASVRFDDPLAK 121

Query: 70  AVLSNVCATKEFLELATSFGELE 92
           A+L N  AT E ++LA  + +L+
Sbjct: 122 AILLNTRATHELVKLALQWKQLK 144




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195446244|ref|XP_002070694.1| GK10887 [Drosophila willistoni] gi|194166779|gb|EDW81680.1| GK10887 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|405971824|gb|EKC36634.1| Fatty acyl-CoA reductase 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|391329016|ref|XP_003738975.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|307169656|gb|EFN62238.1| Fatty acyl-CoA reductase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345497105|ref|XP_001600250.2| PREDICTED: LOW QUALITY PROTEIN: putative fatty acyl-CoA reductase CG5065-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321473808|gb|EFX84775.1| hypothetical protein DAPPUDRAFT_46791 [Daphnia pulex] Back     alignment and taxonomy information
>gi|391344432|ref|XP_003746504.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|357617056|gb|EHJ70562.1| hypothetical protein KGM_10439 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195109807|ref|XP_001999473.1| GI24527 [Drosophila mojavensis] gi|193916067|gb|EDW14934.1| GI24527 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
FB|FBgn0039620 517 CG1443 [Drosophila melanogaste 0.892 0.160 0.409 6.1e-12
FB|FBgn0034145 625 CG5065 [Drosophila melanogaste 0.806 0.12 0.453 4.8e-11
FB|FBgn0043792 506 CG30427 [Drosophila melanogast 0.892 0.164 0.385 1.2e-10
UNIPROTKB|E2R4R9 514 FAR1 "Uncharacterized protein" 0.892 0.161 0.385 1.2e-10
UNIPROTKB|E9PNW8 335 FAR1 "Fatty acyl-CoA reductase 0.892 0.247 0.373 1.7e-10
MGI|MGI:1914670 515 Far1 "fatty acyl CoA reductase 0.924 0.166 0.372 2e-10
UNIPROTKB|G8ENM4 515 FAR1 "Uncharacterized protein" 0.892 0.161 0.385 2.5e-10
RGD|1306647 515 Far1 "fatty acyl CoA reductase 0.892 0.161 0.385 2.5e-10
UNIPROTKB|Q66H50 515 Far1 "Fatty acyl-CoA reductase 0.892 0.161 0.385 2.5e-10
UNIPROTKB|A5PJQ0 515 FAR1 "Uncharacterized protein" 0.892 0.161 0.373 3.2e-10
FB|FBgn0039620 CG1443 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 170 (64.9 bits), Expect = 6.1e-12, P = 6.1e-12
 Identities = 34/83 (40%), Positives = 50/83 (60%)

Query:    10 IFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQ 69
             +F K+KQ  P +  ++TII GDCS   LGIS +  + +  NVN++ H+AA V F+  L  
Sbjct:    91 VFAKMKQVNPKYRCQITIISGDCSLPGLGISADERETIMENVNIVLHSAATVRFDEKLKM 150

Query:    70 AVLSNVCATKEFLELATSFGELE 92
             A+  NV  TKE ++LA     L+
Sbjct:   151 AIAINVHGTKEIIKLAKEIVNLK 173




GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0034145 CG5065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0043792 CG30427 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4R9 FAR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNW8 FAR1 "Fatty acyl-CoA reductase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914670 Far1 "fatty acyl CoA reductase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G8ENM4 FAR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1306647 Far1 "fatty acyl CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66H50 Far1 "Fatty acyl-CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJQ0 FAR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
pfam07993 245 pfam07993, NAD_binding_4, Male sterility protein 2e-22
cd05236 320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 5e-20
cd05235 290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 2e-12
TIGR01746 367 TIGR01746, Thioester-redct, thioester reductase do 4e-10
cd05263 293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 7e-09
TIGR03443 1389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 3e-07
COG3320 382 COG3320, COG3320, Putative dehydrogenase domain of 5e-07
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 7e-06
PLN02996 491 PLN02996, PLN02996, fatty acyl-CoA reductase 0.004
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
 Score = 86.5 bits (215), Expect = 2e-22
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 10  IFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQ 69
           +FD+LK      L ++  + GD S+  LG+SDE+ + L   V+VI H AA VNF    + 
Sbjct: 50  LFDRLKA-----LERIIPVAGDLSEPNLGLSDEDFQELAEEVDVIIHNAATVNFVEPYSD 104

Query: 70  AVLSNVCATKEFLELATS 87
              +NV  T+E L LA  
Sbjct: 105 LRATNVLGTREVLRLAKQ 122


This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included. Length = 245

>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG1221|consensus 467 99.63
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 99.62
PLN02503 605 fatty acyl-CoA reductase 2 99.57
PLN02996 491 fatty acyl-CoA reductase 99.52
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.46
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.2
TIGR01746 367 Thioester-redct thioester reductase domain. It has 99.05
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.03
KOG1502|consensus 327 98.97
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.94
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.93
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 98.91
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.91
PRK07201 657 short chain dehydrogenase; Provisional 98.9
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.9
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 98.79
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 98.72
PLN02650 351 dihydroflavonol-4-reductase 98.72
PLN00198 338 anthocyanidin reductase; Provisional 98.69
PLN02427 386 UDP-apiose/xylose synthase 98.68
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 98.66
PLN02214 342 cinnamoyl-CoA reductase 98.66
KOG1371|consensus 343 98.61
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.58
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.55
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.53
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 98.53
PLN02572 442 UDP-sulfoquinovose synthase 98.51
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.5
PLN02260 668 probable rhamnose biosynthetic enzyme 98.48
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.45
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.41
PLN02896 353 cinnamyl-alcohol dehydrogenase 98.41
PLN02206 442 UDP-glucuronate decarboxylase 98.4
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.4
PLN02166 436 dTDP-glucose 4,6-dehydratase 98.38
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.36
PLN02686 367 cinnamoyl-CoA reductase 98.36
PLN02653 340 GDP-mannose 4,6-dehydratase 98.35
PLN02778 298 3,5-epimerase/4-reductase 98.29
CHL00194 317 ycf39 Ycf39; Provisional 98.25
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.2
PLN02240 352 UDP-glucose 4-epimerase 98.15
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.15
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.15
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.14
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 98.13
PLN02583 297 cinnamoyl-CoA reductase 98.1
KOG1430|consensus 361 98.1
PRK10675 338 UDP-galactose-4-epimerase; Provisional 98.03
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.01
PLN02260 668 probable rhamnose biosynthetic enzyme 97.98
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 97.96
PRK05865 854 hypothetical protein; Provisional 97.95
KOG0747|consensus 331 97.89
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.86
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 97.82
PLN03209 576 translocon at the inner envelope of chloroplast su 97.81
PRK12320 699 hypothetical protein; Provisional 97.8
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 97.79
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 97.76
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 97.75
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 97.75
PRK06940 275 short chain dehydrogenase; Provisional 97.75
PRK09135 249 pteridine reductase; Provisional 97.73
PLN02253 280 xanthoxin dehydrogenase 97.69
PRK06482 276 short chain dehydrogenase; Provisional 97.69
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.58
PRK12746 254 short chain dehydrogenase; Provisional 97.53
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 97.5
PRK07774 250 short chain dehydrogenase; Provisional 97.48
PRK12935 247 acetoacetyl-CoA reductase; Provisional 97.48
PRK09134 258 short chain dehydrogenase; Provisional 97.47
PRK06194 287 hypothetical protein; Provisional 97.45
PRK05717 255 oxidoreductase; Validated 97.43
KOG1429|consensus 350 97.41
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 97.4
PRK12827 249 short chain dehydrogenase; Provisional 97.4
PRK08213 259 gluconate 5-dehydrogenase; Provisional 97.37
PRK06123 248 short chain dehydrogenase; Provisional 97.36
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 97.36
PRK06180 277 short chain dehydrogenase; Provisional 97.35
PRK08267 260 short chain dehydrogenase; Provisional 97.35
PRK07453 322 protochlorophyllide oxidoreductase; Validated 97.34
PRK08278 273 short chain dehydrogenase; Provisional 97.33
PRK06128 300 oxidoreductase; Provisional 97.32
PRK07326 237 short chain dehydrogenase; Provisional 97.29
PRK07067 257 sorbitol dehydrogenase; Provisional 97.29
PRK06500 249 short chain dehydrogenase; Provisional 97.28
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.28
PRK12937 245 short chain dehydrogenase; Provisional 97.28
PRK06179 270 short chain dehydrogenase; Provisional 97.28
PRK06181 263 short chain dehydrogenase; Provisional 97.27
PRK06398 258 aldose dehydrogenase; Validated 97.26
PRK12367 245 short chain dehydrogenase; Provisional 97.26
PRK08643 256 acetoin reductase; Validated 97.26
PRK07814 263 short chain dehydrogenase; Provisional 97.25
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.24
PRK07856 252 short chain dehydrogenase; Provisional 97.23
PRK06138 252 short chain dehydrogenase; Provisional 97.2
PRK06182 273 short chain dehydrogenase; Validated 97.19
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.18
PRK08263 275 short chain dehydrogenase; Provisional 97.16
PRK12939 250 short chain dehydrogenase; Provisional 97.16
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.16
PRK07523 255 gluconate 5-dehydrogenase; Provisional 97.16
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.15
PRK08264 238 short chain dehydrogenase; Validated 97.15
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.14
PRK09072 263 short chain dehydrogenase; Provisional 97.12
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.12
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.12
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.11
PRK12829 264 short chain dehydrogenase; Provisional 97.11
PRK05693 274 short chain dehydrogenase; Provisional 97.1
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.1
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.09
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.09
PRK07890 258 short chain dehydrogenase; Provisional 97.08
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.08
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 97.07
PRK05875 276 short chain dehydrogenase; Provisional 97.06
PRK10538 248 malonic semialdehyde reductase; Provisional 97.06
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.05
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 97.05
PRK07775 274 short chain dehydrogenase; Provisional 97.05
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.05
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.04
smart00822180 PKS_KR This enzymatic domain is part of bacterial 97.04
PRK12743 256 oxidoreductase; Provisional 97.02
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 97.01
PRK09291 257 short chain dehydrogenase; Provisional 97.01
PRK08226 263 short chain dehydrogenase; Provisional 97.01
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.01
PRK08219 227 short chain dehydrogenase; Provisional 97.0
PRK07063 260 short chain dehydrogenase; Provisional 96.99
PRK07060 245 short chain dehydrogenase; Provisional 96.98
PRK06914 280 short chain dehydrogenase; Provisional 96.98
PRK06701 290 short chain dehydrogenase; Provisional 96.97
PRK07806 248 short chain dehydrogenase; Provisional 96.95
PRK05867 253 short chain dehydrogenase; Provisional 96.95
PRK06197 306 short chain dehydrogenase; Provisional 96.95
PRK05876 275 short chain dehydrogenase; Provisional 96.95
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 96.95
PRK05866 293 short chain dehydrogenase; Provisional 96.94
PRK06841 255 short chain dehydrogenase; Provisional 96.93
PRK12744 257 short chain dehydrogenase; Provisional 96.92
TIGR02415 254 23BDH acetoin reductases. One member of this famil 96.92
PRK12938 246 acetyacetyl-CoA reductase; Provisional 96.91
PRK06198 260 short chain dehydrogenase; Provisional 96.9
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.88
PRK09186 256 flagellin modification protein A; Provisional 96.86
PRK07454 241 short chain dehydrogenase; Provisional 96.86
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.85
PRK09009 235 C factor cell-cell signaling protein; Provisional 96.84
PRK08628 258 short chain dehydrogenase; Provisional 96.84
PRK08251 248 short chain dehydrogenase; Provisional 96.83
PRK06947 248 glucose-1-dehydrogenase; Provisional 96.82
PRK07478 254 short chain dehydrogenase; Provisional 96.81
PRK08265 261 short chain dehydrogenase; Provisional 96.8
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 96.78
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.78
PRK07577 234 short chain dehydrogenase; Provisional 96.78
PRK07024 257 short chain dehydrogenase; Provisional 96.78
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.77
PRK07677 252 short chain dehydrogenase; Provisional 96.77
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 96.77
PRK07102 243 short chain dehydrogenase; Provisional 96.77
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.76
PRK08085 254 gluconate 5-dehydrogenase; Provisional 96.75
PRK07097 265 gluconate 5-dehydrogenase; Provisional 96.74
PRK06114 254 short chain dehydrogenase; Provisional 96.73
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.71
PRK07576 264 short chain dehydrogenase; Provisional 96.71
PRK08277 278 D-mannonate oxidoreductase; Provisional 96.71
PRK05993 277 short chain dehydrogenase; Provisional 96.71
PRK06523 260 short chain dehydrogenase; Provisional 96.7
PRK07578199 short chain dehydrogenase; Provisional 96.7
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.69
PRK07041 230 short chain dehydrogenase; Provisional 96.68
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.68
PRK06139 330 short chain dehydrogenase; Provisional 96.68
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.67
PRK05855 582 short chain dehydrogenase; Validated 96.66
PRK07831 262 short chain dehydrogenase; Provisional 96.64
PRK06196 315 oxidoreductase; Provisional 96.62
PRK06949 258 short chain dehydrogenase; Provisional 96.62
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.59
PRK07074 257 short chain dehydrogenase; Provisional 96.58
PRK12824 245 acetoacetyl-CoA reductase; Provisional 96.58
PRK05650 270 short chain dehydrogenase; Provisional 96.58
PRK07985 294 oxidoreductase; Provisional 96.57
KOG1205|consensus 282 96.54
PRK06953222 short chain dehydrogenase; Provisional 96.53
PRK07109 334 short chain dehydrogenase; Provisional 96.51
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.49
PRK09242 257 tropinone reductase; Provisional 96.49
PRK06172 253 short chain dehydrogenase; Provisional 96.49
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.49
PRK06124 256 gluconate 5-dehydrogenase; Provisional 96.47
PRK08703 239 short chain dehydrogenase; Provisional 96.45
PRK05884223 short chain dehydrogenase; Provisional 96.44
PRK05872 296 short chain dehydrogenase; Provisional 96.41
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.41
PRK07832 272 short chain dehydrogenase; Provisional 96.39
PRK12828 239 short chain dehydrogenase; Provisional 96.38
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 96.37
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 96.37
PRK05854 313 short chain dehydrogenase; Provisional 96.36
PRK08936 261 glucose-1-dehydrogenase; Provisional 96.35
PRK08177 225 short chain dehydrogenase; Provisional 96.33
PRK12747 252 short chain dehydrogenase; Provisional 96.32
PRK07035 252 short chain dehydrogenase; Provisional 96.3
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.29
PRK08339 263 short chain dehydrogenase; Provisional 96.28
PRK06101 240 short chain dehydrogenase; Provisional 96.26
PLN00015 308 protochlorophyllide reductase 96.26
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 96.25
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 96.25
PRK12742 237 oxidoreductase; Provisional 96.21
PRK08324 681 short chain dehydrogenase; Validated 96.21
PRK07825 273 short chain dehydrogenase; Provisional 96.21
PRK07023 243 short chain dehydrogenase; Provisional 96.21
PRK07069 251 short chain dehydrogenase; Validated 96.18
PRK06484 520 short chain dehydrogenase; Validated 96.16
PRK06125 259 short chain dehydrogenase; Provisional 96.14
PRK06483 236 dihydromonapterin reductase; Provisional 96.1
PRK07791 286 short chain dehydrogenase; Provisional 96.09
PRK08589 272 short chain dehydrogenase; Validated 96.03
PRK07201 657 short chain dehydrogenase; Provisional 95.98
PRK06057 255 short chain dehydrogenase; Provisional 95.97
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 95.91
PRK06484 520 short chain dehydrogenase; Validated 95.82
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 95.8
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 95.73
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 95.72
COG0300 265 DltE Short-chain dehydrogenases of various substra 95.68
PRK07062 265 short chain dehydrogenase; Provisional 95.64
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 95.5
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 95.5
PLN00106 323 malate dehydrogenase 95.4
KOG1372|consensus 376 95.35
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.3
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.21
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 95.16
PRK07904 253 short chain dehydrogenase; Provisional 95.12
PRK06732 229 phosphopantothenate--cysteine ligase; Validated 95.11
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 95.1
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.07
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 94.98
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 94.97
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 94.86
PRK08017 256 oxidoreductase; Provisional 94.8
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 94.64
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 94.57
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 94.53
PTZ00325 321 malate dehydrogenase; Provisional 94.45
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 94.44
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 94.44
PRK08340 259 glucose-1-dehydrogenase; Provisional 94.35
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.05
PRK06924 251 short chain dehydrogenase; Provisional 93.88
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 93.82
KOG2774|consensus 366 93.62
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 93.5
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.48
PLN02780 320 ketoreductase/ oxidoreductase 93.48
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 93.23
PLN00016 378 RNA-binding protein; Provisional 92.58
PRK08862227 short chain dehydrogenase; Provisional 92.57
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 92.04
KOG4169|consensus 261 91.88
PRK05599 246 hypothetical protein; Provisional 91.87
KOG1201|consensus 300 91.43
PRK08303 305 short chain dehydrogenase; Provisional 91.03
KOG1431|consensus 315 90.83
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.53
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 89.18
KOG1210|consensus 331 88.77
KOG2865|consensus 391 88.75
PRK09620229 hypothetical protein; Provisional 88.4
KOG1200|consensus 256 88.28
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 87.75
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 87.15
KOG1199|consensus 260 86.18
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 85.58
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 83.11
KOG1610|consensus 322 83.04
>KOG1221|consensus Back     alignment and domain information
Probab=99.63  E-value=8e-16  Score=110.75  Aligned_cols=86  Identities=37%  Similarity=0.586  Sum_probs=81.5

Q ss_pred             hHHHHHHHhhCCCCCCCEEEEeccCCCCCCCCCHHHHHHHhcCcCEEEEcCcccChhhhHHHHHHHHHHHHHHHHHHHHh
Q psy17241          8 NMIFDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATS   87 (93)
Q Consensus         8 ~~~~d~~~~~~~~~~~~v~~v~gDl~~~~~gl~~~~~~~l~~~vd~V~H~Aa~~~~~~~~~~~~~~Nv~gt~~ll~~a~~   87 (93)
                      +.+|+.+++..|....++..+.||++++++|+++++.+.+.+++++|||+||.+.|.++++....+|+.||++++++|++
T Consensus        64 ~~lF~~l~~~~p~~l~Kv~pi~GDi~~~~LGis~~D~~~l~~eV~ivih~AAtvrFde~l~~al~iNt~Gt~~~l~lak~  143 (467)
T KOG1221|consen   64 DPLFEVLKEKKPEALEKVVPIAGDISEPDLGISESDLRTLADEVNIVIHSAATVRFDEPLDVALGINTRGTRNVLQLAKE  143 (467)
T ss_pred             hhHHHHHHhhCccceecceeccccccCcccCCChHHHHHHHhcCCEEEEeeeeeccchhhhhhhhhhhHhHHHHHHHHHH
Confidence            58999999998888899999999999999999999999889999999999999999999998889999999999999999


Q ss_pred             cCCCCC
Q psy17241         88 FGELET   93 (93)
Q Consensus        88 ~~~l~~   93 (93)
                      +.+|++
T Consensus       144 ~~~l~~  149 (467)
T KOG1221|consen  144 MVKLKA  149 (467)
T ss_pred             hhhhhe
Confidence            999974



>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 1e-19
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score = 80.7 bits (199), Expect = 1e-19
 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 11  FDKLKQEQPGFLSKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQA 70
            + L+  +     ++ ++ GD S+  LG+     + L   V++I  +AA+VN      + 
Sbjct: 128 PELLRHFKELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAF-PYHEL 186

Query: 71  VLSNVCATKEFLELATS 87
              NV  T E + +A +
Sbjct: 187 FGPNVAGTAELIRIALT 203


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 98.99
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 98.81
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 98.78
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 98.76
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.73
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.72
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.72
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 98.71
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.71
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.69
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 98.68
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.67
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 98.67
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.67
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.66
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.66
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 98.65
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.64
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.64
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.62
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 98.62
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.6
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 98.6
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.6
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.59
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.58
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.58
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 98.58
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.57
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.57
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.56
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.56
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.55
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.55
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 98.55
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.54
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.53
4f6c_A 427 AUSA reductase domain protein; thioester reductase 98.52
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.51
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.5
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 98.49
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.48
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 98.48
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 98.47
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 98.47
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 98.44
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.44
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.43
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 98.4
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.4
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.39
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 98.34
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.34
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 98.33
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 98.32
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 98.32
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.31
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.29
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.28
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 98.27
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.27
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.26
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.26
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 98.24
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 98.19
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 98.19
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 98.14
1xq6_A 253 Unknown protein; structural genomics, protein stru 98.1
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.1
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.09
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 98.09
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.09
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 98.04
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.03
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.01
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.01
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 97.99
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.98
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.97
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.95
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.94
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.94
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.93
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.92
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.91
1spx_A 278 Short-chain reductase family member (5L265); paral 97.9
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.9
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.89
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 97.89
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.89
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 97.88
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.88
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.88
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.88
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.88
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.87
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.85
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 97.85
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.85
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.84
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.83
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.83
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.83
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.83
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.82
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 97.82
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.81
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.81
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.81
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.81
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.8
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.79
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.79
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.79
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 97.79
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.79
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.79
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.78
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 97.78
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 97.78
3imf_A 257 Short chain dehydrogenase; structural genomics, in 97.78
1xq1_A 266 Putative tropinone reducatse; structural genomics, 97.78
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 97.77
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 97.77
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.77
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.77
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.77
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.77
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 97.76
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.76
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.76
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.75
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 97.75
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 97.75
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.75
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 97.74
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.74
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.74
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.74
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 97.73
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 97.73
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 97.72
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.72
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.72
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.71
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 97.71
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.71
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.7
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 97.7
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.7
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 97.69
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 97.69
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.69
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.69
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.69
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 97.69
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.68
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 97.68
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.67
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.67
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.67
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.67
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 97.67
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 97.66
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.66
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.65
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.65
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.65
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.65
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.64
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.64
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.64
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.64
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.64
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.64
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.63
4dqx_A 277 Probable oxidoreductase protein; structural genomi 97.63
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.63
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 97.63
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.63
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.63
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 97.63
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.63
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.63
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.63
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 97.62
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.62
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.62
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 97.62
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 97.62
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.62
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 97.61
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.61
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.61
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 97.61
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 97.61
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.61
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 97.6
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.6
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.6
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.6
3cxt_A 291 Dehydrogenase with different specificities; rossma 97.6
1xkq_A 280 Short-chain reductase family member (5D234); parra 97.6
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.6
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 97.6
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 97.6
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.6
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.59
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.59
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.59
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.58
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 97.58
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.58
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 97.58
4e4y_A 244 Short chain dehydrogenase family protein; structur 97.57
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.57
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.57
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 97.56
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 97.56
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 97.56
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.56
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.55
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.55
1xhl_A 297 Short-chain dehydrogenase/reductase family member 97.55
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.55
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.55
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 97.54
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.54
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.54
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.54
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.54
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 97.53
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 97.53
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.53
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 97.52
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.52
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 97.52
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.51
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.51
3rih_A 293 Short chain dehydrogenase or reductase; structural 97.5
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 97.49
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.48
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 97.47
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.47
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 97.47
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 97.46
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.46
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.46
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.45
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 97.45
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 97.45
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 97.45
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.44
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.44
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.44
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 97.42
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 97.42
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.4
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 97.39
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.38
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.37
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 97.36
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.33
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.33
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 97.31
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 97.31
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.26
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.21
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.19
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 97.19
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.18
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.16
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.15
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.08
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 97.07
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 97.01
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 97.0
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 97.0
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 96.97
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.88
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 96.8
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 96.8
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 96.73
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 96.67
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 96.67
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.66
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.65
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 96.57
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 96.56
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.45
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 96.4
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.3
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.23
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 96.19
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.15
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 96.13
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.11
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 96.1
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 95.99
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 95.98
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 95.95
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 95.92
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.73
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 95.48
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 95.38
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 95.12
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 95.06
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 94.33
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 94.12
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 94.07
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.0
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 93.94
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.84
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 93.24
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 93.06
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 89.33
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 88.31
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 87.79
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 87.42
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 83.6
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=98.99  E-value=1.8e-10  Score=82.18  Aligned_cols=66  Identities=26%  Similarity=0.406  Sum_probs=59.1

Q ss_pred             CCEEEEeccCCCCCCCCCHHHHHHHhcCcCEEEEcCcccChhhhHHHHHHHHHHHHHHHHHHHHhcC
Q psy17241         23 SKVTIICGDCSKKKLGISDENLKLLQTNVNVIFHTAAIVNFEASLAQAVLSNVCATKEFLELATSFG   89 (93)
Q Consensus        23 ~~v~~v~gDl~~~~~gl~~~~~~~l~~~vd~V~H~Aa~~~~~~~~~~~~~~Nv~gt~~ll~~a~~~~   89 (93)
                      .+++++.+|++++.+|++.+.+..+.+++|+|||+||..++ .++...+++|+.||.+++++|++.+
T Consensus       140 ~~v~~v~~Dl~~~~~gld~~~~~~~~~~~D~Vih~Aa~~~~-~~~~~~~~~Nv~gt~~ll~aa~~~~  205 (478)
T 4dqv_A          140 DRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNA-FPYHELFGPNVAGTAELIRIALTTK  205 (478)
T ss_dssp             TTEEEEECCTTSGGGGCCHHHHHHHHHHCCEEEECCSSCSB-SSCCEEHHHHHHHHHHHHHHHTSSS
T ss_pred             CceEEEEeECCCcccCCCHHHHHHHHcCCCEEEECccccCC-cCHHHHHHHHHHHHHHHHHHHHhCC
Confidence            68999999999999999999999999999999999999887 5555578999999999999998753



>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.06
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.9
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.85
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.8
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.78
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.77
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.75
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.55
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.45
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.42
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.42
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.34
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.25
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.23
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.23
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.2
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.13
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.13
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.07
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 97.94
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.83
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 97.8
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.4
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 97.32
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.1
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.07
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.0
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.98
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 96.95
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.95
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.89
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.86
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.85
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.84
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.83
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.83
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 96.83
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 96.8
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.77
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.77
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.76
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.75
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.73
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 96.66
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.63
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 96.6
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.51
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.49
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.49
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 96.47
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.44
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.44
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.43
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 96.39
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 96.38
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.36
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.33
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 96.32
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 96.31
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.29
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 96.26
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 96.21
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.2
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.2
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.17
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.15
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.13
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 96.05
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.79
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.74
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 95.64
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.37
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 95.1
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 94.75
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.45
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 94.29
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 94.09
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 93.98
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 92.82
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 91.68
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 90.76
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 90.32
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 89.05
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 88.62
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 88.13
d2fg1a1154 Hypothetical protein BT1257 {Bacteroides thetaiota 87.76
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 87.29
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 83.93
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.85
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 81.34
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase)
species: Escherichia coli [TaxId: 562]
Probab=99.06  E-value=1.4e-10  Score=77.30  Aligned_cols=61  Identities=15%  Similarity=0.172  Sum_probs=49.6

Q ss_pred             CCEEEEeccCCCCCCCCCHHHHHHHhc--CcCEEEEcCcccChhhh---HHHHHHHHHHHHHHHHHHHHhcC
Q psy17241         23 SKVTIICGDCSKKKLGISDENLKLLQT--NVNVIFHTAAIVNFEAS---LAQAVLSNVCATKEFLELATSFG   89 (93)
Q Consensus        23 ~~v~~v~gDl~~~~~gl~~~~~~~l~~--~vd~V~H~Aa~~~~~~~---~~~~~~~Nv~gt~~ll~~a~~~~   89 (93)
                      .+++++++|+++.      +.+..+++  ++|+|||+||..++..+   ....+++|+.||.++|++|++.+
T Consensus        50 ~~~~~~~~Dl~d~------~~l~~~~~~~~~d~ViHlAa~~~~~~~~~~~~~~~~~Nv~gt~nlL~~~~~~~  115 (338)
T d1udca_          50 KHPTFVEGDIRNE------ALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAAN  115 (338)
T ss_dssp             SCCEEEECCTTCH------HHHHHHHHHTTCSEEEECCSCCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEeecCCH------HHHHHHHhccCCCEEEECCCccchhhHHhCHHHHHHhHHHHHHHHHHHHHHhC
Confidence            4799999999986      35666655  79999999998876443   34578999999999999998764



>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure