Psyllid ID: psy17264

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
cccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHcHHcccc
HHccccccEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHcHHHHcccEEcc
mydldnddaiSRDELLAVLHMMVGANISEEQLTSIAERTILeadqngdqmISFDEFCKALERTDVEQKMSIRFLS
mydldnddaISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALErtdveqkmsirfls
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
*************ELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL***************
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALERTDVEQKMSIRFLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
Q3SYS6195 Calcineurin B homologous yes N/A 0.986 0.379 0.756 6e-25
P61023195 Calcineurin B homologous no N/A 0.986 0.379 0.756 7e-25
P61022195 Calcineurin B homologous yes N/A 0.986 0.379 0.756 7e-25
Q5R7F0195 Calcineurin B homologous yes N/A 0.986 0.379 0.743 2e-24
Q99653195 Calcineurin B homologous yes N/A 0.986 0.379 0.743 2e-24
Q5ZM44195 Calcineurin B homologous yes N/A 0.986 0.379 0.756 3e-24
O43745196 Calcineurin B homologous no N/A 0.986 0.377 0.608 1e-19
Q810D1196 Calcineurin B homologous no N/A 0.986 0.377 0.567 2e-18
Q9D869196 Calcineurin B homologous no N/A 1.0 0.382 0.546 6e-18
P42322177 Calcineurin subunit B OS= N/A N/A 0.96 0.406 0.555 4e-16
>sp|Q3SYS6|CHP1_BOVIN Calcineurin B homologous protein 1 OS=Bos taurus GN=CHP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 61/74 (82%)

Query: 1   MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
           +YDLD DD ISRDELL VL MMVG NIS+EQL SIA+RTI EADQ+GD  ISF EF K L
Sbjct: 121 LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL 180

Query: 61  ERTDVEQKMSIRFL 74
           E+ DVEQKMSIRFL
Sbjct: 181 EKVDVEQKMSIRFL 194
Required for constitutive membrane traffic. Inhibits GTPase-stimulated Na(+)/H(+) exchange. Also inhibits calcineurin phosphatase activity. Required for activity of SLC9A1/NHE1.
Bos taurus (taxid: 9913)
>sp|P61023|CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus GN=Chp1 PE=1 SV=2 Back     alignment and function description
>sp|P61022|CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus GN=Chp1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R7F0|CHP1_PONAB Calcineurin B homologous protein 1 OS=Pongo abelii GN=CHP1 PE=2 SV=3 Back     alignment and function description
>sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZM44|CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus GN=CHP1 PE=1 SV=3 Back     alignment and function description
>sp|O43745|CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens GN=CHP2 PE=1 SV=3 Back     alignment and function description
>sp|Q810D1|CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus GN=Chp2 PE=1 SV=1 Back     alignment and function description
>sp|Q9D869|CHP2_MOUSE Calcineurin B homologous protein 2 OS=Mus musculus GN=Chp2 PE=2 SV=3 Back     alignment and function description
>sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
332023251 188 Calcium-binding protein p22 [Acromyrmex 1.0 0.398 0.906 5e-32
307208991 189 Calcium-binding protein p22 [Harpegnatho 1.0 0.396 0.906 5e-32
383864249 189 PREDICTED: calcium-binding protein p22-l 1.0 0.396 0.906 5e-32
121543871 190 putative calcium-binding protein p22 [Ma 1.0 0.394 0.92 5e-32
48096761 189 PREDICTED: calcium-binding protein p22 [ 1.0 0.396 0.906 6e-32
307166640 188 Calcium-binding protein p22 [Camponotus 1.0 0.398 0.893 1e-31
242014772 194 calcium-binding protein p22, putative [P 1.0 0.386 0.893 2e-31
340718988 189 PREDICTED: calcium-binding protein p22-l 1.0 0.396 0.893 6e-31
357624276 189 calcium-binding protein p22 [Danaus plex 1.0 0.396 0.866 2e-30
114051682 189 calcium-binding protein p22 [Bombyx mori 1.0 0.396 0.866 3e-30
>gi|332023251|gb|EGI63506.1| Calcium-binding protein p22 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 68/75 (90%), Positives = 73/75 (97%)

Query: 1   MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
           MYDLDNDD IS+DELLA+LHMMVGANISEEQLTSIAERTI+EAD+NGD MISF+EFCKAL
Sbjct: 114 MYDLDNDDLISKDELLAILHMMVGANISEEQLTSIAERTIVEADENGDGMISFEEFCKAL 173

Query: 61  ERTDVEQKMSIRFLS 75
           ERTDVEQKMSIRFLS
Sbjct: 174 ERTDVEQKMSIRFLS 188

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307208991|gb|EFN86191.1| Calcium-binding protein p22 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864249|ref|XP_003707592.1| PREDICTED: calcium-binding protein p22-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|121543871|gb|ABM55600.1| putative calcium-binding protein p22 [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|48096761|ref|XP_392514.1| PREDICTED: calcium-binding protein p22 [Apis mellifera] gi|380012597|ref|XP_003690366.1| PREDICTED: calcium-binding protein p22-like [Apis florea] Back     alignment and taxonomy information
>gi|307166640|gb|EFN60652.1| Calcium-binding protein p22 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242014772|ref|XP_002428059.1| calcium-binding protein p22, putative [Pediculus humanus corporis] gi|212512578|gb|EEB15321.1| calcium-binding protein p22, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340718988|ref|XP_003397941.1| PREDICTED: calcium-binding protein p22-like [Bombus terrestris] gi|350396071|ref|XP_003484430.1| PREDICTED: calcium-binding protein p22-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357624276|gb|EHJ75118.1| calcium-binding protein p22 [Danaus plexippus] Back     alignment and taxonomy information
>gi|114051682|ref|NP_001040173.1| calcium-binding protein p22 [Bombyx mori] gi|87248283|gb|ABD36194.1| calcium-binding protein p22 [Bombyx mori] gi|225346701|gb|ACN86373.1| calcium-binding protein [Bombyx mandarina] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
FB|FBgn0037358233 elm "ethanol sensitive with lo 1.0 0.321 0.746 1.2e-24
ZFIN|ZDB-GENE-030131-4086194 chp1 "calcineurin-like EF hand 0.986 0.381 0.756 6.8e-24
UNIPROTKB|Q3SYS6195 CHP1 "Calcineurin B homologous 0.986 0.379 0.756 8.7e-24
UNIPROTKB|E2RPH3195 CHP1 "Uncharacterized protein" 0.986 0.379 0.756 8.7e-24
MGI|MGI:1927185195 Chp1 "calcineurin-like EF hand 0.986 0.379 0.756 8.7e-24
RGD|620447195 Chp "calcium binding protein p 0.986 0.379 0.756 8.7e-24
UNIPROTKB|P61023195 Chp1 "Calcineurin B homologous 0.986 0.379 0.756 8.7e-24
UNIPROTKB|Q5ZM44195 CHP1 "Calcineurin B homologous 0.986 0.379 0.756 2.3e-23
UNIPROTKB|Q99653195 CHP1 "Calcineurin B homologous 0.986 0.379 0.743 2.3e-23
UNIPROTKB|Q5R7F0195 CHP1 "Calcineurin B homologous 0.986 0.379 0.743 2.3e-23
FB|FBgn0037358 elm "ethanol sensitive with low memory" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 56/75 (74%), Positives = 66/75 (88%)

Query:     1 MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
             MYDLD+D  ISRDELL++LHMMVGANIS++QL SIAERTILEAD      ISF++FCKAL
Sbjct:   159 MYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKAL 218

Query:    61 ERTDVEQKMSIRFLS 75
             +RTDV+QKMSIRFL+
Sbjct:   219 DRTDVDQKMSIRFLN 233
GO:0005509 "calcium ion binding" evidence=ISS
ZFIN|ZDB-GENE-030131-4086 chp1 "calcineurin-like EF hand protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYS6 CHP1 "Calcineurin B homologous protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPH3 CHP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1927185 Chp1 "calcineurin-like EF hand protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620447 Chp "calcium binding protein p22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61023 Chp1 "Calcineurin B homologous protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM44 CHP1 "Calcineurin B homologous protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99653 CHP1 "Calcineurin B homologous protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7F0 CHP1 "Calcineurin B homologous protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZM44CHP1_CHICKNo assigned EC number0.75670.98660.3794yesN/A
P61022CHP1_MOUSENo assigned EC number0.75670.98660.3794yesN/A
Q3SYS6CHP1_BOVINNo assigned EC number0.75670.98660.3794yesN/A
Q99653CHP1_HUMANNo assigned EC number0.74320.98660.3794yesN/A
Q5R7F0CHP1_PONABNo assigned EC number0.74320.98660.3794yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 5e-08
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-07
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 5e-04
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information 
 Score = 44.3 bits (105), Expect = 5e-08
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 1  MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
          + D D D  I  +EL  +L  + G  +++E++  + E    E D++GD  ISF+EF +A+
Sbjct: 2  LLDKDGDGYIDVEELRKLLKAL-GLKLTDEEVEELIEADFNEIDKDGDGRISFEEFLEAM 60

Length = 60
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
KOG0034|consensus187 99.58
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.55
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.46
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.39
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.39
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 99.39
KOG0027|consensus151 99.39
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.28
KOG0027|consensus151 99.26
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.25
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.25
cd0005267 EH Eps15 homology domain; found in proteins implic 99.21
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.21
PF1465866 EF-hand_9: EF-hand domain 99.16
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.15
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.14
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 99.13
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 99.11
KOG0038|consensus189 99.1
KOG0044|consensus193 99.07
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.06
KOG0028|consensus172 99.04
cd0503088 calgranulins Calgranulins: S-100 domain found in p 99.02
PTZ00183158 centrin; Provisional 99.02
PTZ00184149 calmodulin; Provisional 99.01
KOG0028|consensus172 98.95
PTZ00184149 calmodulin; Provisional 98.92
PTZ00183158 centrin; Provisional 98.9
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.89
KOG0030|consensus152 98.84
KOG0037|consensus221 98.79
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.71
KOG0031|consensus171 98.66
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.65
KOG0041|consensus244 98.63
PLN02964 644 phosphatidylserine decarboxylase 98.63
KOG0030|consensus152 98.52
KOG0031|consensus171 98.49
KOG0044|consensus193 98.48
KOG0377|consensus631 98.34
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 98.34
KOG0036|consensus 463 98.33
KOG4065|consensus144 98.31
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 98.23
KOG0037|consensus221 98.23
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.23
PLN02964 644 phosphatidylserine decarboxylase 98.16
KOG0036|consensus 463 98.15
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.04
PRK12309391 transaldolase/EF-hand domain-containing protein; P 98.03
KOG0040|consensus2399 97.99
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.86
KOG0034|consensus187 97.83
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.83
KOG4223|consensus325 97.56
KOG0046|consensus 627 97.47
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.45
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 97.42
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.4
KOG2243|consensus 5019 97.37
KOG4223|consensus325 97.25
KOG2643|consensus489 97.06
KOG3866|consensus 442 97.0
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 96.95
KOG0377|consensus631 96.72
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 96.61
KOG4251|consensus 362 96.42
KOG2643|consensus 489 96.37
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.26
KOG0751|consensus 694 96.25
KOG2562|consensus 493 96.09
KOG4578|consensus421 95.8
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 95.66
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 95.6
cd0005267 EH Eps15 homology domain; found in proteins implic 95.4
KOG1955|consensus 737 95.33
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 95.3
KOG0042|consensus680 95.04
KOG4666|consensus412 94.56
KOG0038|consensus189 94.54
KOG4251|consensus362 94.44
cd0021388 S-100 S-100: S-100 domain, which represents the la 94.21
PRK12309391 transaldolase/EF-hand domain-containing protein; P 94.02
KOG1029|consensus 1118 93.86
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 93.55
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 93.53
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 93.41
KOG2562|consensus493 93.4
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 93.21
KOG4666|consensus412 93.02
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 92.96
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 92.72
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 92.64
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 92.46
KOG0041|consensus 244 92.4
cd0503088 calgranulins Calgranulins: S-100 domain found in p 91.03
KOG0751|consensus 694 90.21
KOG1029|consensus 1118 87.43
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 86.91
KOG0035|consensus890 85.76
KOG0169|consensus 746 84.78
KOG0040|consensus 2399 84.46
cd07313104 terB_like_2 tellurium resistance terB-like protein 84.13
PF0040421 Dockerin_1: Dockerin type I repeat; InterPro: IPR0 81.56
KOG3555|consensus 434 81.56
PF0787964 PHB_acc_N: PHB/PHA accumulation regulator DNA-bind 81.38
PF1217470 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: I 80.65
KOG1707|consensus 625 80.41
PLN02952 599 phosphoinositide phospholipase C 80.01
>KOG0034|consensus Back     alignment and domain information 
Probab=99.58  E-value=1e-14  Score=81.87  Aligned_cols=73  Identities=55%  Similarity=0.896  Sum_probs=65.9

Q ss_pred             CccCCCCCccCHHHHHHHHHHHhCCCCC--HHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHhcc-Cccccceeec
Q psy17264          1 MYDLDNDDAISRDELLAVLHMMVGANIS--EEQLTSIAERTILEADQNGDQMISFDEFCKALERT-DVEQKMSIRF   73 (75)
Q Consensus         1 ~~D~~~~G~i~~~el~~~~~~~~~~~~~--~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~-~~~~~~~~~~   73 (75)
                      +||.+++|+|+.+++..++..+++...+  ++.+..+++.++..+|.+++|+|+++||.+++.+. ...++|.++|
T Consensus       112 vYD~~~~G~I~reel~~iv~~~~~~~~~~~~e~~~~i~d~t~~e~D~d~DG~IsfeEf~~~v~~~P~~~~~m~~~~  187 (187)
T KOG0034|consen  112 VYDLDGDGFISREELKQILRMMVGENDDMSDEQLEDIVDKTFEEADTDGDGKISFEEFCKVVEKQPDLLEKMTIRF  187 (187)
T ss_pred             HhcCCCCCcCcHHHHHHHHHHHHccCCcchHHHHHHHHHHHHHHhCCCCCCcCcHHHHHHHHHcCccHHHHcCCCC
Confidence            5899999999999999999998776666  88899999999999999999999999999999987 7777777654

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 Back     alignment and domain information
>PF00404 Dockerin_1: Dockerin type I repeat; InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ] Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF07879 PHB_acc_N: PHB/PHA accumulation regulator DNA-binding domain; InterPro: IPR012909 This domain is found at the N terminus of the polyhydroxyalkanoate (PHA) synthesis regulators Back     alignment and domain information
>PF12174 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: IPR022003 This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2ct9_A208 The Crystal Structure Of Calcineurin B Homologous P 5e-26
2e30_A195 Solution Structure Of The Cytoplasmic Region Of Na+ 2e-25
2bec_A202 Crystal Structure Of Chp2 In Complex With Its Bindi 1e-20
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 5e-14
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 5e-14
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 5e-14
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 5e-14
>pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 61/74 (82%)
Query: 1   MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
           +YDLD DD ISRDELL VL MMVG NIS+EQL SIA+RTI EADQ+GD  ISF EF K L
Sbjct: 121 LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL 180
Query: 61  ERTDVEQKMSIRFL 74
           E+ DVEQKMSIRFL
Sbjct: 181 EKVDVEQKMSIRFL 194
>pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 Back     alignment and structure
>pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-27
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 2e-26
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-24
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 6e-04
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-19
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 2e-19
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 4e-19
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-18
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 9e-04
3a4u_B143 Multiple coagulation factor deficiency protein 2; 4e-14
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 3e-13
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-12
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 7e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 3e-12
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 4e-12
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 4e-12
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 6e-12
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 7e-12
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 1e-11
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 3e-11
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 4e-11
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 2e-10
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-09
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 2e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 5e-09
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 7e-09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-08
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 4e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 7e-06
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 3e-08
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-08
2hps_A186 Coelenterazine-binding protein with bound coelent; 6e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 3e-08
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 5e-08
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 5e-08
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 7e-08
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 9e-08
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 7e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-07
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 2e-07
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 3e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-06
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 3e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 8e-06
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 9e-05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 4e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 6e-06
2jnf_A158 Troponin C; stretch activated muscle contraction, 5e-07
2jnf_A158 Troponin C; stretch activated muscle contraction, 7e-05
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 7e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 8e-07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 6e-06
1avs_A90 Troponin C; muscle contraction, calcium-activated, 9e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 3e-06
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 1e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-06
3fwb_A161 Cell division control protein 31; gene gating, com 2e-06
3fwb_A161 Cell division control protein 31; gene gating, com 1e-05
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-06
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-04
1y1x_A191 Leishmania major homolog of programmed cell death 2e-06
1y1x_A191 Leishmania major homolog of programmed cell death 7e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-06
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 7e-06
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-06
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-06
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-06
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 3e-06
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 3e-06
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 3e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-06
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-06
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 4e-06
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 3e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 4e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 5e-06
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 5e-06
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-05
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 6e-05
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 5e-06
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 5e-06
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 6e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 6e-06
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 7e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 7e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 2e-04
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 8e-06
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 9e-06
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 5e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 1e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 4e-04
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-05
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 7e-05
1c07_A95 Protein (epidermal growth factor receptor pathway 4e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 5e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-04
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 9e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 9e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 1e-04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 1e-04
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-04
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 2e-04
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-04
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 2e-04
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 2e-04
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 3e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 8e-04
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 6e-04
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
 Score = 97.5 bits (243), Expect = 1e-27
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 1   MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
           +YDLD D  ISR E+L VL +MVG  ++EEQL +IA+RT+ EAD++GD  +SF EF K+L
Sbjct: 122 LYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSL 181

Query: 61  ERTDVEQKMSIRFL 74
           E+ DVEQKMSIR L
Sbjct: 182 EKMDVEQKMSIRIL 195
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.62
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.57
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.53
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.5
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.48
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.47
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.47
3li6_A66 Calcium-binding protein; calcium signaling protein 99.46
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.46
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.45
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.45
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.45
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.45
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.45
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.45
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.45
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.45
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.44
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.43
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.43
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.43
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.42
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.41
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.4
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.4
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.39
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.39
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.39
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.39
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.39
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.38
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.38
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.38
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.38
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.38
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.37
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.37
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.37
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.37
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.36
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.36
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.36
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.36
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.36
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.36
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.36
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.36
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.35
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.35
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.35
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.35
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.34
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.34
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.34
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.34
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.34
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.34
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.33
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.33
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.33
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.33
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.33
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.33
3fwb_A161 Cell division control protein 31; gene gating, com 99.32
1c07_A95 Protein (epidermal growth factor receptor pathway 99.32
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.32
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.31
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.31
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.31
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.31
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.31
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.3
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.3
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.29
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.29
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.29
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.29
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.29
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.29
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.29
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.28
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.28
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.28
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.27
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.26
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.26
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.25
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.25
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.25
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.25
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.25
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.25
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.25
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.25
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.25
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.24
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.24
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.23
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.22
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.21
1y1x_A191 Leishmania major homolog of programmed cell death 99.21
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.21
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.2
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.2
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.19
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.19
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.19
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.19
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.19
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.18
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.18
3fwb_A161 Cell division control protein 31; gene gating, com 99.18
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.18
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.18
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.18
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.17
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.17
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.17
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.17
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.16
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.16
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.16
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.16
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.15
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.15
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.14
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.14
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.14
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.13
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.13
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.12
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.12
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.12
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.11
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.11
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.1
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.09
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.09
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.07
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.06
1y1x_A191 Leishmania major homolog of programmed cell death 99.06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.06
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.05
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.04
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.04
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.03
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.03
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.03
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.03
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.02
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.02
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.01
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.01
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.01
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.01
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.01
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.0
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.0
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.0
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.99
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.99
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.99
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.99
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 98.99
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.98
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.98
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.98
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.98
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.97
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.97
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 98.97
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.97
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.96
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.95
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.94
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.94
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.94
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.94
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.94
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.93
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.93
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.93
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.92
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.92
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.92
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.91
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.91
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.9
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.9
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.88
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.88
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.86
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.86
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.86
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.85
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.85
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.84
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.84
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.82
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.82
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.82
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.82
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.82
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.8
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.8
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.8
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.77
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.77
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.76
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.76
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.75
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.74
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.73
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.71
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.71
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.71
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.7
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.69
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.68
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.68
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.67
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.66
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.65
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.65
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.61
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.57
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.55
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.52
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.51
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.42
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.4
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.37
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.35
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.27
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.26
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.25
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.25
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.23
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.23
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.22
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.22
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.14
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.09
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.98
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.88
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.85
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.73
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.66
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.63
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.63
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.63
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.2
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 97.16
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.09
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.02
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.01
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.87
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 96.87
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 96.69
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 96.66
3li6_A66 Calcium-binding protein; calcium signaling protein 96.65
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 96.65
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 96.64
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 96.59
1c07_A95 Protein (epidermal growth factor receptor pathway 96.54
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 96.54
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 96.52
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 96.49
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 96.49
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 96.47
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 96.38
1avs_A90 Troponin C; muscle contraction, calcium-activated, 96.38
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 96.13
1qjt_A99 EH1, epidermal growth factor receptor substrate su 96.12
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 96.11
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 96.11
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 96.02
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 95.98
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 95.89
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 95.88
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 95.69
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 95.43
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 95.28
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 95.16
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 95.02
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 95.0
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 94.96
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 94.81
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 94.76
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 94.74
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 94.72
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 94.7
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 94.63
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.62
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 94.49
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 94.34
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 94.32
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 94.05
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 94.05
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.99
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 93.85
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 93.82
2jq6_A139 EH domain-containing protein 1; metal binding prot 93.76
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 93.76
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 93.75
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 93.65
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 93.6
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 92.67
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 92.45
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 92.35
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 91.15
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 91.07
4dxt_A 198 SUN domain-containing protein 2; beta-sandwich, LI 90.44
1daq_A71 Endoglucanase SS, CELS; cellulose degradation, cel 89.6
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 89.14
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 88.87
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 88.84
3tdu_A 200 DCN1-like protein 1; E2:E3, ligase-protein binding 87.94
3uo9_A 534 Glutaminase kidney isoform, mitochondrial; hydrola 87.91
3kev_A 199 Galieria sulfuraria DCUN1 domain-containing prote; 87.57
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 87.45
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 86.89
3kcp_A321 Cellulosomal-scaffolding protein A; dockerin, X-mo 84.36
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 83.28
4dck_A 168 Sodium channel protein type 5 subunit alpha; IQ-mo 81.34
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 81.09
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=1.2e-15  Score=77.51  Aligned_cols=56  Identities=32%  Similarity=0.515  Sum_probs=52.4

Q ss_pred             CccCCCCCccCHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHh
Q psy17264          1 MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALE   61 (75)
Q Consensus         1 ~~D~~~~G~i~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~   61 (75)
                      .||.|++|+|+.+||+.+++.+ |..+++++++.+    ++.+|.+++|.|+|+||+.+|.
T Consensus        44 ~~D~d~~G~I~~~El~~~l~~l-g~~~~~~ei~~l----~~~~D~d~dG~I~~~EF~~~m~   99 (100)
T 2lv7_A           44 VFDRDGNGFISKQELGTAMRSL-GYMPNEVELEVI----IQRLDMDGDGQVDFEEFVTLLG   99 (100)
T ss_dssp             HTCSSCSSCBCHHHHHHHHHHH-TCCCCTTTHHHH----HHHHCSSCSSSBCHHHHHHHTC
T ss_pred             HHcCCCCCcCCHHHHHHHHHHh-CCCCCHHHHHHH----HHHHCCCCCCeEeHHHHHHHhC
Confidence            3799999999999999999995 999999999888    9999999999999999999875
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4dxt_A SUN domain-containing protein 2; beta-sandwich, LINC complex, structural protein; 2.22A {Homo sapiens} PDB: 3unp_A 4dxr_A* 4dxs_A* 4fi9_A Back     alignment and structure
>1daq_A Endoglucanase SS, CELS; cellulose degradation, cellulosome, calcium-binding, hydrolase; NMR {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1dav_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 3p0d_C 4fl4_C 2b59_B Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 8e-10
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 5e-09
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 4e-08
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 1e-07
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 3e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 5e-07
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 9e-07
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-06
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-06
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 1e-05
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 2e-05
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-05
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-05
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 3e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 5e-05
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 7e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 7e-05
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-04
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 3e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-04
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-04
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 5e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-04
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 5e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 6e-04
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 9e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.001
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 0.001
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.001
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 0.001
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.001
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.002
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 0.002
d1sraa_151 a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR 0.003
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.003
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 0.003
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.003
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 0.004
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 0.004
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcineurin regulatory subunit (B-chain)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.7 bits (117), Expect = 8e-10
 Identities = 33/71 (46%), Positives = 47/71 (66%)

Query: 1   MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKAL 60
           +YD+D D  IS  EL  VL MMVG N+ + QL  I ++TI+ AD++GD  ISF+EFC  +
Sbjct: 93  IYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVV 152

Query: 61  ERTDVEQKMSI 71
              D+ +KM +
Sbjct: 153 GGLDIHKKMVV 163
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.64
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.61
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.61
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.61
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.59
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.59
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.57
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.56
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.53
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.53
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.51
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.5
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.46
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.43
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.43
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.42
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.42
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.41
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.4
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.39
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.39
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.39
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.37
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.36
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.35
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.35
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.35
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.34
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.34
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.31
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.31
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.31
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.3
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.28
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.27
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.27
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.27
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.24
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.23
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.2
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.19
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.19
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.18
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.12
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.1
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.09
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.08
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.08
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.08
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.07
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.06
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.05
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.05
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.04
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.04
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 99.03
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.02
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.02
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.02
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.99
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.98
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.98
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.97
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.93
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.93
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.92
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.91
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.9
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.89
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.88
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 98.83
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.83
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.81
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.78
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.77
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.75
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.74
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.71
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.68
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.65
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.63
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.62
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.62
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.56
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.55
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.55
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.54
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.54
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.45
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.4
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.38
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.37
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.36
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.35
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.33
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.33
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.32
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.31
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.24
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.14
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.05
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.01
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.98
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.93
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.88
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.83
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.81
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.78
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.67
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.55
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.54
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 97.45
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 97.42
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.39
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 97.38
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 97.37
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.33
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 97.3
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.19
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 96.91
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.91
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 96.8
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 96.58
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 96.55
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 96.47
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 95.77
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 95.48
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 95.3
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 95.25
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 95.19
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 95.03
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.99
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 94.89
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 94.53
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 94.48
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 94.19
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 94.1
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.98
d2b59b160 Cellulosomal scaffolding protein A {Clostridium th 93.88
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 93.69
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 92.48
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 92.22
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 92.21
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 91.61
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 89.78
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 89.75
d3buxb186 Cbl {Human (Homo sapiens) [TaxId: 9606]} 85.81
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.64  E-value=4.8e-16  Score=74.23  Aligned_cols=57  Identities=33%  Similarity=0.597  Sum_probs=53.4

Q ss_pred             CccCCCCCccCHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHhc
Q psy17264          1 MYDLDNDDAISRDELLAVLHMMVGANISEEQLTSIAERTILEADQNGDQMISFDEFCKALER   62 (75)
Q Consensus         1 ~~D~~~~G~i~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~   62 (75)
                      .||.+++|+|+..+|+.+++.+ +..+++++++.+    ++.+|.+++|+|+|+||+++|..
T Consensus        17 ~fD~~~~G~I~~~el~~~l~~l-g~~~~~~e~~~~----~~~~D~d~dg~I~~~EF~~~m~~   73 (75)
T d1jc2a_          17 IFDKNADGFIDIEELGEILRAT-GEHVIEEDIEDL----MKDSDKNNDGRIDFDEFLKMMEG   73 (75)
T ss_dssp             HHCCSTTSSEEHHHHHHHHHHS-SSCCCHHHHHHH----HHHHCSSSCSEECHHHHHHHHHT
T ss_pred             HHcCCCcCeEcHHHHHHHHHhc-CCCccHHHHHHH----HHHhCCCCCCcEeHHHHHHHHHh
Confidence            3799999999999999999995 999999999888    99999999999999999999864
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d3buxb1 a.39.1.7 (B:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure